BYKdb

Dataset for cluster tadcd of phylum chloroflexi

[Download (right click)] [Edit] [Sequences] [Repertoires]

57 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A401ZA55      ------------------------------------------MRSTLSRYILLAKRWAWV
A0A1F8RRT9      --------------------------------------------MQLARYLRLAGRWWWF
A0A3M1EAN8      --------------------------------------------MELKQYLLILWKRVWL
A0A326UPN3      ------------------------------------------MRISLSRYILLAKKWVWL
A0A0P6WSP2      -------------------------------------MLSNREAVGLKWLANWNSPSLRI
A0A1F8QGH2      --------------------------------------MTNNANTDLRRIFSVIRRWLWL
A0A0S8KFR9      --------------------------------------------MELRAYLEILIRRKWV
A0A1Q7TTL6      --------MTLSNLPAPLVPPPVTAPGLPQRGVAAFDSDHSESGVDWRRILSAVLRFKWL
A0A1F8SS27      ----------------------------------------MNDYIELHRLFTMVLRKWWL
A0A3A4VPK9      ---------------------------------------MEDETIDLRQYGLLLKRWSWL
A9B6E3          -------------------------------------------MNIIRRYITGLRRWLWL
A0A3D0CW53      --------------------------------------------MELKEYASVLWKWLWL
A0A3C0XJG2      --------------------------------MDDSSR--GVPGFARARVLFMFRRWGPL
A0A3D1TRD4      MALIAPPMRYTDAGSVTWPAGLSQYSASDTSSADQFNRRYGESMLPNIDYLVWVRRWLWL
A0A2E0L5X9      -------------------------------------------------MLRAILRWWWL
A0A3A0AXU8      --------------------------------------------MELLTYWKILRKRLLL
A0A3D1JCW0      -----------------------------MEHFDGEESTLNTGDTDLRKYLWLLWQWAWL
A0A2N2MJJ0      ---------------------------MEENNDNDTLEFDLIDAASLRRMGGLLWRNAWI
A0A3M1LAM5      ----------------------------------------MSMTFSWRLVWRLVKQWWWL
E8N5M1          ---------------MLYLDTGGMLPIRGNFSMEDFAEPVQQPSTDLRQYLWLLWQWGWF
A0A1F8U7F0      --------------------------------------------MEIKRYFSLVRRWAWL
A5V160          --------------------------------------------MTLQRYLTLFWRWLWL
A0A2A6REI6      ------------------------------------------MDNELLRYLFIIRRWAWL
A0A426TTK3      ------------------------------------------MDNELLRYLFIVRRWAWL
A7NIZ1          ---------------------------------MRQVDEQSEHRMILQRYLTLFWRWLWL
A0A0P6XM68      --------------------------------------------MEIKEYLQIARRWAWL
A0A2N2MEG3      --------------------------------------------MEIKHYYMIAQRWAWL
A0A353RQ31      --------------------------------------------MDIKHFFNIAKRWLWL
A0A3B9KNR2      --------------------------------------------MDIKHFFSIAKRWLWL
A0A0P6XME1      --------------------------------------------MQPRDYLVLIRRWLWL
A0A3B9Q1T8      --------------------------------------------MDIRRILYLLKRWSWL
A0A0M8KAF3      ----------------------------MNTPLVPPDMLTDEDTIDLRQYWLLIRRWWWA
A0A3M1H759      -------------------------------------------MAELRRYRNIV-RWWWL
A0A1F8PTW9      --------------------------------------------MELKKYIFPLRKWWWL
A0A1F8QH26      --------------------------------------------MEFKRYLFPLRRWWWL
A0A3D0UNQ0      -------------------------------------MDELNDFVEIRHYISIFLRRWWL
A0A2G6GG97      --------------------------------------------MELKNYFLLIWRWVWL
A0A359HML3      --------------------------------------------MDIAELIYPLRRWWWL
