BYKdb

Dataset for cluster orphancd of phylum chloroflexi

[Download (right click)] [Edit] [Sequences] [Repertoires]

43 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1MN85      -------------MNLKFLDYFSPIFRWWWLLIVCALVAGGVGYALVN-PLPPVYQSGIT
A0A2E6YFL8      MQNSNITMPQLNDINTTFRRYVGIFLNYWWVFLILPAILGIGTYFYSS-SQDTMYEATST
A0A2W6B4S3      --------MELRDLIRVAKRWVPI-------ALIVALTLAIASYAFTKFTVKKVYTATVT
A0A1Y6K3L6      ---------------MDFRQFVNIAKRWIWLALVGALVAGGLGYYISS-QETPLFQASTR
A0A1F8QKW6      ---------------MEIKQYLEPLIKWWKLILVACLLAGISSFLIIS-RQPPTYQTRVS
A0A356DVN8      ------------------YSYLN-------------------------------------
A0A1F3AZM3      -----------------YYAYLD-------------------------------------
A0A350FYF2      ---------------MEINTYLRPLIRWWRLIVIVTMLAVIASAVSAL-LQPAAYVSRTT
A0A363U3C3      ---------------MDISVYLRPLLRWWRLIMIVTVLAVVASAVSTM-FQPEIYVSRTT
A0A0M8JPC7      ---------------MDIRPYLAPIFKWWWLLLAAAALATGTAYFILR-DQPAVYTARTT
A0A1F8PQP8      ---------------MELRTYFRPLLKWWWLLLAAGLVAAVSSFVVMG-RRPLIYQSRTT
A0A351G432      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
                                                                            

A0A3M1MN85      LLVGNALDTPNPSSLEVEIPRRLTDAYAAMALREPVRDGVKKALGLDELPKYTAYTI---
A0A2E6YFL8      LLVEQRRTGGVAGVSDFTLSEDLARMYMKQILSTPFIS----RVVEEPDVKY---NVDEL
A0A2W6B4S3      MEVQAGVTG--QSVPDPTISNLIVPTEAQVAAQGPTVDQAMRRVQSTPGIAITPGEIAAI
A0A1Y6K3L6      FVILRAATTGYDYYAYIDYQQQI-QTYSELLTTDALLNQASEELG---YSAQ--------
A0A1F8QKW6      LVIGRAVYEPNPSGGEMGLAQQLAAYYANIAEREVIRNATMTALNLRWLPAY--------
A0A356DVN8      -------------------NQDIVDTYAQLLTTEELLFQASEALG---FPVR--------
A0A1F3AZM3      -------------------SQQLLQTYIQLLTTEKVLNAASEKLG---YPVY--------
A0A350FYF2      LVIGTTILDPNPDSGQIYIAQQLAGIYADIAEREPIQQATMDSLGIDWLPLY--------
A0A363U3C3      LVIGTTILDPNPDSGQIYIAQQLASIYADMARREPIQQATMEALGIGWLPQY--------
A0A0M8JPC7      LMIGRTLLEANPSSNDFWLNQQLSSLYSDMAYREPVQEGVKKALGMTWLPKY--------
A0A1F8PQP8      LVVGSSVYEANPQTGDFFLNEQLAGFYADLVQRTPIQLETMKALNLEWLPSY--------
A0A351G432      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
                                                                            

A0A3M1MN85      ---------PGSTMVRIEVTDTNPRRAQAVATELGRQLMAQSPGGTTRDS-ETQAFLEEQ
A0A2E6YFL8      KLMLTADAHINPPTLDVIIRNSDKTEAADVANKIAATFI----------N-YTVELRLAE
A0A2W6B4S3      KASIQCKPNPDTSLFSCSASAHQAEVAALVANQLATVFT----------Q-GEQAFDQQR
A0A1Y6K3L6      DVTASASQIADTQFMRLTVTHPDPVKAAEIANVLVKVLIDQNERLQSVRYEATERNMQQR
A0A1F8QKW6      ----ASQAVPNSQIIEITVTDTDPVRAQAVANELANQLIKQSPSNPDLKEQKRQEFIRQQ
A0A356DVN8      KGQATAKQVDDTKFVVLTVKDPDPFKAATIANGLVSIMISQNENLQSVQFAAAEKNLQDR
A0A1F3AZM3      AGQASAQQVPDTQFVRLTVTNTDPQRAADIANVLVMVLIDQNEELQAVRYLTSEQNLQSQ
A0A350FYF2      ----QSKVVPNTQMVEISVTDTNPKRAQIIADELARQLMLQSPAIGGTETGDRQEFIREQ
A0A363U3C3      ----QAKVVPNTQMVEITVSDTVPKRAQIIANELANQLMLQSPAIGGTETGERQDFIKQQ
A0A0M8JPC7      ----VVKTFGNGQFIEIDVIDTSPERAMHVASELANQLILVSPGSKEVNS-NNEAFIQEQ
A0A1F8PQP8      ----SASTIPNTPLIEILVNDTDPSRAQAVANELATQLIKQTPTNDPVNT-ERRGFIENQ
A0A351G432      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
                                                                            

A0A3M1MN85      LHKIADAISETEQDIAAK-----QEEMATAEG-----ASAILSLQADLDA----------
A0A2E6YFL8      IAKI--------------------QTAALSQG-----LPNVQELVAS-------------
A0A2W6B4S3      YQTVLTNIRSSEAIARKN-----GDAALLSRL-----QGSEISVLVD-------------
A0A1Y6K3L6      ADQALEQIEILQAQIDQLSTASVQEQLTQVESEINELQEQIFALETQIVELETKISE---
A0A1F8QKW6      LELLETQIQDTQEQIAQQ-----ENEMGTLNS-----ARQIAEAQADLTA----------
A0A356DVN8      IDQAEEQIATLETQISQISDEMLQSQIESVQLQMDDVQAQVNNLKTDMAQIYPGSLAVEN
A0A1F3AZM3      IDQVQSQITTMQTQINDISEATVQDQLVQVKAQIEPLQTQVTTLETEIADLQKNRYP---
A0A350FYF2      LSSLQIQIQETETKIEEL-----QTSLVDLNS-----ASQIANIETEIRD----------
A0A363U3C3      LDSLKVQIQDTEKNIEEL-----QKSLIGINS-----ASQIANIEKQINE----------
A0A0M8JPC7      LQKLQEQIVATEKELVAR-----QDSLGGLTS-----AHEIEQAKAELRT----------
A0A1F8PQP8      LNLFEADIVQTQIDINDK-----TASLDSLTS-----ARQIAETQDDIRS----------
A0A351G432      -----------------------------------------MFQKKICKPKWQMLKXALE
A0A353H3Y9      --------------------------------------------------RYIDLRTNLE
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------MGRVSESKASLE
A0A2N2MQC3      ------------------------------------------------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
                                                                            

