BYKdb

Dataset for cluster tadcd of phylum chlorobi

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A136PFK4      MPCSGGWRLRTVVEQARTLRPRSNPRFPFSPILLPGYIALGAFFRMASNNNYPYGRDGAN
A0A136K9M8      ------------------------------------------------------------
B3QVI2          ------------------------------------------MSKDFLNGNQAVATNSGS
B3QXQ6          --------------------------------------------MSSFNGN----MKDGS
A0A1D8D4L1      ----------------------------------------------MDYKSHQAVTGNQV
A1BJQ6          ----------------------------------------------MKVEQQTPIKQQEE
A4SF30          ----------------------------------------------MKNESRLLGSGNND
A0A081SFU7      -----------------------------------------------MENSKENGYAANG
A0A395LXF8      -----------------------------------------------MQNIKANGYRAGG
B4SD09          -------------------------------------------------------MMVEK
B3EF76          ------------------------------------------------------------
A0A222SG44      ------------------------------------------------------------
A0A317T3L6      ------------------------------------------------------------
A0A422HIT8      ------------------------------------------------------------
A0A1B1Q171      ------------------------------------------------------------
A0A1W6HT77      ------------------------------------------------------------
B3EME9          ------------------------------------------------------------
A0A369RAQ9      ------------------------------------------------------------
B4S3Z6          ------------------------------------------------------------
                                                                            

A0A136PFK4      GSQLPSRSQQFSPARPQPYNTDMVRLQRT----LRDVDEKKNRLQWLDYVGLLWRGKWII
A0A136K9M8      ------------------------------------------------------MDWIYV
B3QVI2          NYPVFQRESDFLELEDD------FDFKRI----FS----------------LLLRYKWLI
B3QXQ6          YYS--KSKTMPFQVEEEDISVLIFNYLRA----LS-------------------RGKWVI
A0A1D8D4L1      QVQ----------DDKE------ITLAEI----FQ----------------IIARRKIGI
A1BJQ6          IER----------GERE------ISLEEI----FK----------------IVLRRKYGI
A4SF30          GSRHTEYAAHHSAARRE------ITVDEL----FR----------------IIRRRRFGI
A0A081SFU7      GASKFYRQLQQAQLEQE------EDFGVVFYNYLR----------------ALLKGKWVI
A0A395LXF8      EVPMPDHRTLRQALQED------DDNADLYYRYLR----------------ALLRGKWII
B4SD09          ETTLSTQSNNEQTQGSE------ISLGEI----LK----------------IILRRKYGI
B3EF76          -------MPEQNNFEQE------INIQEL----LR----------------LLWGRKYLI
A0A222SG44      -------MLEMKDAGSQ------LNVQEL----LR----------------LAWKNRYVI
A0A317T3L6      ------MADNENQIEQE------INIQEL----LQ----------------ILWKNRVLI
A0A422HIT8      MQDPTPQSQQGNQFEQE------INIQEL----LQ----------------VLWKNKLII
A0A1B1Q171      MTPDHN-----NQFEQE------IDIKEL----LF----------------TLWHNRLVI
A0A1W6HT77      MQDPTPHSQSGNQFEQE------INIQEL----LQ----------------VLWKNKLII
B3EME9          MPNNDP-----NQFEQE------INIQEL----LQ----------------VLWQNRLII
A0A369RAQ9      MTNNDP-----NQFEQE------INIQEL----LQ----------------VLWNNKLII
B4S3Z6          MTNNDP-----NQFEQE------INIQEL----LQ----------------VLWNNKLII
                                                                        .  :

A0A136PFK4      LACLLVMGSLAAWYTYSLPFIYESSLQILVNEKDQ------SIDLLNNRNYWSNTD--RE
A0A136K9M8      LLIFLGVLLTTVFYVLNARNIYESTTVIKITKPQG----SILTSSPIPEFQDFGFLSDRY
B3QVI2          LSSVIFSTLISALAIYFSLPIYKSEGTMLVQESSGKLGRGAGSDLSNLLASTYGVGMGST
B3QXQ6          LITFVATVLISVIYSFRQKDIYEGITSVLVRDNTRQ----------SSVIVNFSVTDRRN
A0A1D8D4L1      GIIVSLSLLVSILFYYSQTPEYRAVSVLMINQKND------SQGLVEAVLGGGPAADSKM
A1BJQ6          ILVMALSLFAAIFYHYTETPEYHAVAVMMINDNKE------PTDLLATVLGSGAAVDNKA
A4SF30          LVLMGASLVLTMLVYVLQKPEYHAVSVVMIKDDKR------PSDLLQAVLGPDASVDMNA
A0A081SFU7      LFLFLVSTTIGILVSRSQKNIYEGVTSVLVKNTKS------SASVVVSLDLQER----ES
A0A395LXF8      LILFLTSVLVGYLINVSQPDIYEGVTTALVNNTRS------NASVIISLDVMQQRG--ES
B4SD09          LLILIASLVMAWIYNKAQTPEYHAVSVMMINENKA------PGDLLATLLGPSAGVDTKS
B3EF76          LAVTAASLALALLFRYSATPEFRSTAVVMIKDSNG-----SEGDVLAPMLAVMPSSFIDP
A0A222SG44      GLITGLALVIALFIYLSARPVYSATATIMLKSSQKE---ELVGELSGS-ERVGEMQ----
A0A317T3L6      GVVTGLALVLVLLYHFSATPEYRSTSVVLIKTDKG-----GVGEMINPFESMTGFE----
A0A422HIT8      GAVTGLVVVLVLLYHFSATPEYRSTSVVLIKSDKGA---AAMGEMINPFESMTGFE----
A0A1B1Q171      GAVTVAALLIVFLMYLGSTPEYRSTSMVLIKSSKS----S-PAELMTPFESMTGSQ----
A0A1W6HT77      AAVTGIVVFMVLIYHFSATPEYRSTSIVLIKNDKG----VVTGEMINPFESLTGFE----
B3EME9          GAVTGVVLVLVMLYHFSATPEYRSTSVVLIKSDKG----G-MSEMINPFESMTGFE----
A0A369RAQ9      GAVTGLVVLLVLLYHFSATPEYRSTSMVLIKQDKG----GAMGEMINPFGSLTGFD----
B4S3Z6          GAVTGLVVMLVLLYHFSATPEYRSTSMVLIKQDKG----GAMGEMINPFGSLTGFD----
                                     : .     :                              