A0A2U2S5W9      --------------------------------------------MTLRQYFAVIWRWLWL
A0A3M1EJ46      --------------------------------------MINEDQMELRHYLAVLWTWVWL
A0A3M1ZZ81      --------------------------------------------MEIRQYIRLIWRWLWL
A0A3D0D4X6      --------------------------------------------MELRQYARIVWKWLWL
A0A1J4ZRV4      --------------------------------------------MELRQYALLLRKWLWL
A0A1V5RXW5      --------------------------------------------MELREYMALLRKWLGL
A0A3A0B2P8      -----------------------------------------MEELNLRLLLRPLLKWWWL
D1CAL1          -----------------------------------------MRDLTFIEILGLIRRWWWV
D1C8M3          ---------------------------------------------MTSSILARGLRWWWI
I4EI06          ------------------------------------------MDMTIADMLKLGRRWWWV
A0A3D1U3H5      ----------MGSLNRRQEFDSVGIALNPATQALDAEQSSGDRAALLRWYYHLVRRWIWL
A0A2N2MEK3      --------------------------------------------MEIKHYLGMLQRWAWL
A0A3B9J9U6      --------------------------------------------MEIKHYLGMLQRWAWL
A0A1W9UQ51      ------------------------------------------MNKQVAQYVRLLGKWWWL
A0A3C0LJ76      -----------------------------------------MDNRELQMYLRPLLRWWWL
I0I8T2          -----------------------------------------MNQRELQAYLRPILRWWWL
A0A363SX22      --------------------------------------------MELISFLKIFLKRWWI
A0A2E5F6N9      ---------------------------------MVEQNFDEESSLDLRQYVDALIRWSWV
A0A2E6J6X7      -----------------------------------MNQNEQEQSIDFKKYIGLAISYSWL
                                                                            

A0A401ZA55      IILGMVICGGTTYLVTKLLMQPVYEAQTRILITLAGT------S-------QNDSTLAAI
A0A1F8RRT9      IALAALIGGGSAYSIS-QLITPIYRADATLLVNQTQT------P----GVIAYNDILTSE
A0A3M1EAN8      LIAAPLLAGAISYAAS-LRMVPVYRASATLLVSPSGE------S----AALNYSSLLASE
A0A326UPN3      VVVGVVICGVGTFAVSKLFIKPTYKASASIVVTLQT------------SSSPSDNATAAL
A0A0P6WSP2      VLGCVLIATLIAC-LVILLIPPTYKSSTLLLIEPSPG------L----VTDDYSSIIAGE
A0A1F8QGH2      ILGCTLVGGVIAF-SVTSLLPPVYKATATLLVEPSQE------S----SPNDYSTLMAGE
A0A0S8KFR9      VILTTLATVAAVV-LVTSRQQPVYSAAARVRVA-QAS------S----GSIEYVDYMYAE
A0A1Q7TTL6      IATMTLVGTVAGI-GATRFIKPEYSAQTKIWID-VEG------R----GQDRGPTPIRSA
A0A1F8SS27      LIMVTAFAAALGY-TFGHRQAPVYEARATLLVGQIFE------S----ANLEKQDLQTSE
A0A3A4VPK9      LVLSLVIGAATGL-IVSLLSTPIFQSTAKVMITRAGQ------D----QSSDVTAYLTTN
A9B6E3          LVLGPVVAAGAAY-GISSQQTPRYASSTRVIVGQTLK------N----SNPDYGSLVASE
A0A3D0CW53      IIVAMLIAAVSSY-WASLRMQPIYQTSTTLMVGQFIQ------N----PNPTDQDLRISQ
A0A3C0XJG2      IALATVVAGGTAF-AVSEVLPKEYSATSQLYVAPAAN------P----TA-ALQDAVLGQ
A0A3D1TRD4      VLLGTLLGGGIAF-GIAATTAPTYQSSATLLINASST------P----NALTYTDVLLSQ
A0A2E0L5X9      IVLSVSLGVGVGY-IVRSQQPDLYFSEATVIVGA--------------DSNNPVPTGVDS
A0A3A0AXU8      IVLLILVAEFGAV-YYVVSRVPLYSTTTTMIITPSAM------G----SLLSYQVNLTLG
A0A3D1JCW0      IGLATLLAAGAAF-IVSELQTPVYQASTTILVNEAPS------T--Q-SSNYSAIYLTSQ
A0A2N2MJJ0      IALAGLLLGLAAF-IFGRMQAPVYEARTQVLVSRPSM------Q--S-QIVDITQSMNSQ
A0A3M1LAM5      LVVGAVLAGGTGY-YFASKKPNIYAARTTLMVGANIR------NPDP-NSRDFGLTVT--