A0A3M1MN85      ------------------------------------------------------------
A0A2E6YFL8      ------------------------------------------------------------
A0A2W6B4S3      ------------------------------------------------------------
A0A1Y6K3L6      -FNPLFATEEQKAQHEANRTRAAELEAEVKQLTPILALYQQIFTNLTVLGRVPDSSTNTS
A0A1F8QKW6      ------------------------------------------------------------
A0A356DVN8      IADLKSLTEDLESLTEEEIAQLTAYQTKLDEITPILELYQEIYTELVVLGQTTGASNQNP
A0A1F3AZM3      --------------TEEENAQLAEKEATLAQVKPILTLYQQLYTNLVVLGQPVDTGTNTS
A0A350FYF2      ------------------------------------------------------------
A0A363U3C3      ------------------------------------------------------------
A0A0M8JPC7      ------------------------------------------------------------
A0A1F8PQP8      ------------------------------------------------------------
A0A351G432      TREETRPYQPTPTLAPETLSQIQENRLDLQQKQGMLNLYQELYFNLLSSDSSGNPILTSG
A0A353H3Y9      T--------------------------ELANTDKQISSINARLAAIPTDTAGNAINPNDV
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      R--------------------------EITSVEADITRTQDALNAVTDDN----------
A0A2N2MQC3      ------------------------------------------------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
                                                                            

A0A3M1MN85      -LNNKLATLQENYARLLASSQSNAINT----------LRVVEEATLPTRPIGPNKVLDVA
A0A2E6YFL8      --------------------NFTTLDS----------LSLLEPAAPPKSPAFPRTKRNTA
A0A2W6B4S3      --------------------AAQRASI----------VRITQQAQRPTSPSSPHPTLNAA
A0A1Y6K3L6      IEISQLQTNLNLYQQIYINSISSLENLNLTRAQNTPNVIQVEPARIPKKPISPKPMQDAA
A0A1F8QKW6      -QRQKLTTLQTNYATMLGTSLGRASNS----------LNIIETAALPTRPIGPNRGTIIL
A0A356DVN8      TDLDRLKTTLNLYQQIYISSINNLETLKLAKAQNTPTVMQVETAAKPTVPISPKPTETAL
A0A1F3AZM3      TRLQQLQTTLSLYQGIYVNLLNSLENVRFARVQNTPNVVQVEPAVASTSPISPRPFQSTA
A0A350FYF2      -HTQKLNSLRESYANFLVNSQEGALNI----------LSIVEPANLPTRSVGTSKLIIIA
A0A363U3C3      -QTQRLNSFRENYASLLANSQEGALNI----------LSVVEPANLPSNPVGTNRFFIIA
A0A0M8JPC7      -LEDKLSLLRTNYANLLSSSKENITNI----------LQVIEPASLPVRPTGPNRYLIIA
A0A1F8PQP8      -LEQKLASLRSSYAALLASSDRGAGNT----------LRLIEPANLPGRPISPNTFTMVM
A0A351G432      AGSNQYQSTLALYQQIYANLLSDYEAVRLSRMENTTTVVSVEPATPKMQPIRPKPVTNTL
A0A353H3Y9      ATRAQLETSLSQYEQARSYLVSDYQQLMLSEVLSTSTVVQKDPAVANPLPIQPQPMRSAL
A0A2M8PN31      --------------------------------MKKPNARIVDRAVPPMFPSSPRHVLNIG
A0A2N2PFW9      -QRMRLETSLAQYRSTYSSLLSSYQQIRLAEAQATDNIAIAKPARVPEEPIRPRTMTNTL
A0A2N2MQC3      ------------------------------------------------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A3N5RU86      ---------------------------------------------------------MEL
A0A3N5NV84      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
                                                                            