A0A136PFK4      LKKELQILTSRPIYEKAAQRLLTLRYTDTIRRKTVLPML-------------------VA
A0A136K9M8      ISNEIEVLKSFSIRSLTAKTLLD-----------------SAEANGNISSFYHLLNDPDD
B3QVI2          IANELFVLQSR----KMSYKLAKVLLQERWQKGGELYPLLWEKYPD--------------
B3QXQ6          LANEIEILKSRTLAEQVAYKLLQIIYRDPIRKTDTLDII---KGAG--------------
A0A1D8D4L1      AQKDVELLQSLPVADMTVRALWN------SSRRDSLEFFGYRPYISPIRRLVDWIAPVKP
A1BJQ6          VKKDVELIKSMPIAMLAVGELYK------SARRDSLEFFEKRIYRSPVSRFFSQLNVFTP
A4SF30          SKKDIALIKSMPIAELTIKELER------SRNGKALEIFGNKTYQSPVIALVSHI---VP
A0A081SFU7      YADEIEILKSRTVAEEVAYKLLQIVFKDETTKKDTLDLIR--------------------
A0A395LXF8      NVDDIEILKSRTVSEEVAYKLLQWVYKNPSEKKDTLSIIL--------------------
B4SD09          ARKDVELLQSHPIAELTVKELYK------TTRKDSLEFFGKRKYVSPIDFLFSAI----D
B3EF76          MKNDIELMSSLPIAEKAVEQLYR------SPMRDSLELFGKRRYISPIDRLLAF--AGLQ
A0A222SG44      VQNHLQLLASVPLAEEVIRSLVA------GGAQDSLELFGNRPYKTKIQGFLDGM-FGVS
A0A317T3L6      LQNDIELIKSFPLAEEVVRDLAA------RKDRDSLQLFGERRYVSPIGALFSGLQFG--
A0A422HIT8      LQNDIELIKSFPLAEEVVRDLFR------KTDRDSLQLFGERRYVSPLQGLFGGLSFGSA
A0A1B1Q171      LQNDIELIKSFPLAEEVVRSLYR------QTERDSLELFRERRYISPLARFFG---AGNG
A0A1W6HT77      LQNDIELIKSFPLAEEVVRDLYQ------QQDRDSLQLFGERRYVSPLKDLFGGLSFGFG
B3EME9          LQNDIELVKSFPLAEEVVRELYA------RKDRDSLQLFGERRYISPIGHLFSWMRF--G
A0A369RAQ9      LQNDIELVKSFPLAEEVVRNLYT------KKDRDTLQIFGERNYVSPIGGLFGWLSFG-G
B4S3Z6          LQNDIELVKSFPLAEEVVRNLYT------KKDRDTLQLFGERNYVSPIGGLFGWLSFG-G
                  . : :: *          *                                       

A0A136PFK4      VEAKLGTASHNQSSQDRHARLIDEVVESLHKMIEVKPSKD-ADIIQVITRAGDPLEAALV
A0A136K9M8      LSKGLKNEFEIAKM--------------LKQVVQVVQKKG-LDVVDLSVESPSPYEAAII
B3QVI2          ---------------DSTIVSEDVLAQRIRKQLQVAQADKSADVINISFESPSPFEASRM
B3QXQ6          ---------------SAKIARVDVIAARIMGAVSVEQVDK-ADLLLIKFRSHDPEEAAVV
A0A1D8D4L1      LNASDRDIIENTPAFDT---MMRFYAIKLSKRIKVEGSRD-SSVLRVSVASPFSDEATFL
A1BJQ6          LNADQNPPYRALSD-EE----LRRYAVKLNSRITVEAARE-TNVLKVSVASPFADEAAYL
A4SF30          FKVGNAGPRKDRSP-EE---ILRRRALLLTKRIRVTPVKD-TNMLKVSVASPFSNEAELL
A0A081SFU7      -----EEDGKISNI-DAIAARVRSGISIAQPKAT-----S-TSILLISFKSFDPFEAATV
A0A395LXF8      -----TADGKIASV-DEIAARVRMAMFVVPAKVP-----G-SNIITIGFRAFDPYEAATV
B4SD09          VFHPLNADQKAEAW-HYSDALLRFHAMQLKDRIRVIPLRD-TNLLQVSVASPFADEAVFL
B3EF76          GFSEKDAEEVPASQ-KE---TMRNFAENLKGRITIDNPKE-TNVLHVTVSSPFPEEAAVL
A0A222SG44      -----EPSRQPVQA-GEILDNIRPYAELLRSRLSVLNERG-TDIITVTVSSPFPREAALL
A0A317T3L6      -----MGKEEAADY-DL---LMREYAKTLQKRISVGNARD-TDILKVSVSSPFPDEAALL
A0A422HIT8      -----SAEEEPVDY-DV---QMREYAAALQKRIEVNNARD-TDILKVSVSSPFPDEAALL
A0A1B1Q171      DEPSVAEKKRKIPL-DL---KLRSYASRLSSRVTVENGRD-TDILYVSVSSPFSHEAALL
A0A1W6HT77      -----GKEEEEVDF-DL---KMRTYAEALKKRVSVSNSRD-TDILQVSVSSPFPDEAALL
B3EME9          -----TREKEEKEY-DI---RMREYATALQKRISVSNSRD-TDILQVSVSSPFPDEAALL
A0A369RAQ9      -----AAEKDSVDY-DV---QMRKYAAALQERIKVGNSRD-TDILNVSVSSPFPEEAALL
B4S3Z6          -----AAEKDSVDY-DV---QMRKYAAALQERIKVGNSRD-TDILNVSVSSPFPEEAALL
                                                          .:: :   :  . **  :