E8N5M1          IALAGVLAASGAL-ILSLLQTPIYAASTTILVNEARS------G--Q-YYDSTAIILTNE
A0A1F8U7F0      GILGLVLGAAGGY-FSSANQTPVYQASTRFVILRAAQ------T----TAADYYAYLDSQ
A5V160          MLLMTLIAGGAAY-LVSRQMTPIYEASTTLLINQAPA------G--S-SSPDYQAVLTAE
A0A2A6REI6      IIIGTVLSASAAF-LVSREMTPVYQASTTLLINQASA------S--N-ANADYNAILSSE
A0A426TTK3      IVMGTLLSAGAAF-LVSREMTPVYQASTTLLISQASA------N--N-ANADYNAILSSE
A7NIZ1          MLLMTLLAGGAAY-LVSNRMTPVYEASTTLLINQAPA------S--S-ASPDYNAVLTAE
A0A0P6XM68      LILGLLLGAVSAF-FFANSQTRIYESSIRVQIVSAVK------T--V-PNMDYNSYVEQN
A0A2N2MEG3      LILGLLLGGGGAY-IFSSLQEPVYQTTTRVQVVSASR------VGGA-GTDAYSNFYIEN
A0A353RQ31      VIAGVIIGAAVGY-FVSSRQTPIYEASSKFVILRAPQ------T-----TYDYYAYLDNQ
A0A3B9KNR2      VIAGVIIGAAVGY-FVSSRQTPIYEASSKFVILRAPQ------T-----TYDYYAYLDNQ
A0A0P6XME1      LGVGIFVGALGGL-VFSLLQKPIYQASTKVMVLGVPQ------S-----NLSDILNQNSE
A0A3B9Q1T8      LIIVTLISGVAGY-YFSSQQTPMYRASTRFVIMQPAS------T-----DSDNLSLVEIQ
A0A0M8KAF3      FVLALLLGAVAAY-IASQFQQPIYRAEARILVSQSSS------S--D-LNDIYRDIVIGE
A0A3M1H759      VLLSTVIAAGASY-YISDQQPRIYASTTTLMVGQAIA------K----ANPSDQDLYLAD
A0A1F8PTW9      LLASTLVAVVLSY-LYILRQPKIYQTHTTLMIGTTIS------D----PNPSSNEFALGQ
A0A1F8QH26      ILASTLVAAVLSY-LYLYQQPKIYQTHTTLMIGAAIT------N----PNPSYNDFVLGQ
A0A3D0UNQ0      VLLTALVAAGIGY-VVSQSQDRVYRATTSVIVGQSIQ------A----TQLDSRDIQTSE
A0A2G6GG97      IILGVVIAAIAAF-LISKNTAPVYQSTSRLLIDQAPG------A--G-SGNDYTQILVEE
A0A359HML3      IVLATVIAAGASF-AVARQQPPTYQSRATLMIGRTIE------N----PNPTSVQFSLEE
A0A2U2S5W9      IVLAGAVAGGAAY-ASSQSMPRVYQSTTTLMVGQKVM------R--D-PNVTAQDLYVSQ
A0A3M1EJ46      LLLAPLLAAGISL-AVSMHIQPVYRASATLLISQASG------P--SLDSNSYNSLLTSE
A0A3M1ZZ81      IILGAIIAGGTAY-VISKNTVPIYRASSRLLIDEAPG------S--G-SNNEYAELLVEQ
A0A3D0D4X6      IVICTAVSGAIAY-VVSINTAPVYQATASLLIREGKD------P--E-STT-YTDLLTSE
A0A1J4ZRV4      VVICTVVAGGTAY-GVSKNSTPIYQASATLLVNQASN------P--V-SGAGYQDILTSE
A0A1V5RXW5      ILACMILAGGVAF-FVSRQSIPIYQASATVMINQASS------P--S-AAAVYADILTAE
A0A3A0B2P8      IAACTLLAGVSSG-LYTLRQPRTYLSRTTIMVGSSLL------E--P-NPN-SNDLYLAG
D1CAL1          FIVCPLLAAAAAY-GVSRALTPIYRAEATLFIDQRET------T--G-SLN-VGDIQAAQ
D1C8M3          VLVGALAAAALAY-LVSAAMTPIYQAQLTLLIEESQG------T--G-AGD-YNDILAAE
I4EI06          FVACPLLAAGAAY-LVSSLLTPIYEANLMLLINQSRV------P--G-VIN-YDDILAAQ
A0A3D1U3H5      IVLVTIAAGVTGYSVTTLFIKPTYVATATLQVDAGQ-------L--S-SDVNGTGVIASQ
A0A2N2MEK3      LALGLILGGVGSY-LFSVNQSPVYQSSTKLLVIRAP-------Q--G-QNSDLAYLA-SQ
A0A3B9J9U6      LALGLILGGTASY-LFSVNQSSVYQSSTKLLVIRAP-------Q--G-QNSDLAYLA-SQ
A0A1W9UQ51      FVISVIIPAVISY-YFTAQQPALYQAKATIMVGASIF------Q--D-PNPDQTAIRLGN
A0A3C0LJ76      ILLSALLAGASAF-VFVRLRPPVYIASGTVMVGTAI-------Q--E-RNPDSQQLSLTQ
I0I8T2          ILLAMALAGTSAY-IFARMRPDVYIASGTVMVGTAL-------Q--E-RNPDSQQLSLTQ
A0A363SX22      IVLIFLVTVGSTA-IFTWRQNPTYSVTTTFVVSPSSTIFSDPRS----FLSGLDVLGGRV
A0A2E5F6N9      AIIVAVLAGAAAY-FYTQSRTPVYQASSLVQIQQTQG------S----ALPTFSDLQLSR
A0A2E6J6X7      IILLPTIVGTGAY-FYSQQQTKLYEAKATLLVEQRSS------G----LSTSISDYSLSA
                                       :     . :                            

A0A401ZA55      AQQS--TYSQLVTNPNVLAPVAAKHNME--L-----------------------------
