BYKdb

Dataset for cluster orphancd of phylum chlorobi

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A136N8H5      ------------------------------------------------------------
A0A136K9F1      MENNPTGNFINQYQLNNGTEDSGRDTLRDYLVILRMHWVAIALIFAAAMCVTIVYILTAT
Q3B4U4          ---------------------------------------MIVLMVGTLVVAMLFYLFKTP
                                                                            

A0A136N8H5      ------------------------------------------------------------
A0A136K9F1      NYYSTTTSIKINKPQESILSSSIFTDFGGQQADRFIANEIDLMQTYPIRQKAAKFI----
Q3B4U4          EYHAVSVVMIKEDKQSNDLLQTILGPEAGMDINA-SKKDIALFKSMPIARLTIEQLERNL
                                                                            

A0A136N8H5      ------------------------------------------------------------
A0A136K9F1      ----LDTLQTIEDKSALYYLYS--DPENISQGFRT----------VESMAKLLSDIVAID
Q3B4U4          KGKPLELFGSRDYTSPLMALFTKLQPSSIGNAFPSETDGLSKEELLRQRCLLLTKRIRVE
                                                                            

A0A136N8H5      ------------------------------------------------------------
A0A136K9F1      QKRGLDVVTLVAESPSPIEATIISNLYARAYSEYSLELSRKDLTNTISFLVKEKDRKMRD
Q3B4U4          PVKDTNMLNISVASPFADEAELLTNTICEVYRQADISRNSEKYAQANSYIAKSLVEQQSK
                                                                            

A0A136N8H5      ------------------------------------------------------------
A0A136K9F1      LNNAEASLEDFQKRSGLINLDVQSEQLVNSISELDKAKGYAQVEITGNQTKYNELSAEIK
Q3B4U4          VDEADRALSLFMTHNEIYEVSGNTQQLLDKLVEADAQYNTIQAEYHTVGNTLRFLEQRLS
                                                                            

A0A136N8H5      ------------------------------------------------------------
A0A136K9F1      KIDPQLVTFLEGELSGKYVTDLQAKISELELQKSIELSNTQTQAVRDKIIGDYEQRLQPL
Q3B4U4          ESDKAIGSQIEQTVNSK----LGAIMDEIRGLESSYVALLKQKGADDPAVRAAKVRLEEV
                                                                            

A0A136N8H5      -------------MKEGAQSNTPDEMRSLTYKYFETKIVNNQNKIKEGLLKNYMNKYQEK
A0A136K9F1      RN---SLNEKVMKLEEALYVQTPEERRELIQELLLAGVQRSESKSRLNIISGMLGKYERE
Q3B4U4          KSRYATLQRSQIAGEIGYAGRAKKFGFDMVSEKLQIERKLNELQFRAGELSRIRQYYEQQ
                              : .   .: .   .:  : :      .: : . . :.     *: :

A0A136N8H5      FNKLPAQSIEYANLERERLANEKVYLMLLEKYQEALINEESQPNNVKIIDYGKVPKAPSK
A0A136K9F1      FSLLPSQALELAKIERQRLSSEKLYLLLEEKYQEALINQNARIGNVLITDPARVPSQPSK
Q3B4U4          LSSLPNKQQEYLKLERDRNVAGKTYAELKQKFDETSIFLGSEVGGVSLIGAAFRPFFPES
                :. ** :  *  ::**:*    * *  * :*::*: *   :  ..* : . .  *  *..

A0A136N8H5      PNRFLIITIGLLIGLGLGYGFALLRNILDVSVKSPEDLENIGISLIGWVPTF--------
A0A136K9F1      PKKTIVLLAGVLIGLGLGFGYAFGRNYLDRSIKNPEEIEKKGVTILAWIPSIDTLKE---
Q3B4U4          PSLLKSLLLGVLFGGMLAIGYAYIEEAMDGTLQDECLYDEIGLRPLSVIPTVGSARNPAV
                *.    :  *:*:*  *. *:*   : :* :::.    :: *:  :. :*:.        

A0A136N8H5      ------------------------MREPKAGRHTHTEQELVLAYNSDSVPAEAFRTLRTR
A0A136K9F1      ----------FKGGSPDEL---------------------VVLNKSTSTAAESFKALRTR
Q3B4U4          PPSGSSRMLSHVGNSFGKLLPDASSRQSPSGREDAAQLIPLITDNLTSSFAESIRILRTS
                                                        ::  :  *  **::. *** 

A0A136N8H5      LQFSKLEPEPIKTILITSSIPREGKTIISSNLAASFAL-SSRVLLLDCDFRKPRMHNIFN
A0A136K9F1      VQFSKLEEKPLKSILVTSSIPGEGKTFVSSNLASSFAIDNKKVLLLDCDLRKPRLHNVFA
Q3B4U4          IQYSR-QGSPPQSILISGTAMWEGKSTVCLNLGMAYALVGKKTLIIDCDLRRPSQHVKLN
                :*:*. : .* ::**::.:   ***: :. **. ::*: ....*::***:*.*  *  : 

A0A136N8H5      MKRYPGLCDYLFGTVPIEDA--VRETSFPNLHIMTCGTIPTNPAELIASKHMQTFLNMIK
A0A136K9F1      ADRFPGLSDYLFSNVELEDI--IRDSQNENLKFITAGTIPPNPSELLGSVQMKKFLELLE
Q3B4U4          CLRGPGLTDYLLSSDGDSCVPNIQNTRMENLFLLSAGLNVSGSSELLASKKMQGLLSVMR
                  * *** ***:..   .    :.::   ** :::.*   ...:**:.* :*: :*.:: 

A0A136N8H5      PKYDYILIDSPPLATVTDAELLSSYVDGTVVVCLASKTRLDLLVNTIDTLNKIN-DTFIG
A0A136K9F1      NKFDMIVIDSPPLISVTDSEILFAVTDGGILVAKAQKTPIDVVMKSANTVNNINPRNFLG
Q3B4U4          KRFDCILLDCPPFF-LSDASQISALTDGVVLVSRLQYT--ERKMLQSIIADPAVKDALLG
                 .:* *::*.**:  ::*:. : : .** ::*.  . *  :  :      :      ::*

A0A136N8H5      VIL---NNFDYQATYGSYYKYYYYYYGSEKGKEGASATNGKSSNGVNNNGNLKEKTIKPN
A0A136K9F1      CVL---NDFNVKGSYGYYYNYYYYYSKPEQKANA--------------------------
Q3B4U4          VALIATPELSRKGYLGKYGNGVY---EEDPLLLT--------------------------
                  *    ::. :.  * * :  *     :                               

© 1998-2019