A0A136PFK4      ANTFAEVYIKDNKEQNSRKATQIRQFVADKMEKVRDSLAVIELRLKDYLESKNILGLDIQ
A0A136K9M8      CNAYAKTYSDYSLEFSRLDLTNIINYLNTEKEKKFRDLKLSEAALEDFQQREGVVQLDVQ
B3QVI2          VDLTMDTYSTLSTEQNRLMARSALEFLENEKQRVENNLRVTEEQLRDFMNQKGLIQIDAQ
B3QXQ6          SKAIAESYEERSMKYTRNTARSVRQFLEDQLAQKRRLLYESEERLRRFMEDNRVISLDEE
A0A1D8D4L1      SNMLCSVYQKSDIQRNSEKYIQSNQFVAEMLQEQKDMMANADAALSKFMTENQMYEVSGN
A1BJQ6          SNTLCRVYREADIDRNSEKYAQANKFIAEMLGDQQKKVGDADYALSKYMEANEIYELTGN
A4SF30          TNTLCSVYREADIERNSEKYAQANSFIAKSLVDQKQKLDEADRSLSGYMSRNEIYEVSGN
A0A081SFU7      SRAIASVYQERKKKSSSNTARILREFLEDQLAQKKRQLAESERTLQSYMEENRVVSLNEE
A0A395LXF8      SRAITEVFQERKRKSANNAARMLRQFIEDQLVQKKRQLAESERALQAYMEQNRIVALNEE
B4SD09          TNILCQTYKNADIIRNSEKYTQANKFIAEMIQDQQQKVGEADNALSQYMQANKIYEVSGN
B3EF76          SNALCRAYQQKDIEWNSEQAKSVNQFVEEQLGEQQKKVATVENNLSGYMEKQDIYELTGN
A0A222SG44      ANIVGRTYQKQDVAWNVEQARNVNQFVVDQLREQQKKVAEVEAAVSRYMKQENIYEVTGG
A0A317T3L6      TNAICQSYMRKDIEWNADQAMSVKEFVSEQLASQQREIAAVEDQLSSYMKQQNIYELTGN
A0A422HIT8      TNAICEAYMRKDIEWNADQAMSVKEFVGEQLSQQQQEIAEVEDRLSAYMKNQNIYELTGN
A0A1B1Q171      TNVLCKTYMQKDIEWNADQAMMIKDFVSEQLAVQEKEIAAVESQLSSYMKQENIYELTGN
A0A1W6HT77      TNAICQAYMRKDIEWNADQALSVKDFVSEQLAQQQREIAAVENQLSAYMKNQNIYELTGN
B3EME9          TNAICRSYMRKDIEWNADQAMSVKEFVSDQLASQQKEIGEVENQLSSYMKKQNIYELTGN
A0A369RAQ9      TNAICQAYMRKDIEWNADQAMSVKEFVGEQLAQQQREISSVENKLSSYMKNQNIYELTGN
B4S3Z6          TNAICQAYMRKDIEWNADQAMSVKEFVGEQLAQQQREISSVENKLSSYMKNQNIYELTGN
                       :   .            .::          :   :  :  :   : :  :   

A0A136PFK4      AHDLVQAKSKLENDASQTQIQISTLSRKLQEARQQYQAVDSGFATE-FASGDWAYASQLQ
A0A136K9M8      ADELVRSLSAIDKEKTMTSIELAANEKKYSELSQKIDEIDPKLKVYLESEISKGYLPELQ
B3QVI2          TTDVIKILTDLESKSQEIKVQRVAIDAALQNYKQQLNSFKPGIAEQYTDAYGATLSRC-Q
B3QXQ6          GRRMIQRYSLAMSSAEEAEVMVKMLQSSLKAYEQEIRAMTPKLSNSAVQATIDPYTKLFQ
A0A1D8D4L1      TGGLLAKLIEFEGRYNDIMAEYNIVSNSRNFLENQLTQADREMSDR-IARNVNAQLGAIR
A1BJQ6          TQQLLNKLVEADAKFKSIQAEYNIANNGLAFLEKKLSESDRAISSQ-IAKNVSNQLGSIM
A4SF30          TQQLLNKMVDSDAQYNAVQAEYHTVANTLNFLEKKLSESDKAISSQ-IEQTVNSQLSSIM
A0A081SFU7      ATRMIGRYSQAQAQLDETGVLLNALTASLKQYNEELAALQPKLSNSAVQASIEPYTKQFQ
A0A395LXF8      ATRMIQRYSQAVAQMDEAAVMLSALNASLKAYNEELAALQPKLSNSAVQAAIDPYAKQFQ
B4SD09          TGAILAKVVDADARYNDIKAESRIASNSLAFLEKKLSDTDREISSR-IAKNVNSQLGAIM
B3EF76          ADQLLKKLIDIDARYNEIMAERNILAKRLDFIRKKLSGEEKALSAN-IAESVGSQLRAVQ
A0A222SG44      AEELQERLADADARYNEVQAEARILRQRLAFLRRKLSEDEKAYSER-VAETMAPRLKAVQ
A0A317T3L6      AEKLLEKLVEAESRYNDAQAEYNILKNRQDFLVQKLSEEEKALSAK-IAKNVDQQSKELK
A0A422HIT8      AENLLEKLVEAESRYNDAQSEITILKKRQDFLVQKLSVEEKALSDK-IAQNIDRQASDLK
A0A1B1Q171      AQNLLNRLVEAESRYNDTRSEINILTKRQEYLVEKLSEEERAISAR-IAQNVDRQSSELK
A0A1W6HT77      AEKLLEKLVEAESRYNDAQSEITILKKRQDFLVQKLSAEEKALSDK-IASNVDRQASDLK
B3EME9          AEKLLEKLVEAESRYNDAQAECNILKNRQDYLINKLSAEEKALSAK-IAKNVDQQSRELK
A0A369RAQ9      AEKLLEKLVEAESRYNDAQAEYNILKKRQDFLVQKLSDEEKQISAR-IAKNVDQQSIDLK
B4S3Z6          AEKLLEKLVEAESRYNDAQAEYNILKKRQDFLVQKLSDEEKQISAR-IAKNVDQQSIDLK
                   :                              :                         