A0A1F8RRT9      RLTM--TYRELISKRPVLEDVTEDLELP--MSP---------------------------
A0A3M1EAN8      RVAK--TYAELLTKRPLLEQVIANLHLS--LTP---------------------------
A0A326UPN3      TLLP--TYIELVTNPTVLQPVVSKYHMQ--------------------------------
A0A0P6WSP2      QLAF--TYSQLMVEKQILETAIRRLELD--LEP---------------------------
A0A1F8QGH2      RLAL--TYSQMLKGPLILEKVITRLGLD--ETP---------------------------
A0A0S8KFR9      RLMN--TYIEMLKSSSILEEVIKELDLS--SSP---------------------------
A0A1Q7TTL6      QLLDAESWVDLLLSYVVLDQVVRDQRLF--VEPGTPADGQAVEKLSVADQYQPGVYRFTV
A0A1F8SS27      LVAQ--TYSDLTRRQPILQSVVDVLGLN--KTW---------------------------
A0A3A4VPK9      QQTQ--TYLQLLQTESILNIVSERLGFE--------------------------------
A9B6E3          RLVA--TYAQIAQSRTTMQAVEQRLNLS----D---------------------------
A0A3D0CW53      QLAQ--SYARLLRRQMILQTTIDALGLQ--IPW---------------------------
A0A3C0XJG2      NLAP--SYVQLAQSEVVLRRARDKVSWP---DS---------------------------
A0A3D1TRD4      QLTL--TYSKIAVQDPVLAQVIQEGHLP--FTV---------------------------
A0A2E0L5X9      TVLD--AYSVLIGRNSLLQPVIDDLGLN--ISV---------------------------
A0A3A0AXU8      PLAN--TYIQYMGTRSFGEMVAARMPVE--ISS---------------------------
A0A3D1JCW0      QLTK--TYAEMLTKKPLLDKVRQNLGLS--ENV---------------------------
A0A2N2MJJ0      QITQ--TYVEMFKLASVRQAAAEHLQIE--IKP---------------------------
A0A3M1LAM5      -LAQ--IYGEMAKRRPITQAVVDRLDLP--MEW---------------------------
E8N5M1          KLTR--TYAEMMTKRPLLVKVAQKLNLP--YVI---------------------------
A0A1F8U7F0      QLLQ--TYIQLLTTEKVLNAASEKLGYP--VYA---------------------------
A5V160          RLAR--TYAELLVKRPVLEDVVRELNLS--IAP---------------------------
A0A2A6REI6      RLAR--TYASLMLTRPILEEVIAELELV--TTP---------------------------
A0A426TTK3      RLAR--TYASLMLTRPMLEAVIADLDLT--TSP---------------------------
A7NIZ1          RLAR--TYAELLIKRPVLEEVVRELSLP--FAP---------------------------
A0A0P6XM68      QLAQ--TYVQTLRSRPVLDAVAERINTA--ITP---------------------------
A0A2N2MEG3      QLAQ--TYVQTLKSHSIVDMVAERIGGS--VSP---------------------------
A0A353RQ31      QLIS--TYVQLLSTESVLQKASDELGFP--IYK---------------------------
A0A3B9KNR2      QLIA--TYVQLLSTESVLQQASEELGFP--VLK---------------------------
A0A0P6XME1      LLSQ--TFTELLVTRPVLEAASERLGYY--INS---------------------------
A0A3B9Q1T8      QQIT--TYSQLISSTDLINQVSTELGFP--VDQ---------------------------
A0A0M8KAF3      RLVK--TYAEIMKSDAVLDLVAETVGEE--------------------------------
A0A3M1H759      QLAN--VYAQMAEREPILQATIDALALD--VEW---------------------------
A0A1F8PTW9      QLAS--AYANIANRQMVRNATMNALDMN--------------------------------
A0A1F8QH26      QLAD--AYANLTNLQLIREATMNALNID--------------------------------
A0A3D0UNQ0      RLAL--TYADIARRQPVLEAVIVSLDLD--YAW---------------------------
A0A2G6GG97      RLAQ--TYVELLKTDPILEETISQLELP--MSV---------------------------
A0A359HML3      QLAV--SYANIANREPLRDATMEALGLD--------------------------------
A0A2U2S5W9      QLAQ--TYIQMATRQPILQATIEALGLK--EDW---------------------------
A0A3M1EJ46      RVAK--TYAQLLTKRPLLEQVISDLHLK--LTP---------------------------
A0A3M1ZZ81      RLTQ--TYLQILSTRPVMEETITRLNLP--YTP---------------------------