A0A3M1MN85      AATLGGLILATLGAYGIEYLDDRLKTETHIQHLVHYSLTGYIPTIYTQENP------VTY
A0A2E6YFL8      IGVMLGFLLATFLSVLLSSITSTIKDVENIYNQFGVPTLGNIFRWGSQNDQ-----NEVL
A0A2W6B4S3      LAFLAALLLVLGVGFVSDRLDDSVRGEEEIKELTGLPLLGIVPSIDMLKDRAL-SPNSLL
A0A1Y6K3L6      LYASVGFLLMAGIAFLMEYLDDTIKTPEDVKQILGLPVIGLVADMETGRSKHKGQSKGVF
A0A1F8QKW6      MSIAIAFMISAGAAYLIEYLDDSIETPEEINRVMKLPVIGFIPEID--NDVHK----ATI
A0A356DVN8      LGAAIGLLITAAIVFLIEFLDDTLKTPDEIKAILEVPVIGFIGELKQSSKKGE-DALGVY
A0A1F3AZM3      LAAAVGLMLAAGIAFLIEYLDDTLKTMEDIERVMQLPVVGYIAEIQYESGSDE----SLY
A0A350FYF2      LAGLVGFSLGSGAAYLLEFLDRTIKTTSDVERIFNLPVIGYISEIY--ENGNN----AAY
A0A363U3C3      LAGLVGFSLGTGAAYLLEYLDKTVKTASDVERIFGLPVIGYISAIT--DDEDS----GTY
A0A0M8JPC7      LCGMAGLVLGAGCAYLLEYLDEAIQNPEELARLIDAPIVGYISDLG--RKANA----SLY
A0A1F8PQP8      LSTVIALALAAAAAYLIEYLDDTLKSPDEVTKLLDIPVVGFISEVE--RGKSL----EYY
A0A351G432      LGSVAGLMLASGLVFLIEYLDDTVKSPDELSRFSSIPIIGYLPSLNQSKLNGK-NQSNVY
A0A353H3Y9      LAAVVGFMIAAGVIFLITFLEDTIRDPEEVTRKWGVPVLGVIS---R---YGS-TATPII
A0A2M8PN31      LGFIGGIGLGLVCVFGLAFIDDRVKSTVDVENSLNINLICLIPKVAR---KNS-FDKARI
A0A2N2PFW9      LAAVVGAMIAVGAVFLIEYLDDTIKTPDDVARVSGLSTLGAIA-----------------
A0A2N2MQC3      -------------------MGKMFDVLQKLEREKTADQKKEEPAIVSDPDNQV-LDNKIV
A0A0S7BVT9      -------------------------------MLTMDRKLLTNFFRKNQKINDQ-NIRSLK
A0A3N5RU86      ITVALAMAVGLSLSGSVAYVLEYMDGAIKSQDEIEVLLNTPVVGNIFEVKQGK-NKQPFS
A0A3N5NV84      ----MAAAIGLVLAVGGALLIEFLDDTVKTPDDLQRTAQLTTLGTISRVAGGE-DKYRLI
A0A3B9YZ03      -----------------------------------MTSSSGAPVPSGPESAVK-GTPDVI
A0A3L7X1Q5      -----------------------------------MTSSSGAPVPSGPESAVK-GTPDVI
A0A3M1E8I5      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A2M8PT60      ----------------------------------------------------M-ANAKLI
A0A3M1YX52      ----------------------------------------------------M-GNTKLI
A0A2W4MA80      ---------------------------------------------MSLSNGTS-P---LI
A0A2A6RLU6      ----------------------------------------------MSSNGST-AETTLV
A0A2H3KNY1      ----------------------------------------------MGANGSS-PETTLI
A0A1V5YJ40      ----------------------------------------------MTDKTAS-DL--LV
A0A2N5K785      ----------------------------------------------MTNKATP-NLSQLV
A0A3D0CW09      -------------------------------------------------MTIQ-GRAALI
A0A399ZSS8      ------------------------------------------------------MTNSLI
A0A3M1DIE1      ---------------------------------------------------MT-QKPRLI
A0A3C0ZZ70      -----------------------------------------------MIMANN-RQESLI
A0A1F8N3P4      ---------------------------------------------------MS-DNPDLV
A0A3M1M4P3      ---------------------------------------------------MK-REIPLV
A0A160T936      --------------------------------------------------------MALV
A0A3D0US14      --------------------------------------------------------MSLI
A0A3L7VU47      ---------------------------------------------MTNPVAAS-PTSTLI
A0A426U8Y8      ---------------------------------------------------MT-TETTLV
A0A3M1EV88      -------------------------------------------------MAVE-EQAKLV
A0A2E0ZA41      --------------------------------------------------------MDLV
A0A3M1ZY58      -------------------------------------------------MNKE-AEKYLI
                                                                            

