BYKdb

Dataset for cluster tadcd of phylum candidatus-wallbacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2N1PQJ6      MKEEIRKEFSLHDYFHVIEKRLVTVISTIVIVVGLVALFNWRQIPTYVTSGKVMVERAR-
A0A2N1PV92      MHEE---EIDLKEYFRIVYKRKWIILLTVMAITVIGILISFALPPVYQGSTVLLVETNKQ
                *:**   *:.*::**.:: **   :: *:: :. :  *:.:   *.*  *  ::**  . 

A0A2N1PQJ6      ----------------------SVIQSLNVMQSLLLSLNNYIEIIKSRKFLGKVVDKINE
A0A2N1PV92      TMPMLMMEFADMGKGDAIQTQCEIVKSRSVVEAAVRHLNLVNRPSEYNTFLKNILTYVGF
                                      .:::* .*::: :  **      : ..** :::  :. 

A0A2N1PQJ6      TEPGIV----------------------------TLEDLQDKISVSPVPGTDLLEIKGLG
A0A2N1PV92      GDKGWARSLIAFSESRNRKSDKNLKLPEAERFRKIVEDLQKNLSVKTLKKTDLINITVDS
                 : * .                             :****.::**..:  ***::*.  .

A0A2N1PQJ6      SDPKVLKMTVDTVIDFFVRDSEEVQGDVARGNLEYLKNQLDNLEEQLRTSERDLREFQQR
A0A2N1PV92      ESPSLASDLANTIADEYIKLSLNARRGEAKSVKDFVNNQLEIRESELRDLEKLLREFKEQ
                ..*.: .  .:*: * ::. * :.. . *..  ::::***:  *.:**  *. ****::.

A0A2N1PQJ6      EKVYSLPKEMEQFHQDLIRWQSEKTQLDMELELTEKAIESLTSELKTYAGMTGLGGDKGS
A0A2N1PV92      KGIVSLSEETKIDLEKEAEFGKALEEVRVEREALKIKVENIEKDLNEQEKLVVSSSTLTK
                : : **.:* :   :.   : .   :: :* *  :  :*.: .:*:    :.  ..   .

A0A2N1PQJ6      NSMESELSA--LEREYATASKLYKGKHPKLIEVRQKISAIKKSFQAIASGNYLAIGG---
A0A2N1PV92      NPILDQLKSQKIDLELKMERLISDGLTPNHPDIKKINAEISQTERKIVNEESKVFGSKVY
                *.: .:*.:  :: *      : .*  *:  ::.:  : *.:: . *.. :  .:*.   

A0A2N1PQJ6      TNDPIFNELKTQLLQKKIDIFNMRVKRNSLEELIKDKSSSLENVPEKNLVYVRLSRKLSV
A0A2N1PV92      TLNEIRRKLEGEYLESRALFKALEVKQSELEKICAQYDRKFENLPKLELEYLRIQRDIKV
                * : * .:*: : *:..  :  : **...**::  : . .:**:*: :* *:*:.*.:.*

A0A2N1PQJ6      TEKIYSSLLQKFNEAQIQASSMTSKARVVDYSREPKEPIMPNKKLNLFIAFVASIITGIG
A0A2N1PV92      TEEIFVMLAKKKEESRISEAMEIGNIRIIDSSIIPIKPIKPKKALNAVISFILGIMLSLG
                **:*:  * :* :*:.*. :   .: *::* *  * :** *:* ** .*:*: .*: .:*

A0A2N1PQJ6      FAFLKEHLDKSIKTSEEAKIIFERPVLGLVPQFRSSELKESRKVIEKSKIFISPSLLTYS
A0A2N1PV92      LAFTIEFFDTSFKSAEDVEKYLSLAVLGSIPFIKKDGLAD--KVVDEPGEGRAARLITEL
                :**  *.:*.*:*::*:.:  :. .*** :* :... * :  **:::.    :. *:*  

A0A2N1PQJ6      ELNTMSSESFRTMRTNILYANDENQVKTLLLTNAQAAAGKSTVVANIAISFAQIDKRVLV
A0A2N1PV92      DPKSPVAETYRSLRTNIQFVNIDKKIRTLLVTSAGPSEGKSTTISNLAVTYAQMGHRTLL
                : ::  :*::*::**** :.* ::::.***:*.* .: ****.::*:*:::**:.:*.*:

A0A2N1PQJ6      VDADLRKPIMHKLFNLDNSMGLTNALLGA-DIEGLISRTSIKNLDIMTSGPLPPNPSELL
A0A2N1PV92      VDCDLRKPMLHNIFHLERDRGLTNILVGGMNHKDAIVESGIDNLALLPTGPIPPNPSELL
                **.*****::*::*:*:.. **** *:*. : :. *  :.*.** ::.:**:********

A0A2N1PQJ6      ASSRMVEVIEICKANYDLVIFDSPPVIAVTDAAVIASKVDGVLYLVSLRRVARKQAEKGM
A0A2N1PV92      GSNKMSELLEILSREFAMILIDAPPILAVTDAAVLSPKLDGVLMVIHSEKTERESSKRAK
                .*..* *::** . :: ::::*:**::*******::.*:**** ::   .. *:.::.. 

A0A2N1PQJ6      ELLENVNANVFGVVCNFVKERELGGYYYRYGYI--------------
A0A2N1PV92      ILLDHVGANIIGVVLNGVTAGSGHGYYYYYYYGPTGEKTRSGKRKEG
                 **::*.**::*** * *.  .  **** * *               

© 1998-2019