A0A3D0D4X6      RLAR--TYSERLQSRPVLEETARALGLQ--QDL---------------------------
A0A1J4ZRV4      RLAK--TYASLLTGWPMLDETARRLGV----DA---------------------------
A0A1V5RXW5      RLSR--TYANLLMSRPVVDQTAEQLGI----EP---------------------------
A0A3A0B2P8      QLAS--AYADIVQRSTVRDATQAALGLG--WLP---------------------------
D1CAL1          ELAA--TYSRLVTARPVLEQTINRLSLD--TTP---------------------------
D1C8M3          RRTR--TFSRLVAQRPVLEETIRRLSLR--MTP---------------------------
I4EI06          QRTQ--TYSRLVTTRPVLEETIRKLNLS--VTP---------------------------
A0A3D1U3H5      QLAD--TEARLVVTQPVAVKAYKALHLHLPLTP---------------------------
A0A2N2MEK3      QLAQ--TFIQLLKTKPVLDSASAELGY---------------------------------
A0A3B9J9U6      QLAQ--TFIQLLKTKPVLDSASAELGY---------------------------------
A0A1W9UQ51      TLAA--AYAELLRQGPVVEAVIERLGLE--RTP---------------------------
A0A3C0LJ76      GLAQ--TYVKIAQRPSIREATRKALGMD--WLP---------------------------
I0I8T2          GLAQ--TYARIMQRPSIKKATMEALGMD--WLP---------------------------
A0A363SX22      SVAN--TYSDIATSRRIKNDTIDALGLN--PVQ---------------------------
A0A2E5F6N9      ALAS--TYKELITTTDILSAVTKELGLS--AST---------------------------
A0A2E6J6X7      RLSK--TYAKLITADPFLDQVRETNGFE--RLG---------------------------
                                    .                                       

A0A401ZA55      ----------------------------------------------------------KQ
A0A1F8RRT9      ----------------------------------------------------------DE
A0A3M1EAN8      ----------------------------------------------------------RQ
A0A326UPN3      --------------------------------------------------------SANE
A0A0P6WSP2      ----------------------------------------------------------ED
A0A1F8QGH2      ----------------------------------------------------------ED
A0A0S8KFR9      ----------------------------------------------------------KD
A0A1Q7TTL6      DHSGQGYTLASADGVELERGTLGDSVGTRYGLRWAPDASTVAPGRAVQFNLTTLRDAATA
A0A1F8SS27      ----------------------------------------------------------QQ
A0A3A4VPK9      -----------------------------------------------------------L
A9B6E3          ----------------------------------------------------------MA
A0A3D0CW53      ----------------------------------------------------------QA
A0A3C0XJG2      ----------------------------------------------------------KS
A0A3D1TRD4      ----------------------------------------------------------IQ
A0A2E0L5X9      ----------------------------------------------------------LD
A0A3A0AXU8      ----------------------------------------------------------AE
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      ----------------------------------------------------------WD
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A5V160          ----------------------------------------------------------SL
A0A2A6REI6      ----------------------------------------------------------SA
A0A426TTK3      ----------------------------------------------------------DA
A7NIZ1          ----------------------------------------------------------SM