A0A136PFK4      TQIASLKTQRGLMLSVPFDGASKLAYDQKVKTLTEQMEMLESQLAPVIARLKNSNVGTLL
A0A136K9M8      KQIAQLEIERELQLS---IISNDRVRQKAKEEYDRKISSLQESLDKNVKSLDAGM-----
B3QVI2          YRLAELETERLLILSRNPGLKQKEENSPELKKIQDEISVLRSEIKVITSKMLSDDQDQLS
B3QXQ6          EEIAKLEVERDKILT-DPASRYNVNVQERLQEYNDKIESYKKRLQQSFERQVKQG-----
A0A1D8D4L1      DEIHSKESAYISLLR-EKTVDDPEVKGKK-----QELEQAKARYDQISRSKIAGQ-----
A1BJQ6          DEIKGLESEYMQLVQ-EKGIDNADVKAKR-----QQLEVVKTRYEQLSRSKIAGE-----
A4SF30          DKIHGLENSYVALLK-QKGSDEPAVKAKK-----QELDEVKARYEKLQRSSIAGE-----
A0A081SFU7      QEIARLEFERDKVLA-DPGSQTNLNVQERIRQYEDQIESYKKKLQQAFDRQVKQG-----
A0A395LXF8      AEIARLEFERDKALA-DPGIQFNISAQERVKQYEDQIEAYKKKLQQAYDRQVKQG-----
B4SD09          DELRTLESDYIKMVR-EKGIDNPEVKIKR-----QQLDVVKTRYEQLSRSKIAGE-----
B3EF76          NRIKAEEADYMALLQ-QKGAASPEVKARR-----QQIDQMKSQLDQVVRGKIAGE-----
A0A222SG44      DMIRKEESVLSELIV-QRGPEDTAVRTKQ-----EQIRNMKAQLDQITRTRIAGE-----
A0A317T3L6      SRIKQEEKTLITLAG-ESGAESSSYIAKK-----QQLDVLKQRLQELTRNMIAGE-----
A0A422HIT8      DRIKSEEKELISLAN-DAGTNSPQYASKK-----QQLDMLKQRLQELTRNMIAGE-----
A0A1B1Q171      RRIMEEERTLIEMER-LGNASGEAYDIRK-----QQLELLRRRLEESTGNIIAGE-----
A0A1W6HT77      NRIKQEEKALIDIAT-QNGTSDPSYVAKR-----QEVDVLKQRLQELTRNMIAGE-----
B3EME9          ERIKQEEKQLIAMAG-EAGTQDAGYLAKK-----QQLDMFKQRLQELTSNTIAGE-----
A0A369RAQ9      SRIKKEEKALIELAN-STGTEDGSYIAKK-----QQLDVLKQRLQELTRNMIAGE-----
B4S3Z6          SRIKKEEKALIELAN-STGTEDGSYIAKK-----QQLDVLKQRLQELTRNMIAGE-----
                  :   :                            ::                       

A0A136PFK4      STTKQGELPTAPLGNLRQQIFEDEIALQALRAQGAAINA-ARAQVNAQ---MSAVPQQQM
A0A136K9M8      --YVMTPEERR---EMVWELVKTGVMVNSDRIKNRVLGN-YVNEYETR---FNKLPSQII
B3QVI2          SILSATNGDIAAE-ILLTKRKLLELDI--QRRQYDAQSAVLEQELEKKKLFFEKIPDNMI
B3QXQ6          --LSNVNASEAYQ-ELFKNKLNTELELIEQKSKFEAYKK-LAEEYDKA---FLKSPGVNV
A0A1D8D4L1      --IEYIGKAQKYRYDLISEKLQLDQKLNTLKFSAGEYAK-VKQKYDGQ---LAQLPEKEQ
A1BJQ6          --IGYAGKAQKFSFDMVSEKLQIQRKLNELSFSSREFSR-LKEYYEGL---LGQLPEKQQ
A4SF30          --IGYAGRARKFGFDMVSEKLQIERKLNELKFRAGEFAR-IRQYYESQ---LSNLPYKQQ
A0A081SFU7      --LANVDNSQYFK-EIYRKKLETELQIIGLQTKLKAYKD-LAQDYDRA---FLKTPGKNI
A0A395LXF8      --LANTNNTEYFR-EIYKKKLDTELQIVAVQTRLKAYKE-LAEEYDKA---FLKTPGKNI
B4SD09          --IGYAGKAQKFSFDMVSEKLQIERKLNDLNFSASEFSL-LKQYYESQ---LSMLPIKQQ
B3EF76          --LAYSGRAQKFQFDLISEQLQTDLRLAELNYSAQEFGK-LKNYYESQ---LNALPDKQL
A0A222SG44      --IAYSGRSQRYQFGLIAEQLQTDARLAELEFSASELNR-LRNYYQAQ---LRSLPQKQL
A0A317T3L6      --LAFTSKARQYQFDLISEQLQTDVRLAELSYIAQEYQR-SKNYYESQ---LNRLPQKQL
A0A422HIT8      --LAFSSKARQFQFDLISEQLQTDVRLAELQYIAQEYLR-AKNYYENQ---LNKLPQKQL
A0A1B1Q171      --LAFMSKARQYQFDLISEQLQADVRLAELTYVADEYLK-SKNYYEAQ---LNKLPQKQL
A0A1W6HT77      --LAFSSKARQFQFDLISEQLQTDVRLAELDYIAQEYLR-AKNYYESQ---LNRLPQKQL
B3EME9          --LAFASKARQYQFDLISEQLQTDVRLAELKYIAQEFQR-SKNYYESQ---LNRLPQKQL
A0A369RAQ9      --LSYTSRARQFQFDLISEQLQTDLRMAELGYVAQEYLR-AKNYYESQ---LNRLPQKQL
B4S3Z6          --LSYTSRARQFQFDLISEQLQTDLRMAELGYVAQEYLR-AKNYYESQ---LNRLPQKQL
                               :  :       :                  :     :   *    