A0A3M1MN85      LRKRPRSPAA--DAFRSIRNALGY----LADAPYRTLLVSSAAAGEGKSTVAAGLAISLA
A0A2E6YFL8      THTDPSSPYS--EAFRHIRANFQF---ATANKQPPLFLITSPGPGEGKSTIISNLGASLA
A0A2W6B4S3      FFTGKRSPEA--ESFRVVRTGIAF---SRIDDPPRCLLVTSTVQAEGKSTFASNLACAFA
A0A1Y6K3L6      VADQPRSPIS--EAFRSMRTSLEF---YSVDQQLQMLIVTSSGPEEGKTTIASNLAVIIA
A0A1F8QKW6      VAEKPRSVVA--ESFRAVKVSLDF---GQVDVPAKSFLVASVSKTEGKSMIASNLAMTYA
A0A356DVN8      VAKNPRSPVA--EAFRSLRTNLEY---SSVDNPVKTVLVTSSRESEGKSTIAANLAIVEA
A0A1F3AZM3      VTRQPRSPVS--EAFRLLRTNLEF---AGVDRPIRRLLVTSAGPGEGKTTIAVNLAAIMA
A0A350FYF2      VYENPNSIIA--ENFRLIRSNIEF---FQISNPITTILITSPNQGNGKTTVASNLAISIS
A0A363U3C3      VEKNPDSILA--ENFRLLHSNIEF---FRVSNPIRTILVTSPNQGNGKTTVASNLALSIS
A0A0M8JPC7      VARHPRSLMA--EAFRTLRANIEL---QNLDNGPLALLITSPDTGDGKTSVAANLAVSFS
A0A1F8PQP8      ITNQPRSLIA--EAFRSLRTDLEF---SSVDKPLKTIYVTGTEVEAGKTSIAINLAIVIA
A0A351G432      VQENPRSPAA--EAYRSLRTNIEF---AGIANQTKTIMITSASPQEGKSTTAVNLASILV
A0A353H3Y9      TVSQPRAPVS--ESFRSLRTNLQF---ASVAAPLKTILVTSPSPEDGKTSVVANLANVVS
A0A2M8PN31      VQNNMEPRAA--ESFRSLYSSIRI---SDVGRHSQVILTTSTLPSEGKSFVATNLAYTFA
A0A2N2PFW9      ----------------------RL---KETGGTRQL--------SEGKSTTAANLAVVMA
A0A2N2MQC3      SFFAPSSMVT--EQFRRLRTHIIQ---PNQPNSPKTIVITSTLSGEGKSLIAINLAIIIA
A0A0S7BVT9      KITDENSPFQFVEAYKSLRTNIDF---VSVNKRYQTIEITSAIPKEGKSGIAINLSISFV
A0A3N5RU86      IADNPRHPVT--EAFRNLRTFIEF---TNRDK-LHTILVTSAGSNDGKTWIAANLAISMA
A0A3N5NV84      PAEEPLSHVA--EAYRALRTNIRL---SSVDEPIRTLIVTSPSPREGKSTTAANLGVVVA
A0A3B9YZ03      VYTDPRSPAA--EAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIAFA
A0A3L7X1Q5      VYTDPRSPAA--EAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIAFA
A0A3M1E8I5      --------------------NIQF---MAVDHPTKTLLVTSPSLGEGKSTTAANLGVIMA
A0A3N5PDS6      ------------------------------DRPLRCLVVTSALAAEGKTTTVANLAVVIA
A0A2M8PT60      TLTDPRSPAS--EAFRTLRTNIMF---SSVENPITTLTVSSPAQGEGKSTLIANMAVTFA
A0A3M1YX52      TLTDPRSEAA--EAFRTLRTNLMF---SSVENPIHTLLITSVAQSEGKSEVLANLAVTFA
A0A2W4MA80      AIRDPRSPAA--EAYRTLRTNIQF---TSLDRPLRTLLATSTAPDEGKSTTLANLAVTIA
A0A2A6RLU6      TLRDPGSPAA--EAYRTLRTNILF---SSLDRPLRTLLVTSTAPNEGKSTTLANLAVTMA
A0A2H3KNY1      TLRDPGSPAA--EAFRTLRTNLLF---SSLDRPLHTLLVTSTAPDEGKSTTLANLAVTMA
A0A1V5YJ40      TLSDPRSPIS--EAYRTLRTNLQF---VSLDKPLRTILVTSAGPDEGKSTLIANLAIAMA
A0A2N5K785      ALRDPRSPAA--EAYRALRTNIQF---SSLDKPLRTILTTSTAPDEGKSTTVANLAITIA
A0A3D0CW09      TLTDPRSPVS--EAYRSLRTNLEF---ASLTGPLRSLVITSPGPGEGKSTMLANLAVTMA
A0A399ZSS8      TISNPRSPIA--EAYRTLRTNLEF---SNLDKTLRTLLVTSAGAEEGKSTMLANLAVTIA
A0A3M1DIE1      TLTDPRSPAA--EAYRTLRTNLTF---AGLDQPLEALVVTSPAMEEGKSLAVANLAVTMA
A0A3C0ZZ70      TISNPRSPIS--EAYRTLRTNLEF---SSLDKPLRTMVVTSAGPEEGKSTTLANLAVTLA
A0A1F8N3P4      TLSDPLSPIS--EAYRTLRMNLQF---AALDSPLRSLLITSATPGEGKSTTLANLAVTMA
A0A3M1M4P3      TLTHPRSSAA--EAYRTLRTNLTF---ASLDKPIRSLIVTSAAPGEGKSTTLANLAVTMA
A0A160T936      TISDPRSPAS--EAYRSLRTNLSF---YSLDAPLRTLVVTSPAAGEGKSSTVANLAVTMA
A0A3D0US14      TLTDPRSPVS--EAYRTLRTNLSF---TGLDEPIRTLVVTSPAPDEGKTTTIANLAVTIA
A0A3L7VU47      ALSAPQSAAA--EAFRSLRTNIQF---ASLDHTLQLITITSAGVDEGKSLVAANLAITMA
A0A426U8Y8      TLRDPGSAAA--EAYRTLRTNILF---SSLDRPLRTLLVTSTAPNEGKSTTLANLAVTMA
A0A3M1EV88      TLSDPRSPVA--EAYRSLRTNLEF---SSLDEPLRTMVVTSPAPEAGKSTTLANLAVTMA
A0A2E0ZA41      TITNPRSPLS--EAFRTLRTNLSF---YSLESPLRSLVVTSPVMGEGKSSTVANLAVTMA
A0A3M1ZY58      TLSDPRSPVS--EAYRTLRTNLSF---YSLDNPLRTLVVTSPAADDGKSTTVANLAVTMA
                                                              **:     :.    