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A0M8KAF3      ----------------------------------------------------------AL
A0A3M1H759      ----------------------------------------------------------DV
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A3D0UNQ0      ----------------------------------------------------------QN
A0A2G6GG97      ----------------------------------------------------------PT
A0A359HML3      ------------------------------------------------------------
A0A2U2S5W9      ----------------------------------------------------------TS
A0A3M1EJ46      ----------------------------------------------------------YQ
A0A3M1ZZ81      ----------------------------------------------------------EQ
A0A3D0D4X6      ----------------------------------------------------------GT
A0A1J4ZRV4      ----------------------------------------------------------KD
A0A1V5RXW5      ----------------------------------------------------------RS
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ----------------------------------------------------------ED
D1C8M3          ----------------------------------------------------------EE
I4EI06          ----------------------------------------------------------EQ
A0A3D1U3H5      ----------------------------------------------------------ST
A0A2N2MEK3      ----------------------------------------------------------HI
A0A3B9J9U6      ----------------------------------------------------------RI
A0A1W9UQ51      ----------------------------------------------------------EQ
A0A3C0LJ76      ----------------------------------------------------------EY
I0I8T2          ----------------------------------------------------------QY
A0A363SX22      ----------------------------------------------------------AE
A0A2E5F6N9      ----------------------------------------------------------GG
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A401ZA55      LTGMVKTQSATNSPIIDILVDSSNPQLAATLSKEVAQSF-TSYATS--------------
A0A1F8RRT9      LGALIDVEAIEDTQLLRLSVEHEDPDQARWLANATAQAFIDSNEQD--------------
A0A3M1EAN8      LAGKINVAQPADTQLLELQVEDSNPQLAVAIANNIADTFVAQHEKR--------------
A0A326UPN3      LASKISVKQIGGTQVIEVTVSDEDPKMATNITNDVAQNFAQYQNT---------------
A0A0P6WSP2      LARRVSAEPVSNTQLIRLSVRDSSPQNAALLAETIADEFVQHVRLLEREKFGESISGLQA
A0A1F8QGH2      LSEKIVAEPVANTQLIRLTIRESSPEKVTLLANTIAEIFTDHIQALQTDRFTDLLQSLQD
A0A0S8KFR9      LAKQIEADVVPDTELLSITVTDHDPARAKDIANALATLLVERSRNLYFGGTRSAREILQQ
A0A1Q7TTL6      LSEALDARMDVDGSFLRVELRGHDPKRTTAIVNALAQRYVQVYADLKRQKLVELTKILGE
A0A1F8SS27      LRKQVSVGLVEGTQLIQITAEADSPDTAQMIADEVAHQLILFSPGRSNT-----------
A0A3A4VPK9      DEDAIDTKAIIDTQIIEINVEDPDPQRAALTADMLVEVLIEQNELISSERYDLMEESLSA
A9B6E3          SSAIITTRPVQETEFLDIAVEANDPQQAADIANAIADQLIL-------------------
A0A3D0CW53      LAGRVSAASAPGSQLIQINVVDGDPQRARLLADEIAHQLILHSPTTPE------------
A0A3C0XJG2      FRERTQVAQVRNTSIIAVSFRDRDPQRAAEIADLIANSFVE-------------------
A0A3D1TRD4      LQKMVSAAPVLQTQLITITANTHDAKQAATIANLVANVFIT-------------------
A0A2E0L5X9      LMELMSLETNRSASLITIGITDTDPERAAAIANRIVDELIRQTSD---------------
A0A3A0AXU8      VLRSIQAEFVRDTQIFRITATHRNPEVAQMLANTTAQMLIDANTERQLSQQEARLAAQRS
