BYKdb

Dataset for cluster cd of phylum chloroflexi

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A5V0I3      ---------MNHTNGYADSPLIALRDPRSPAAEAYRTLRTNIQFSSLDKPLQTLLATSTA
A7NQ71      MNTTNDARAMNQTNGYAESPLIALRDPRSPAAEAYRTLRTNIQFSSLDKPLHTLLATSTA
                     **:*****:*********************************:********

A5V0I3      PDEGKSTTLANLAVTIAQAEQRVILVDCDLRRPSLHTLFGLSNDIGLTNMILAHNDAPPP
A7NQ71      PDEGKSTTLANLAVTIAQAEQRVILVDCDLRRPSLHTLFGLTNDVGLTTMILAQDDAPPP
            *****************************************:**:***.****::*****

A5V0I3      LQETGVPGLSLLASGPLPPRPADILGSRRMEAIIQRLRGMADMVLFDTPPVIAVTDAAVL
A7NQ71      LQDTGVPGLSLLASGPLPPRPADILGSRRMETVIQRLRTMADIVLFDTPPVIAVTDAAVL
            **:****************************::***** ***:*****************

A5V0I3      ATRVDGVLLVLEAGRTRRDRARRAREILEKVKANIIGVVLNSARFDGEYGYYA
A7NQ71      ATRVDGVLLVIEAGRTRRDRARRAREILEKVKANIIGVVLNGARFDGEYGYYA
            **********:******************************.***********

© 1998-2019