A0A3M1MN85      -QAGYRVILVDADLRAPSLHTMLG--LPQK-PGLSDVLQGK----IPLAESIIMLEN-L-
A0A2E6YFL8      -QNGKKVIILDADLRKPTIHRRFN--LKKREPGLSTFLSDK----DLTPSEIIMNPG-IP
A0A2W6B4S3      -ESGKSVILVDLDLRRPSLSKIVN--TPMR--GLTNVLLDQ----ASSLESYLVAGA-LP
A0A1Y6K3L6      -GSNKKVLLLDADLRRPNVHQRLM--IPNR-VGLSDLIRGR----LEINDVIQFSTE-IP
A0A1F8QKW6      -LSGKKVFLLDADLRRPSLHTYLD--LPNA-KGLTTLLLHP----EKSIQQCAQSLP-IG
A0A356DVN8      -QSGKAVVIVDADMRRPKVHLQFS--KPNR-MGLSDVVTGK----LGIDDVLKTYDQ-VE
A0A1F3AZM3      -QGGKRVVLVDADLRRPKIHRFLG--LSNK-VGLSDLFRGV----VAVRMVSQQVQD-VE
A0A350FYF2      -HGEQDVVLVDADLRRPAIHNVLN--ITKN-PGLSDVIRNK----TDIDSVVRYWK--ED
A0A363U3C3      -HEEQDIIIVDADLRRPAIHNALK--VPKN-PGLSDILRNK----ADVKSVVKSWKD-DD
A0A0M8JPC7      -QGGKRVILVDGDLRKPSLHEFFD--ISDR-RGLTDVLQGK----LSVEKALRTWD--GG
A0A1F8PQP8      -QSGKRVILMDADMRRPNVHRVLS--LTNQ-KGLSDVFRGT----IDIYNATIPYK--EG
A0A351G432      -QGGKKVVLLDADLRRPFIHRFYK--FSNR-VGLSE-----YFRGEVSLESTFNYVDPSR
A0A353H3Y9      -QNNRKVLVIDGDLRKPRIHKIFQ--LPNR-IGLTDYFLHA----QERLNGVIKKTE-IK
A0A2M8PN31      -SHGERTLLIDGDLRMPAIAQSLQ--MEDE-VKAHGGGLVGYFEGSTSWENMIVNEI-AH
A0A2N2PFW9      -QTGQRVVLVDTDLRRPVMHKVFG--AANN-TGLTSALLNG---DQVVLDGHLQGTE-VE
A0A2N2MQC3      VEMQSHALLVDCDIRNPSIARLFG--LKDT-KGLSNYLLGE----AE-IPDLLIKTS-VD
A0A0S7BVT9      -EIGKKVILIDADLRKPMLSSYLGENPADA-KGLSTVLTGC----DLYASILHTKF----
A0A3N5RU86      -REGKRVVLIDADLRNPSLHQFFH--EERE-NGLTDLFQGK----QA-VTDVLKYNN-KE
A0A3N5NV84      -QAGKSVILVDADLRRSSLHRFFA--LPSK-EGLTNVLVQD----ELAVDGWLQETG-ID
A0A3B9YZ03      -QAGMRVVIVDADLRRPAQHLRFN--LPNS-DGLSNLFGGA----TP-RTPTLQPTA-VP
A0A3L7X1Q5      -QAGMRVVIVDADLRRPAQHLRFN--LPNS-DGLSNLFGGA----TP-RTPTLQPTA-VP
A0A3M1E8I5      -QADLRTIVVDADLRRPSLHKIFQ--VPNA-GGLTDLLRSP----EMELADQLKRTE-FE
A0A3N5PDS6      -QGGKRVVLVDADLRRPAVHRLFG--MPNR-GGLTDALVEE----PAALNSFLRDTA-VE
A0A2M8PT60      -QGGNKTILVDCDLRRPSQHEIWD--VENE-RGLTTMILED----AAISSPPLVETE-VD
A0A3M1YX52      -QAGHKTIIVDSDLRKPAQHEIWG--VANE-RGLTSMMLED----TALAEPPLIKTE-VE
A0A2W4MA80      -QAEQRVILVDCDLRRPSLHTLFD--LSNE-SGLTNMILAS----ED-TPPPLQETG-VP
A0A2A6RLU6      -QAEQRVLVVDCDLRRPSLHTLFG--LPNE-QGLTSAILAQ----ND-DLPPAQATV-VP
A0A2H3KNY1      -QAEQRVLMVDCDLRRPSLHTIFG--VPNE-RGLTSAVLAQ----DD-GPLPIQPTS-VP
A0A1V5YJ40      -QGERKVILVDCDLRRPSLHKLFG--LGSR-EGLTSMMVAE----GGSAEPPLQETG-VP
A0A2N5K785      -QSEQRVILVDCDLRRPTLHTLFG--LPNE-EGLTSLMLQE----GGRV--PLQKTE-VP
A0A3D0CW09      -QAGKKTIVVDTDLRRPSQHELFG--LDQE-PGVTTMFMDP----ALQSAPPLQATE-IE
A0A399ZSS8      -QSGKRVILVDADLRRPTQRQIFG--LKDN-AGLTDMARDD----AARAQPPLQDSG-VP
A0A3M1DIE1      -QGERRTILVDADLRRPRLHAIFG--VSND-RGLTTMFVEP----AAMANPPLVDVG-VE
A0A3C0ZZ70      -QAEKKVILVDCDLRRPSQHEIFE--VENG-VGLTTMVVDE----EAFKNPPLQETP-VP
A0A1F8N3P4      -QVDQRVIMVDCDLRRPCLHTFFG--LPNN-VGLTNMMLED----QALDDPPLQSTR-VP
A0A3M1M4P3      -QGDRRTILVDADLRRPSLHRIFG--LPNE-PGLTTMFVDE----ASRTDPPLLETG-VE
A0A160T936      -QSGRRTVLVDCDLRRPTLHELFG--LAMT-PGLTSLALDE----TV--DLPLQETS-VE
A0A3D0US14      -QGGRKTILVDCDLRRPTLHTLFD--LKPE-PGLTNLLLEE----NG--QPALQPTM-VD
A0A3L7VU47      -QAEQRVILVDCDLRRPALHSLFG--VSND-TGLTSMLFAN----AG-DAPPLQATS-VP
A0A426U8Y8      -QAEQRVLLVDCDLRRPSLHTLFG--LSNE-QGLTNAILAQ----GD-ELPPLQATA-VP
A0A3M1EV88      -QAGKQVILVDCDLRRPSLHEIFG--VSNT-TGLTSVILDD----TT-SAPPLRETG-VP
A0A2E0ZA41      -QSGRKTVLVDCDLRRPSLHTLFD--RQVE-PGFTDAILHN-------DEPVLQETA-VE
A0A3M1ZY58      -QSGRKTILVDCDLRRPSLHTFFG--LPAE-PGLTNMLLDD-------DEPPLQETG-VE
                       .::* *:* .                                           

