BYKdb

Dataset for cluster tad of phylum chloroflexi

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A5V0I4      MQLSDYLAVLRRRWWVILLTMVVAVASALIFSRLQERIYRSEASYLVVPNRIDNGLSIVL
A7NQ70      MQLSDYLAVLRRRWWIILLTTVVAVASALIFSRLQERVYRSEASYLVVPNRIDNGLSIVL
            ***************:**** ****************:**********************

A5V0I4      QNSMSSFREMALARPQLQKISDELKLDRTPEWLLKRVAIQPRPDERKMIVQVDYPDPATA
A7NQ70      QNSMSSFREMALARPQLQKISDDLQLDRTPEWLLKRVAIQPRPDERKMIVQVDYPDPATA
            **********************:*:***********************************

A5V0I4      QRLADAIGNNMVALVSARNNFLEGTDRISMTVLEPATPPVLHRPQTRVNMLAGAVLGLVL
A7NQ70      QRLADAIGNNMVALVSARNNFLEGTDRISMTVLEPATPPVLHRPQTRVNMLAGAVLGLVL
            ************************************************************

A5V0I4      GVLLAFVLEALDDTIKTPSDVERYVQLATLGAIPAVSSDSRGATFTARRARKNEELEVVP
A7NQ70      GILLAFVLEALDDTIKTPDDVERHVQLATLGAIPATGSDTRSAALPARR-----------
            *:****************.****:***********..**:*.*::.***           

© 1998-2019