A0A136PFK4      DVGRLVREQSASAKMYEDMLDEYNKKVLEEQSVTSTARIFEDAQPVLKPVSPNRTANILT
A0A136K9M8      EYARLERDKLTNEKIYILLEEKYQEALINQNARIGNVTIIDPAFESLLPSKPNRVFLLVS
B3QVI2          ILARLKRNVDVNEKLYLTISERYAETALWEQTQFGLGRPIDYGYLPEAPIKPKKQIFLLV
B3QXQ6          EFGRLERKTKSAQELYLLLEKKYQEALIAEEQVPKMVEVIDWAITPGAPIAPNRKANILV
A0A1D8D4L1      NFVRLQRDRDVVSKTYLFLKEKLDETRILIGSEVGSVTMIGSAFKPFMPEKPELVKNILA
A1BJQ6          DYIKLQRDREVVGKTYLYLKEKLDETRIMLGSEVGGVSVIGSAFVPFKPEKPNLKKNMLM
A4SF30          AYLKLERDRNVASKTYEELKQKFDETRIFLGSEVGGVSIIGSAFRPFTPEKPSLPVNLLL
A0A081SFU7      EFARLQRNNQTLQDLYSLLEKRYQEALIAEEQIPSGVEVIDLAVPNLVPVGPNRATNVIL
A0A395LXF8      EFARLQRNNKILEELFSLLEKRYQEALIAEEQVPSGVEVIDWAVPNPIPVGPNRRNNMIL
B4SD09          EFIKLQRDKEVVGKTYLYLKEKLDETRIMLGSEVGGVSIIGSAFKPFSPEKPVLSRDLLA
B3EF76          NYARLQRDREVVNSTYTFLKQKFEESRIKIASEVGRVVIVGPAYPPKLRESPDTKKILLV
A0A222SG44      ELARLQRDRDVVNRTYSFLRERLDESGIEIASEVGQVVVIGDAHPPDSPVSPNLGMNLFL
A0A317T3L6      NYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAFPPIDPVAPDLKKNLLI
A0A422HIT8      NYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAGYPPTSPVAPDLKKNLLI
A0A1B1Q171      NYARLQRDREVLNNTYTFLRNKLEESRIKIAAESGKVVIVGAGYPPLSPVAPDLKKNVLI
A0A1W6HT77      NYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAFPPVQPVAPDLKKNLLI
B3EME9          NYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAFPPIEPVAPDLKKNLLI
A0A369RAQ9      NYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAYPELAPVAPSLKKNLLI
B4S3Z6          NYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAYPELAPVAPSLKKNLLI
                   .* *.       :  : .   :  :           .  .        *     :. 

A0A136PFK4      GCFLGLAIGVGIALLLAYSDTTVHSPD-DLEKHGFTVLTAIPLIPEGMLNYEIISNDPLS
A0A136K9M8      GAVFGLILGIGFVITRNYLDKSIKTPD-DLENNGYSILAWIPSIDIKEKSDLSSPDEF--
B3QVI2          GFLFGLAGAVTFIYVKESLNTGIDGAE-KLKKKQYPLLAVIPDMEE--------------
B3QXQ6          GVVIGLTFGVGIVMLIQFLDKTVYTPE-QAERLG-PLLATIPMMES--------------
A0A1D8D4L1      GLVIGIVLAGLFTYGAEMIYDTVNEEMQFFKSLGLNIWGVIPFI---------NSSSDYS
A1BJQ6          GLVLGGLLAVLFTYTAELVDDSVKDDS-FFRDIGLATLSIIPLVPGEKNAVPSREVSGFN
A4SF30          GVLFGGLLAIGYTYIEESVDGTLQDDF-FFDEIGVRPLAYIPTV--GPYGYPALPGYGKG
A0A081SFU7      GVVVGLVLGVGVVMLLQFLDQSVHTPE-QAEKLGTL-LATIPVIET--------------
A0A395LXF8      SVVIGLLAGVGVTLVLQFLDQNIHTPE-QAEKLGML-LTTIPVIET--------------
B4SD09          GFILGGLLAVLYTFGAEMADNTVKDDL-FFRDLGLTVLSVIPLVGQKGQTPFLDNKESFI
B3EF76          GLVLGLGLGGALVFVLEMRDHSVKEEQ-FFDDHGFVTLARIPFVDK-AEFTLADGMKKAV
A0A222SG44      GLFSGLGLSALLLISQNLLDDTIRDDS-FLEDNGFVELARIPFTGSGETHEAAVPFG---
A0A317T3L6      GLILGLGLGGAMVFVREMLDHSLKDDT-FLEDHGYTPLAAIPYVEDGNGKDLPKTLKGSL
A0A422HIT8      GLILGLGLGGALVFVREMLDHSLKDDT-FLEDHGFTPLAAIPYVPR-EGETLQGSFRKSM
A0A1B1Q171      GLILGLGLGGALVFVREMLDNSLRDNE-FLEQHGYVPLAFIPFIADKARGMQRKQSGKKA
A0A1W6HT77      GLILGLGLGGALVFVREMLDHSLKDDA-FLEDHGFVPLAAVPYVAREGE-TLQGSLQKSV
B3EME9          GLILGLGLGGALVFVREMLDHSLKDDA-FLEDHGYTPLAAIPYVGDENESDLQDSLKKSI
A0A369RAQ9      GLILGLGLGGALVFVREMLDHSLKDDS-FLEDHGFTPLAAIPFVDSDGGGSMQASMKKSL
B4S3Z6          GLILGLGLGGALVFVREMLDHSLKDDS-FLEDHGFTPLAAIPFVDSDGGGSMQASMKKSL
                . . *   .             :                 :*                  