A0A3D1JCW0      -EFDVKVNFIRDTQLVQLLVEHTDPFLAANVANEMVAVFSEDIRNLQQSKYAASKENLKA
A0A2N2MJJ0      --GQVSVSALTNTQIVEIVVEDTNPALAGEIADTLVDVLIEKNDAIQSERYTNSEQSLST
A0A3M1LAM5      LAGRIETRVNPTAQLLEITVFDTDPQVAALLANAVAEELVRQSPASQ-------------
E8N5M1          --DTVKVTPVRDTQLMQVIVEDINPVYASDFANELVNAFAEQLQEMQISRFKASKENLQN
A0A1F8U7F0      --GQASAQQVPDTQFVRLTVTNTDPQRAADIANVLVMVLIDQNEELQAVRYLTSEQNLQS
A5V160          LAERVRVRPIRDTQLIVVTVEDIDPQRAADIANRIVAVFSEQNRELQSERFAESKRSLMN
A0A2A6REI6      LADRITTTPVRDTQLIRVTVEGEDPAQVAAIANRLVTVFVERNEALQGERFVATRASLEQ
A0A426TTK3      LARRITTTPVRDTQLIRVTVEGEDPLQVAAIANRLVEVFVQGNEALQGERFVATRASLEL
A7NIZ1          LAERIRVRPIRDTQLIVVTVEDIDPQRAADIANHIVAVFSEQNRELQSERFAESKRSLAG
A0A0P6XM68      --EQIRAQIVQNTQLIDIFVTDTDPQRAASIANTLVEVFIERNSRMQAERFNESERSLEA
A0A2N2MEG3      --DQVQVQIVQGTQLIDITVEDTDPERTALIANTLVDVFIARNVQMQFERFATSEQSLEA
A0A353RQ31      --GQATASPITDTQFVVLTVRHTEPEKAALIANGLINVLIDENEQLQAIRYISAEQNLQN
A0A3B9KNR2      --GQATARAITDTQFVELTVRHTDPEKAALIANSLIDILIEQNEQLQAIRYIAAEQNLQN
A0A0P6XME1      --SQVRVQQVRGAQLIQIIVEDSIPEKAAEIANTLVTVFLEQNAKIQSSRFSASEESLQA
A0A3B9Q1T8      --KQLEVEQIGDSQFVRLTVTNEDPFKTAVIANALIDALIQNNERLQSLRFESTEANLQR
A0A0M8KAF3      EEAKISVSPGQDTQLLVVAVEHPDPELAATIANEVVRVFSA-------------------
A0A3M1H759      LGGQVSAFHPSQSQFLSVTVQDTSPERAAVIADEIARQLILQSPTSPQN-----------
A0A1F8PTW9      ELPEYTAWALPNTQLIEISVTDIDPKRAQAVANELATQLILMSPSNAQ------------
A0A1F8QH26      QLPEYKARVEPSTQLVVITVNDTDPNRAQAVANELAAQLILLSPTTEH------------
A0A3D0UNQ0      LRNRVRVDLVPDTQLLEISVDASSREEAISIADELAQQLILISPTSLQS-----------
A0A2G6GG97      LKKMISVSAPQETQIIIIQVEDTNKDRAALIANTLGQVFIF-------------------
A0A359HML3      WLPEYSVTAVPNTQLIEIVVVDTDPQRAQIVASEIANQLILGSPTSTN------------
A0A2U2S5W9      LRGRVNASPVQGTALLQVSVLDTSPEWAVAIADEIARQMILQSPTAPEE-----------
A0A3M1EJ46      LAGKIEVIQPANTQLLELYVEDSDPEQAVAIANGIATLFMQQN-----------------
A0A3M1ZZ81      LAAKVSASSPQDTQIIIISVEDPNPELAAQIANTLGEVFIE-------------------
A0A3D0D4X6      LKVKITVQPVRDTQLIRLTVEHTDPALAQAIANTIPQVFAN-------------------
A0A1J4ZRV4      LEKTVTVSSVRDTQLLEIQVEGPNPQLIVQIANTLPEVFIA-------------------
A0A1V5RXW5      IERSIDVTPVRDTQLLKITVEGPNPWLIARVANTLPEVFIE-------------------
A0A3A0B2P8      ---YYTARLVPNTQLIELSVVDTDPVRAQAVAAELVNQLLQIGP----------------
D1CAL1          LVENISVTRIGSTQLVEIAVEDPDPRQAAQIANTLAQVFIE-------------------
D1C8M3          LMAVIEVTPIRDTQLVTLAVSDPSPARAAAIANTVAEVFIE-------------------
I4EI06          LLKKVDVSPVRDTQLFTVAVSDPSPEQAATIANTIGQVFID-------------------
A0A3D1U3H5      LLGGATASSDVNSQLVTLSVSSHDRVFAARAANALA------------------------
A0A2N2MEK3      SSGQIKAEQLRDTQVITLTVEDNDAGHAAAIANTLVGVLVAQNDSLQSSRYLTSEEGLQA
A0A3B9J9U6      SSNQIKAEQLRDTQVITLTVEDNDAGRAAAIANTLVGVLVAQNDSLQSSRYLTSEEGLQA
A0A1W9UQ51      LAAQIGTGFYSGAQLLEIQVTDTNPEAAALIANALADELIRRSPA---------------
A0A3C0LJ76      SVRIV-----PDSQLIEISVTDVDAQRAYAVATELINQLILLSP----------------
I0I8T2          TVRT-------ESQLIEINVTDVDPQRAYAVATELINQLILLSP----------------
A0A363SX22      TL-DVGSKILAGTNVIYITVEGPDPSLITTFANKLGETTVKYV-----------------