A0A3M1MN85      GIDLLTSGDIPDQSTELLASRAMQTTMAQLGQSY--D--VVVLDGPP-FAVPDAVVLARR
A0A2E6YFL8      NLDIIPSGPVPPNPSELLGTERMKNLCNDLHSKLNYD--YVLLDSPPILVVADGSVLASI
A0A2W6B4S3      NLRVLPSGPTPPSPAELISSLRMAQVIQRLQTMA--D--IIIIDSPPILAAADAAITAGL
A0A1Y6K3L6      YLNLITSGSLPPNPAELLGTQKMLSILEDLRAKF--D--MIVIDTPP-AIVTDAQILASK
A0A1F8QKW6      NLSVITAGNSVENPSDLIGSQRMKDILLELSERS--D--YLIVDGPP-VLVTDSTILSTA
A0A356DVN8      NLSIITCGTIPPNPAELLGSERMSQTLKDLKMRF--D--VIILDTPP-MIVSDAQILSSK
A0A1F3AZM3      TVSVLTSGSLPPNPTELLASVRMEQILQEAEQDA--D--IVIIDSPP-SLVADVQVLAGK
A0A350FYF2      GLKVITAGDIPPNITEVVGSKRIASILEELKEKH--E--IVVIDAPP-LIIADSYNLASK
A0A363U3C3      GIKVLTAGNIPPNVTEVVGSKRIAMILSGLEKEY--E--LVIVDAPP-LIISDAYNLASK
A0A0M8JPC7      GLRLITVGDEAVLPDLLLTAEKVENLLCELKPLA--D--IILIDSSP-FLVSDAMIFAAK
A0A1F8PQP8      NIFIVPSGSPPPNPAELLSSKKMDQILESLKKVA--D--VVIVDGPP-FLVTDAQILASK
A0A351G432      RLIAIPSGKLPPNPAELLGTEQMSALLQQLELIS--D--YIIIDSPPL-VVTDPVILATK
A0A353H3Y9      SLFVITSGNLPPNPSELLGSERMQEVVETLSSHF--D--PIFIDTPPLLAVTDALVLAPR
A0A2M8PN31      NLDMLASVKNASVPSEIANSSHFIDIINVLRQTY--D--RIIVDTPPIGVVSDAMALVPA
A0A2N2PFW9      NLSLLTSGPIPPNPSELLGSHRMARLVEKLVGQA--D--LVIFDSPPVLAVTDAAVMGRQ
A0A2N2MQC3      KLSLIAGGPLQENPVELIGSERMKNLIQELKTRY--KDRYIILDCSPLLATTEPTVLTEM
A0A0S7BVT9      HFDFLPAGLIPPNPVELLGSRQMGEILCELRNEY--D--FIVIDTPPVSLLTDAVTLCQF
A0A3N5RU86      RVGLITAGELPQNTYELMNIKMMERILMELMDAV--D--TVIIDSPPFF-IADSVLLSSL
A0A3N5NV84      NLRVLTSGPLPPDPADLLGSKRMHHLIECLEHEA--D--LIIFDTPPTIPVSDATVLALE
A0A3B9YZ03      NLHVLTSGTEPESPADILASSDLDHIMDHAGRDA--D--LVLIDCPPICAVADASVLSTR
A0A3L7X1Q5      NLHVLTSGTEPESPADILASSDLDRIMDHAGRDA--D--LVLIDCPPICAVADASVLSTR
A0A3M1E8I5      NLQIITSGPLPPNAAELLGSQRMGHILKQLTGMA--D--IVIFDTPPVLSVTDATVLAGR
A0A3N5PDS6      NLRVLTSGPIPPNPQELLGSQRMEDLLQRLQGEA--D--VVLVDTPPSLVVADANVLAAR
A0A2M8PT60      NLQLLPSGPVPSNPADIISSQRMNEVIGVLKARA--N--YVLFDSPPVLAATDAALLASK
A0A3M1YX52      HLQVLPSGPLPPNPADLLSSQRMQEVIGILKARA--A--YVLFDSPPVLAATDAAVLGVK
A0A2W4MA80      GLSLLASGPLPPRPADILGSRRMEQIIARLSGMA--D--MVLFDTPPVIAVTDAAVLATR
A0A2A6RLU6      GLKVLTSGPLPPRPADLLGSRRMAAMIERMSANA--D--IVLFDTPPVVAVTDAAALAPR
A0A2H3KNY1      GLHVLTSGPLPPRPADLLGSRRMGALIERMRSEA--E--IVLFDTPPVVAVTDAATLAPR
A0A1V5YJ40      GLTLLASGPLPPSPSDLLGSRRMDAVLATLKERA--D--VVLLDSPPVVAVSDAAVLATK
A0A2N5K785      GLMVLTSGPLPPRPADILGSRRMEAVIAQLREHA--D--IVLFDTPPVNAVTDAAVLATK
A0A3D0CW09      GLWLLASGPKPPNPAELLAAPQLRTIIEALTARA--D--IVLFDAPPVVVVTDAAVLASQ
A0A399ZSS8      NLQVLTSGQLPPNPAEILGSKRMSEILAALLEQS--D--IVLLDAPPVLAVTDAAVLSGK
A0A3M1DIE1      NLWLLPSGPLPPNPADLLGSRRMDEVLAALRARA--D--ILLFDAPPVIEVTDAAVLGRK
A0A3C0ZZ70      NLKLLPSGPLPPNPSELLGSRRMEEIIATLRERA--D--LVLFDAPPIIAVTDAAVLASK
A0A1F8N3P4      GLHLLASGNLPPRPPDLLGSERLERVIERLLAEA--D--ILIFDAPPVIAVPDAVVLSTK
A0A3M1M4P3      HLWLLPSGPLPPNPADLLGSRPMEEIIASLLERA--D--FLLFDAPPVIAVTDAVVLSTR
A0A160T936      NLWLLSSGPKPPNPADLLGAARMGRLIDQLLERA--D--FVLFDAPPVMAAADAAILGAK
A0A3D0US14      GLQLLSSGPLPPNPADLLGSHKIDQIIATLLERA--D--IILFDAPPVIAVTDATVLGAK
A0A3L7VU47      GLQLLASGPLPPRPADILGSRRMGEILQALRGLA--D--VIIIDTPPVLAVSDAVVLAPR
A0A426U8Y8      GLSVLTSGPLPPRPADLLGSRRMAALIERLSANV--D--MLLFDTPPVVAVTDAAALAPR
A0A3M1EV88      GLKLLTSGPLPPNPAELLGSRRMADLIRALREQA--D--IVLFDAPPVIAVTDAAILASQ
A0A2E0ZA41      NLWLLTAGTKPPNPADILGTPQVDQLIARLQEKA--D--IILFDAPPVNAVTDAAVLGAK
A0A3M1ZY58      NLWLLASGPKPPNPADLLGARKVDRVIERLKEMA--D--VILFDAPPVVAVTDAAVLGAK
                 .  :.          :     .                 :..* .*    .:       

