BYKdb

Dataset for cluster tadcd of phylum candidatus-vecturithrix

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A081BXV5      --------------------MFDEVIQLREYVHILKKRRWIILTVTFLTVVAITIWTFRQ
A0A0S6W9T1      MIPCEEGKKTDFPKTKGGKDVFQEEVHLRDYLRIIKKRQWVILTFFVIVVVSVAITTFLK
                                    :*:* ::**:*:.*:***.*:***. .:.**:::* ** :

A0A081BXV5      IPIYEATTRILIEKESPNLIAFEEVLKLDTSAQDYYQTQYMILMSRSLAKEVLKKLGLTD
A0A0S6W9T1      SPIYRATTRILIEKETPNVLSFKEVLALDTSDTDYYQTQYTILKSRTLAKEVLEKLGLME
                 *** **********:**:::*:*** ****  ******* ** **:******:**** :

A0A081BXV5      LQRPQVQMFFSVRGIFNELAEKLGLSTPAPSPESDETIDKEERLVNEFLQS-ITVSPIRG
A0A0S6W9T1      QAMQTESRSFSIRGLVSGLIVLLGLRESL--SEEAQNRAREQQAIDHFLNDMITIEPIKG
                      .  **:**:.. *   ***  .   .*. :.  .*:. :: **:. **:.**.*

A0A081BXV5      SRLVDIKAISTDRQQAAMLANTLADVYIERNLDDKLVASKDAVLWLEKEVEITQKKVADS
A0A0S6W9T1      SRLVDVNAFSTDPKLAANIANTLVATYIQQNLEAKLSASKDAVGWLAEQLKVTQQKVADS
                *****::*:*** : ** :****. .**:.**: ** ****** ** :::::**:*****

A0A081BXV5      EAALQQYKEEHGILSFEERQNIIMQKLLELNTAVNEAKIKRAAIEAQYKQVQKYQS----
A0A0S6W9T1      ENALFQYKEQHAIISFEDRQNMVMQKLSELNTAVNNARIKRITAETQYNQIQEYLAAVES
                * ** ****:*.*:***:***::**** *******:*.*** : *:**:*:*:* :    

A0A081BXV5      -------DKVESLSVVINNPLIQGLKVELANLESELSQLRKKFRDKHPNMTALQSQIDAT
A0A0S6W9T1      SSNAKAIEKLESISQVINNPLIQRLKVELSTLESELSDLLKKFRNKHPNVIALRSQIDSV
                       :*:**:* ******** *****:.******:* ****:****: **.****:.

A0A081BXV5      KSRLNTEIKRIFDSLKSDYEVALAQEKDLSKMLEEQKHEAMDLNKKAIRYGELQREVESN
A0A0S6W9T1      RNRINSEISRIVTSIKNEYDLALAQEQEMTAALEEQKREALDLNEKSIQYGVLDREVQSN
                ..*:*:**.**. *:*.:*::*****::::  *****.**:***:*:*.** *:***:**

A0A081BXV5      HRVYNELLQRTKETNVTERLQTNNIRIVDHAVVPNSPIAPKKIRNILLAMVVGLTMGIGL
A0A0S6W9T1      KRVYDALLQRTKETSVTEQLETSNIRIIDQASIPNYPVAPRKKLNIFLAMVMGAVLGTAL
                :***: ********.***.*:*.****:*:* :** *:**.*  **:****:* .:* .*

A0A081BXV5      AFFFEFWDNSIKTSDDIKQYLDMPFLGFIPKVYGKEYSNNG-NNGTRAKPDMIVAIDPKS
A0A0S6W9T1      AFFFEYIDNSIKTPEDIKQYVNIPFLGFIPKV---SYEHPALLNSSPYSIELVAAFDPKS
                *****: ******.:*****:::*********   .*.: .  *.:  . :::.*:****

A0A081BXV5      SASEAYRTLRTNVVFSLVSDEERALDLDFGSVMLVTSPGPAEGKSCIVANLGIAMAQSGS
A0A0S6W9T1      TVSEAYRSLRTNVLFS---------SLERGPVLLVTSAGPTEGKSITVANLAVTMAQSGS
                :.*****:*****:**         .*: *.*:****.**:****  ****.::******

A0A081BXV5      KTLIIDCDLRKPVMHKIFNV-NNDRGFADMMADIKTYGTKVVVKHTKIKNLDVIPCGKIP
A0A0S6W9T1      KTLIIDCDLRKPRMHKIFNIAEHEQGITDMIANLGTNGLRITVKRTKIPNLDLIPCGKIP
                ************ ******: :::.*::**:*:: * * .:.**.*** ***:*******

A0A081BXV5      PNPSELLGSSLARIVIEALAERYDKILIDSPPVNTVTDPILLSRIADGIVFIVHAGQTKR
A0A0S6W9T1      PNPSELLGSERTRRLIEALSKVYDKILIDSPPVNVVTDPVILSQIAGGVIIIIRAGETGR
                *********. :* :****:: ************.****::**.**.*:::*:.**:* *

A0A081BXV5      DVAQRARDQLLSADAVILGGVINSVDLKKDSYYYYYSYYHSHYYTQDGKKQLNAAA----
A0A0S6W9T1      DVVRRAREQLLDVKANILGGVLNSVDLKKDN-YYYYSYYHNYYYHRD-QNELNQATKETR
                **..***:***...* *****:********. ********.:** .* :::** *:    

A0A081BXV5      ---------------------------------
A0A0S6W9T1      LPIKYPQKVLQAANLMKKGSSIEPSDKPQQGSS
                                                 

© 1998-2019