A0A136PFK4      VRLNG--------------------------------------RASSHLITHIQPKAPIS
A0A136K9M8      -------------------------------------------IVASDAKSSI------S
B3QVI2          -------------------VIKESYDEE--KYITVKGS-----KISTRLVSFLDVISPIA
B3QXQ6          -------------------FDDDVRDKSGASVKVIEGPDAEYKKIASHLVTHFDPKSSVS
A0A1D8D4L1      GTYHEAKRKIEKKSVMLLDIFKKKEEQINNPQSEVSGDIKNNPLMTDKLNSSF------A
A1BJQ6          RILYNTSKAFREKVLL-------SGNGAGKRKGAQPKVETPMPMITDSLSSSF------A
A4SF30          KLMESTGRTIRK--LL-------PGSSEGDGENSVTVTVLPAPLICDNLDSPF------A
A0A081SFU7      -------------------FDESVRGKAGTEVKAEDETDLEYKKIASHLVTHFDPKSSVS
A0A395LXF8      -------------------YDETVRDKASAGDKVAEDPNAEYKKIASHLVTHLDPKSAVS
B4SD09          KRFL---------------YSKSQAFREKVLSEASVKGALPMPMITDSLSSAF------A
B3EF76          GQLLVTIDPGKGNGKSN---------GNGRHPGQGSADGAPL-LITDKLSSPF------S
A0A222SG44      --IAKLFSRFT------------NRKNADVELHAGKSGAAPL-LISDYPSTAF------A
A0A317T3L6      EQLTGYLPKYGDNGK----SSKYIKTNSQGKIVPSTHDRKPL-LMADSLSSPF------A
A0A422HIT8      DDITRALPSLNLNGNGKNGTSKHKKVDSQGKSVPSSSKKPPL-MMADSLSSPF------A
A0A1B1Q171      KRVGGLIEKLLVQL-SP--KKEHERLALHTQATAD----EPL-LMNNSLDAGF------S
A0A1W6HT77      DDVRKLLPSFNGN--GT--SGKHQKQNSQGKPVASSSKRPPL-LMADSLSSPF------A
B3EME9          RQLSDSIPGFGASSNGK--DASHVKMNSSGKSVPSTRESKPR-LMADSLASPF------A
A0A369RAQ9      KDFASVFPFLSGNTDGK--KDQHQKKNSYGKPVESTRNKQPL-LIADSLSSPF------A
B4S3Z6          KDFASVFPFLSGNTDGK--KDQHQKKNSYGKPVESTRNKQPL-LIADSLSSAF------A
                                                                  : :      :

A0A136PFK4      ESYRSLRT-----AVQFAAI------EEPVRKILVASSVPQEGKSTTSTNLAITLAQSGA
A0A136K9M8      EAFKVLRT-----RVQYAKI-----EEEPLKTILITSTIPGEGKTTVAVNLAGSFALDGK
B3QVI2          ESFRRLQS-----NVIYS------HPDEKLKLIVVTSPGKGEGKTTVISNFAVALAESGK
B3QXQ6          EAYRTLRT-----NILFSGVHDFNGSKKQGLIYIITSSSPKEGKSTTISNLAITIAQGGQ
A0A1D8D4L1      ESFRTLRT-----NLNFSRI------DKPFKTILISGCSIGEGKSTVSTNLALAWAIADK
A1BJQ6          ESFRTLRT-----ALDYSRV------ESPLKSLLISGTAMSEGKSTVCSNLAMAYALVGK
A4SF30          ESIRMLRT-----SIQYSIP------GKPPQSILISGTAMWEGKSTVCVNLGMAYALVGK
A0A081SFU7      ESYRALRT-----SILFSSSFVGNGEKEDGNVFAVTSASPKEGKSTTISNLAITIAQGGQ
A0A395LXF8      EAYRSLRT-----AILFSSASPTKENGKAGKVYLITSASPKEGKSTTVANLAITLGQGGQ
B4SD09          ESFRTLRTALDYSRVDFSRI------DSSLKFILVSGTAMTEGKSTVCANLGMAYAISGK
B3EF76          ESFRDLRT-----NLTFARA------GTPLRSVLVTGTAVSEGKSTICANLGLAFALTGK
A0A222SG44      ESFRDLRT-----NIMFSRA------DNPVNSMLVTGTSISEGKSTVCSNLALSYSMIGK
A0A317T3L6      ESFRDLRT-----NIVFSQA------DRPLKSILVTGTEISEGKSTVCGNLAYAFALNGS
A0A422HIT8      ESFRDLRT-----NITFSQA------DKTVKSILVTGTEISEGKSTVCSNLAFAFALTGK
A0A1B1Q171      ESFRDLRT-----NITFSRA------DNPLKTIMVSGTEMSEGKSTVAGNLGLAFALTGK
A0A1W6HT77      EAFRDLRT-----NIIFSQA------DRKVKSILVTGTEISEGKSTVCSNLAFAFALTGK
B3EME9          EAFRDLRT-----NLVFSRA------DRKLKSILVTGTEISEGKSTVCANLAFAFALSGN
A0A369RAQ9      ESFRDLRT-----NITFSQA------DRTLKSILVTGTEISEGKSTVCTNLAFAFALTGK
B4S3Z6          ESFRDLRT-----NITFSQA------DRTLKSILVTGTEISEGKSTVCTNLAFAFALTGK
                *: . *.:      : ::                ::.    ***:*   *:. : .  . 