A0A3M1MN85      VEGMLWVIRVGYSRRTAVKYMQEQIEQTLVNVLGVVINCGRGPRA---------------
A0A2E6YFL8      ATAGILIVDGFSTKIGSLQSAVNTLNGTAIETLGIIVNKLKNSRF--------------S
A0A2W6B4S3      CDSAVLLVRPDRITRRGLTRAVETLNGVGVRVIGMVVNGVPRTDA---------------
A0A1Y6K3L6      TDGVIYVIRPGKTRSLVARTPLEEFERLGANVIGVVMNRIPHNRG--------------Y
A0A1F8QKW6      VDEVLIVVGYGLTRRSEAAVALKRLESAGAKIGGVILNRIPRNNR--------------A
A0A356DVN8      VDGLVYVVIPGQTRAITAMRPLEELRRIESKVLGVVANKIPRNRD--------------Y
A0A1F3AZM3      VDGVILIIHPGHTQEDASLATLEMLNRAGARTLGVVLNRIPRGRS--------------D
A0A350FYF2      VDGVILIMEPGQTSEEQAMTIKEQLDRSNAHLLGIVFNKISEQSA--------------H
A0A363U3C3      VDGVILVMEPGQTTEAQARTIKEQLDRSGARVLGIVFNKVTEEMA--------------H
A0A0M8JPC7      VDGVITVIRPGYTSREMARVMKERIAMAGGKIIGVVLNRIPLKRI--------------G
A0A1F8PQP8      VDGVLLVVRYGFSRKNAAISAVQQLKRADARAIGVVMNRIPRTAS--------------G
A0A351G432      VDGVLLVIQPGVTRISSVRASIDQLERAQARILGIALNNITRQNA--------------Y
A0A353H3Y9      VDGVILVIDPAKTKRAALQHSIEQLKQVNANLLGVVLNNVKISRS--------------H
A0A2M8PN31      VDACLYVVKHKGVKMRSIRDSIRRLRDVHMPILGAVMNQVDKVGS--------------G
A0A2N2PFW9      VDGVLLVVDAGQTREQVVAQAAAELQKTGANLLGVVLNRLDSRRG--------------G
A0A2N2MQC3      ADGILMVIKSGKTPRESVQQALRLLNK--DKIMGVVLNGMEYRTKALIQRHFGTNRYYHD
A0A0S7BVT9      VDGIIFVIRQKTASIDQIKFAMKKLESVKANVIGAILNDYVVPKDSSQSKNYYNNYS--D
A0A3N5RU86      VDSVLAVVRPNHTLKQSALAMIEQIHRSGGNLTGVVINRIPFRQLKYYLKYPYNSLE--K
A0A3N5NV84      ADAVLLVVEAGRTRRGAIRRTMEDLQRAGAHVLGAVLNRVTSRPS-----------K--G
A0A3B9YZ03      VDGVIVVVGAGVVKRDLARHARAQLDAVRANVIGLVVTNAPYNER----------TF--A
A0A3L7X1Q5      VDGVIVVVGAGVVKRDLARHARAQLDAVRANVIGLVVTNAPYNER----------TF--A
A0A3M1E8I5      VDGVVLVIQAKRTRRDAARHAVQRLQQVGATILGAVLNQSGKGSG----------YY--Y
A0A3N5PDS6      TDGVLLVVNADRTRRVAVQQAAEGLRQVGANLVGGVLNMVDIRRGRGAGYYSYYGYY--S
A0A2M8PT60      TDGVLLVIRAGHTRRDQAARARQALERVHVRIVGAVLSNAPREDS-----------G--E
A0A3M1YX52      LDGALLVVQAGNTRRDHTARARDALERVHVRLIGAVLTNADRETA-----------G--S
A0A2W4MA80      VDGVLLVFQAGKTSRDRARRTREVLEKVKANIVGVVLNGAELEQG-----------Y--G
A0A2A6RLU6      VDGVLLVLHAGHTRRDRAREARQLLEKVKANIVGVVLNGAKQERG-----------Y--T
A0A2H3KNY1      VDGVLLVLHAGQTRRDRAREARRLLEQVKANIVGVVLNGAKVERG-----------Y--A
A0A1V5YJ40      VDGVLLVVSAGHTRREGVQAAKAKLEKVNANLLGAVLTNATMDTS-----------L--S
A0A2N5K785      VDGVLLVFRAGATRRDRAGEARRLLDKVNANIVGVVLTDVKQEDG-----------Y--S
A0A3D0CW09      VDGVLLVIQAGKTKRDQAAQAKTLLDQVRARLVGTALTNVKLDPK-----------L--Q
A0A399ZSS8      VDGVLLVVSAGKTKRENAKKAQAQLEKINARIIGVVVNNVQAEKG-----------A--S
A0A3M1DIE1      ADGILLVMTTGRTRRDHALRAKEVLERAHVRLVGVVLTDVSVSRA--------------H
A0A3C0ZZ70      VDGVLLVINAGTTKRDHAQRAKALLEKVNARLVGAVLNNVRMDIS-----------L--H
A0A1F8N3P4      VDGVVLVLNAGETKREHAQHAVERLNRVNVRIVGAVLNNVPLDAT-----------L--H
A0A3M1M4P3      VDGVLLVVQAGRSRREHVQQAKQLLERVQARLVGAVLTNAPSDSV-----------M--G
A0A160T936      VDGVLLVIQAGKTRRDHSERARELLEKANVRIIGATLTNAPQDRS-----------M--R
A0A3D0US14      VDGVLLVISAGKTRREHAERAKEMLEKANVRIFGAALTNAPKDSS-----------I--G
A0A3L7VU47      IDGVILVMQAGRTRREPAKQARIVLEKAKAHIVGVVLNDAEMTQS-----------S---
A0A426U8Y8      VDGVLLVLHAGHTRRDRAREARQLLEKVKANIVGVVLNGAKLER----------------
A0A3M1EV88      VDGVLLVLNAGVTRREHAQRAKAALEKVNARLIGTVLNNVKLDTS-----------L--Y
A0A2E0ZA41      VDGVLLVLSAGKTRREHAERAKEILEKARVNIVGATLTNAPVDSS-----------M--E
A0A3M1ZY58      VDGVLLVISAGKTRREHAERAKELLQKAHVRLVGVTLTNAPKDDA-----------I--S
                    : :.                :        *   .                      

