BYKdb

Dataset for cluster orphancd of phylum chlamydiae

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0U0XQN3      MALFRKKRGTDDTIKHGAKLITVADPRSAVSEQFRTIRTNINFMAVDEEISTLAFTSANI
A0A0E9F2I6      ---------MPSLEL----AKNKEKTIKKTEEYYNALRTNIQLS--GDNIKVIAITSVQS
A0A0E9FNN9      -------------------MAKKKRNQFDVDEIYRGLRTNIEFSQMDDKIQVINVVSTAP
A0A1X6W5W9      ---------MSRLDSKNRPIIADINKKSPISEAYRTLRTNIDFSSIDHQIQVIMVTSPGP
                                              .* :. :****::   . :*..: ..*   

A0A0U0XQN3      SEGKSTVTANVAITYAQAGRKTLLIDADLRRPTLHSTFNVKNN-TGLTTVLTSEADAINL
A0A0E9F2I6      GEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMSGIFKTRDKITGLTDYLAGATD---L
A0A0E9FNN9      NEGKSTVSTNLARIMAAKYKNVLLIDCDLRNPSVHKLLHISNR-SGLSNIMSQFKE---E
A0A1X6W5W9      GEGKSTTTANLATVYAQAEKKVLVIDADLRKPTMHQTFVKTNR-WGLTSVLAGQSP---F
                .*****.::*:*   *    :.*:**.*:*.. :   :   :.  **:  ::        

A0A0U0XQN3      NDVVEESGI--------DNLSILTSGPIPPNPAELIGSRRMETFIELVKSHYDMVIIDLA
A0A0E9F2I6      SNGLCETNI--------DNLFVIESGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTP
A0A0E9FNN9      TPVREYDGVQEHVFPNGETLSVITTGHKVPNPSEVLGSRRLGAFLNQARKSFGYIILDCP
A0A1X6W5W9      AKVIAKTHI--------DNLDLLTSGPVPPNPSEMLSSKRLSALLEELRTQYDVILMDTP
                        :        :.* :: :*   ***: :: *..:  :::  .. :. :::* .

A0A0U0XQN3      PVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGG
A0A0E9F2I6      PIGLVIDAAIIAQKCDASVLIVESGNVKRKTLQKAKEQLEQTGTPFLGVVLNKYDIQLEK
A0A0E9FNN9      PIAVSSDSIPVCNVSDGVLFVVDSKTADKRKVKSAINDVQRNGGNVFGIVLNKVEEFSDK
A0A1X6W5W9      PVLVVTDAQLIAAKSDGVLMVIDSGKVKRESALKAKASLELVQARMLGVVLNNVDQRRNE
                *:    *:  :.   *. :::: .  ...     *   ::     .:* *:*.       

A0A0U0XQN3      YGYGYGYGYGYGYGAEKKKGLFGRKKSDDQ
A0A0E9F2I6      Y---GSYGNYGNYGNYGKKK----------
A0A0E9FNN9      H---YGYGYGYGYGQEDKDNA---------
A0A1X6W5W9      D------SYYYYYGTQE-------------
                       .    **                

© 1998-2019