A0A136PFK4      RTLLIDCDLRRPTQNSVFGFPREPGLVNCLIGMARL--DEAIRPSGIPNLDILSSGSIPP
A0A136K9M8      NVLLIDCDLRKPRVHSVMGVNRYPGLTDLLFGNNDL--SEVIRPTKFDNMHFIPSGTIPP
B3QVI2          KIILVDTDFRRPYVHKMFGLDQQPGLTETLFDGVPV--EEVIMKSIVPNIDILTTGKRPS
B3QXQ6          KVLLIDTDLRRPIIHSIFGYNKEPGITNYLVGRAQI--DDIVRNSPIQNLDIITSGTIPP
A0A1D8D4L1      KTLLIDADLRRPSQHTILGKKRSPGLTDCLIDDGKNDNDKYFQKTHVENLFLMTAGTPVP
A1BJQ6          KTIIVDCDFRRASQHKKFSVKREKGLTDYLFGEDRSIDESYFQATHVDNLFLLSSGKKVP
A4SF30          KTLIIDCDLRRPSQHIKLNCQRGPGLTDFLNSENDEFSAPHIQTTQVDNLFLLSAGAKVS
A0A081SFU7      KVLLIDADLRRPVVHAIFGYNKEPGITNHLVGRAAL--DDITRSSAIPNLDIITSGTIPP
A0A395LXF8      KTLLIDADLRRPVIHSVFGYNKEPGITNYLVGRASV--EEITRITPIPNLSLITSGTIPP
B4SD09          KTLIIDCDLRRASQHKKLNVKREPGLTDFLYSQQANIDESFFQPTHIENLFVLSAGKKVP
B3EF76          RVLIVDCDLRRPSQHKLLGSSKAPGLSNYLAGQEADM-SKLIQPTLNENLFLLPAGAAVP
A0A222SG44      KVLVIDCDLRRPVQHQYLQTSRQPGVTDYLAGASDEIAEEFIQDAGYENLFLLAAGSPVP
A0A317T3L6      RVLLIDCDLRRPSQHRLYSCKKVPGLSDYLAGLEVDA-EALIQPTMHENLYILPAGNKTP
A0A422HIT8      KVLVIDCDLRRPSQHRMLNTLRMPGLSDYLAGVEKDL-DVLLQPTMHENLWLLPAGNSTP
A0A1B1Q171      RVLLLDCDLRRPSLHRVFKVDRGPGLTDYLAGQQDDL-KRLTRQVLHENLHLIPAGAKTP
A0A1W6HT77      RVLIVDCDMRRPSQHRMLNTLRMPGLSDYLAGVETDL-EEILQPTMHENLWLLPSGSTTP
B3EME9          RVLIVDCDLRRPSQHRIYSCKKTPGLSDYLAGVEDDA-DALIQSTMHENLFILPAGNSTP
A0A369RAQ9      KVLIVDCDLRRPSQHRNLNTMRMPGLSDYLAGQEKDI-NAVLQPTMHENLSVLPAGSQTP
B4S3Z6          KVLIVDCDLRRPSQHRNLNTMRMPGLSDYLAGQEKDI-NAVLQPTMHENLSVLPAGSQTP
                . :::* *:*..  :      .  *: : * .                *: .:.:*   .