A0A3M1MN85      ------HYYQVYGYHGYYQDGNGRERRKPAFRRLVENLRR-----TK-------------
A0A2E6YFL8      YGYRYPYYYNYYYYQSYYQYNEAGEKTEKQEKRSTKSTIKKLFRWSK-------------
A0A2W6B4S3      ---------DYYGYGNYYDYQAPAARGDGAKPVAITTDKKNAA--GQ-------------
A0A1Y6K3L6      YYGGFEYYSPNVY--GSEKYYVDSHNDQPF--------------------------IPIQ
A0A1F8QKW6      YYRLYHY--------DY---------GMPAEDTRSIKLGKFHFPMKFNRPVNKKKKPASH
A0A356DVN8      YYGGYNYYSPYSNHYSYHTESIVPNSEIDMDSKKVTPLGSVFEKYQRRDADKQN------
A0A1F3AZM3      YYGGYRHYSPYYS--GYH--YYHSMDGQDLKPSRMRRLFGKLSPFNHNGHKKVEAGVVEE
A0A350FYF2      SSYDYQYRSLYSP--KYYGDYISKSTNEPNTGSRSKKIMDFFEHGQLPPDMAESVELTIT
A0A363U3C3      SYYDYRYQSLYSP--KYYGDYISTASREPNTGSRSRQLMDFFEHGKVPADVAVEVEHAIT
A0A0M8JPC7      YYGGYRYYLPY----GYY---------------EKKKKREEDEDKKVPKKSELTFSGK--
A0A1F8PQP8      YYGYGMYHSYP----GYYIAEEDGATQPSITDRLKPPRKSRPKDKSTGDALNLEKTES--
A0A351G432      YYASY-------YQQEYYAPDEEEARSLN-------------------------------
A0A353H3Y9      YYYNRDY-----YYGKPYGKAAEESGGSGADTDTTELELQKPALRD--------------
A0A2M8PN31      YYHNYTDKNYHKYYGAYTPQKTQNPKRVSKPKKK--------------------------
A0A2N2PFW9      YY----------YYYYYYSEEEGGQRRRSASR----------------------------
A0A2N2MQC3      YHYSKTHPEPDNWEKAALILKDIKMLLLKLIPHKKGER----------------------
A0A0S7BVT9      YYQHK-------------------------------------------------------
A0A3N5RU86      YHLASERMQKEPR-----------------------------------------------
A0A3N5NV84      YYYYE-------------------------------------------------------
A0A3B9YZ03      SYYEESPGRSAS------------------------------------------------
A0A3L7X1Q5      SYYEESPGRSAS------------------------------------------------
A0A3M1E8I5      SYYTQTGARPVKQPRRAPQRRWWQIGSTR-------------------------------
A0A3N5PDS6      HYYGEEEGERHRGPRGWWRRLRRGKEAGSPRDGVSPAA----------------------
A0A2M8PT60      YYGL--------------------------------------------------------
A0A3M1YX52      YYG---------------------------------------------------------
A0A2W4MA80      YYS---------------------------------------------------------
A0A2A6RLU6      Y-----------------------------------------------------------
A0A2H3KNY1      Y-----------------------------------------------------------
A0A1V5YJ40      RYYDAREEVSG-------------------------------------------------
A0A2N5K785      YYGS--------------------------------------------------------
A0A3D0CW09      GYY---------------------------------------------------------
A0A399ZSS8      YYYAESN-----------------------------------------------------
A0A3M1DIE1      RYY---------------------------------------------------------
A0A3C0ZZ70      RYYAEQKQA---------------------------------------------------
A0A1F8N3P4      RYYR--------------------------------------------------------
A0A3M1M4P3      AYYTDEW-----------------------------------------------------
A0A160T936      EYYG--------------------------------------------------------
A0A3D0US14      GYYD--------------------------------------------------------
A0A3L7VU47      GYYG--------------------------------------------------------
A0A426U8Y8      GYAY--------------------------------------------------------
A0A3M1EV88      GYYSAQ------------------------------------------------------
A0A2E0ZA41      AYYG--------------------------------------------------------
A0A3M1ZY58      GYYG--------------------------------------------------------
                                                                            

A0A3M1MN85      -----------------------------
A0A2E6YFL8      -----------------------------
A0A2W6B4S3      -----------------------------
A0A1Y6K3L6      DIETEPKK---------------------
A0A1F8QKW6      DTSDLGDQVASRVDKTI------------
A0A356DVN8      -----------------------------
A0A1F3AZM3      NVIEKP-----------------------
A0A350FYF2      AIKTQPKQIVERLRKSKKNG---KNGKDG
A0A363U3C3      AIKTQPRKTMERLRKSKKSGTGRKNGKNG
A0A0M8JPC7      -----------------------------
A0A1F8PQP8      -----------------------------
A0A351G432      -----------------------------
A0A353H3Y9      -----------------------------
A0A2M8PN31      -----------------------------
A0A2N2PFW9      -----------------------------
A0A2N2MQC3      -----------------------------
A0A0S7BVT9      -----------------------------
A0A3N5RU86      -----------------------------
A0A3N5NV84      -----------------------------
A0A3B9YZ03      -----------------------------
A0A3L7X1Q5      -----------------------------
A0A3M1E8I5      -----------------------------
A0A3N5PDS6      -----------------------------
A0A2M8PT60      -----------------------------
A0A3M1YX52      -----------------------------
A0A2W4MA80      -----------------------------
A0A2A6RLU6      -----------------------------
A0A2H3KNY1      -----------------------------
A0A1V5YJ40      -----------------------------
A0A2N5K785      -----------------------------
A0A3D0CW09      -----------------------------
A0A399ZSS8      -----------------------------
A0A3M1DIE1      -----------------------------
A0A3C0ZZ70      -----------------------------
A0A1F8N3P4      -----------------------------
A0A3M1M4P3      -----------------------------
A0A160T936      -----------------------------
A0A3D0US14      -----------------------------
A0A3L7VU47      -----------------------------
A0A426U8Y8      -----------------------------
A0A3M1EV88      -----------------------------
A0A2E0ZA41      -----------------------------
A0A3M1ZY58      -----------------------------
                                             

© 1998-2019