A0A136PFK4      NPSELIGSRRMRELLNDLEKDYDMILIDSPPIGAVTDAMILSTMTDTTILVVRAHKTKME
A0A136K9M8      NPSELLGSLQMKKTLENLKTQYDIIVLDSPPSISVTDSEILFKITDGTLLVVQSLKTPMD
B3QVI2          NPAAVNQSLKLRELLQSLKKKYDHVLVDTAPFGITTDAASIMKLTNGVILVVRFGQTSET
B3QXQ6          NPSELIGTQRMKDMLQLFRERYDIVLLDSPPIIAVTDPQVLAKVADGMILVLLSGQTQIE
A0A1D8D4L1      NPNELLGSEKMHLFLKKISDQFDRVVIDSPP-IFISDAAQLVNEVDGVLITARLHYSSRA
A1BJQ6          NPNELLGSAKMQDLIRELETKFDKVIIDSPP-LFLSDAAQLAHSIDGILLVSRLQFTSRK
A4SF30          GPSELLASDDMQRLLAVMKTRFDCILLDCSP-FFLSDASQLADWVDGIVMVSRLQYTGRK
A0A081SFU7      NPSELLGSDRAREFITQVRQRYDTILFDTPPVLAVTDAQVLATQVDGIMIVIAAGQTQVE
A0A395LXF8      NPSELLGSPRMREFLDQMREKYDMILFDSPPVMAVTDAQVLSQHADGVIVVLAAGQTQIE
B4SD09          NPNEILGSQKMIRLLKELDGKFDKVVFDSPP-LFLSDAAQLAHSVDGVLLAARMHFTNKD
B3EF76          NPNELIGSQKMSETVELLEFRYDMVIIDSPPLLLISDAALLSQSVDGILLAARLEYTNKK
A0A222SG44      NPNELLFSNKMTQLIERLKARFDIVLLDSPPVLLLSDAAVLSRSVDGVVVVAKTGYTSKD
A0A317T3L6      SPNELLGSNKMNELIKRFEDEWDYVILDTPPLLLLSDTTLISRAADGILMVVRMGYTNRN
A0A422HIT8      SPNELLGSRKMTDLVKELEEKWDYVILDTPPVLLLSDAALISRSADGILMVVRMGYTNKN
A0A1B1Q171      NPNELLGSQKMKELIRQLEAEWDIVILDTPPLLMLSDATVLSRHVDGILMVARMGYTNKN
A0A1W6HT77      SPNELLGSNKMTELVEKLEEEWDYVILDTPPVLLLSDATLLSRAADGILMVVRMGYTNKN
B3EME9          SPNELLGSNKMTGLVERLEEEWDYVILDTPPMMLLSDAALISRAADGILMVVRMGYTNRN
A0A369RAQ9      SPNELLGSNKMTELVKKLEEEWDYVILDTPPVLLLSDATLLSRTADGILMVVRMGYTNKN
B4S3Z6          SPNELLGSNKMTELVKKLEEEWDYVILDTPPVLLLSDATLLSRTADGILMVVRMGYTNKN
                .*  :  :      :  .   :* ::.* .*    :*.  :    :  ::.     :   

A0A136PFK4      FLEKS-REGLERVNTPLLGVVLNDFDVSQTY----GSASYKYYRY---------YRYYNY
A0A136K9M8      AFSKVYDRFNSFSEPNLLGTVLNNFSYKRNYGYYYN--YYYYYSSGEKPN----------
B3QVI2          ELDQT-VENLRQVNANIIGTVLSAFDYRKTSDHYYNSGYYKYSYKRYTDY----HEEKEV
B3QXQ6          LAKRS-IDAIRKVNAKIIGFVLNSFDFNNSYGSYYK--YYRYYNYYYEPK----GKNKNV
A0A1D8D4L1      PLKQY-AS-DNFLHSKIIGVAIIDKPRPSKT--RYG--------YGEGKYGYGRSGYGRY
A1BJQ6          PIQDF-VS-DHFMRPLLLGVALIGSRQGTGY--GYG--KYGYGKYGYGKYGYGKYQYGQY
A4SF30          MLQNI-IS-DPYLKARLLGVALISTTEMSKQ--GY----------------YGKYGYAEY
A0A081SFU7      LAKRA-RQAVARVDGRFLGFILNNFDVANSYGSYYK--YYRYYNYYYESK----GTPKIK
A0A395LXF8      LAKRT-KQALLKVDAPIIGYVLNNFDVTKAYGSYYK--YYRYYNYYYESK----ATPK-K
B4SD09          PIRNF-AV-DHFLRPLILGVAMIESRDSQRYGYGYG--KYGYGKYGYGKYGYGKYGYGKY
B3EF76          LLQEV-QK-ISYIKPQLLGVALIGSSSRDRY--------G-YDRYGYKGQ----YKYKTY
A0A222SG44      QFREL-GK-VDYLRERMLGVALIGSVGQKKY-----------GKYGYD--------YKAL
A0A317T3L6      LLKEV-QK-LDYLKHRLLGVAIVGPSEKIGY-GSYG--RY-YGRYGYKGY----YSYKSY
A0A422HIT8      LLKEV-QK-LDYLRNNMLGVAIIGPSEKSSY-YKYG--RY-YGRYGYKGY----YTYKSY
A0A1B1Q171      LLRDV-QK-TEHIRKNILGVAIIGPSVQDKYNYKYG--RY-YGRYSYKGY----YSRESY
A0A1W6HT77      LLKEV-QK-LDYLKKTMLGVAIIGPSEKSGY-YKYG--RY-YGRYGYKGY----YSYKSY
B3EME9          LLKEV-QK-LDHIRKQMLGVAIIGPSEKAGY-GKYG--RY-YGRYGYKGY----YSYKTY
A0A369RAQ9      LLKEV-QK-LDYLKHRLLGVAIIGPSDKSGY-SNYG--RY-YGRYGYKGY----YSYKSY
B4S3Z6          LLKEV-QK-LDYLKHRLLGVAIIGPSDKSGY-SNYG--RY-YGRYGYKGY----YSYKSY
                                ::*  :                                      

A0A136PFK4      YGGMEEEESSRRKDRRAKAIANGEATEKQPRLHG
A0A136K9M8      ----------------------------------
B3QVI2          ----------------------------------
B3QXQ6          KQGFLTKIIERLVDKV------------------
A0A1D8D4L1      SSVYPEKL--------------------------
A1BJQ6          EEQA------------------------------
A4SF30          EEESQLLS--------------------------
A0A081SFU7      KSFIEQLSDRFIGK--------------------
A0A395LXF8      KNFFEALSDRLSGIKS------------------
B4SD09          GYGQYEEEA-------------------------
B3EF76          SHYIDTPES-------------------------
A0A222SG44      DYYGAGAKI-------------------------
A0A317T3L6      SSYLDEQRN-------------------------
A0A422HIT8      SSYLEPEKTKG-----------------------
A0A1B1Q171      QKYLDTSST-------------------------
A0A1W6HT77      SSYLEPEKNKG-----------------------
B3EME9          SSYMEPEKTKG-----------------------
A0A369RAQ9      NAYLEPEKSNG-----------------------
B4S3Z6          NAYLEPEKG-------------------------
                                                  

© 1998-2019