A0A2E5F6N9      LRKNISVSILRDTSILRILAMNEDPALAASIANAVAQQFQSQT-----------------
A0A2E6J6X7      ---SVQTRTQENPPLIEIYVRDSDKVLVGEVANAISLNFIDYV-----------------
                              .. :                                          

A0A401ZA55      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A0P6WSP2      EMESQTTLISANQARVDSLSSQSIAHGSKMVHLQSQIDLDRGDYQFLQQSYFVAQSQADQ
A0A1F8QGH2      QMSAASTQMNETESTMDGISARMIEEETKLVRLQTFVAELRADLQTLQQNQEELQSTIDE
A0A0S8KFR9      QLDEVEAKLEQVRTELQTLVDSVARENARVDALKARIRSEEEVYASLLSQYEQARVAEAA
A0A1Q7TTL6      QLQHSQDNLRSAEADLQRFREQ--------------------------------------
A0A1F8SS27      -------SNSIMVRQF--------------------------------------------
A0A3A4VPK9      QKAQIESQIADLQNQI--------------------------------------------
A9B6E3          -------TSPAGPQSA--------------------------------------------
A0A3D0CW53      -------KEQEQYRQF--------------------------------------------
A0A3C0XJG2      -------QVRALQSSL--------------------------------------------
A0A3D1TRD4      -------QQHD-------------------------------------------------
A0A2E0L5X9      -------RATLLDLEF--------------------------------------------
A0A3A0AXU8      -------PEALARQKQ--------------------------------------------
A0A3D1JCW0      QLDYLDQQIVENQNAL--------------------------------------------
A0A2N2MJJ0      QIADVEGQIADLQEKI--------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
E8N5M1          QLSYLEQQIQENSSAL--------------------------------------------
A0A1F8U7F0      QIDQVQSQITTMQTQI--------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      QIAQIDAQIEALQSRS--------------------------------------------
A0A2N2MEG3      QIEQVDAQIETLKTRS--------------------------------------------
A0A353RQ31      RIDETQQQISLLEKQI--------------------------------------------
A0A3B9KNR2      RIDETQQQISLLEKQI--------------------------------------------
A0A0P6XME1      QIQQVEAQIADLQRQL--------------------------------------------
A0A3B9Q1T8      RAEDALQQMEELQNRI--------------------------------------------
A0A0M8KAF3      -------YMRRVQTER--------------------------------------------
A0A3M1H759      -------KARQERAGF--------------------------------------------
A0A1F8PTW9      -------PEEQGRQEF--------------------------------------------
A0A1F8QH26      -------TEDQVRQEF--------------------------------------------
A0A3D0UNQ0      -------PEDENARLF--------------------------------------------
A0A2G6GG97      -------ENQKRESLR--------------------------------------------
A0A359HML3      -------QADVERQAF--------------------------------------------
A0A2U2S5W9      -------AQRAKHRAF--------------------------------------------
A0A3M1EJ46      -------ARRQGDSSG--------------------------------------------
A0A3M1ZZ81      -------QNRERESLR--------------------------------------------
A0A3D0D4X6      -------RNAEQQSER--------------------------------------------
A0A1J4ZRV4      -------QNQELQMGR--------------------------------------------
A0A1V5RXW5      -------QNQELLLGR--------------------------------------------
A0A3A0B2P8      -----GMQEGSEYQAF--------------------------------------------
D1CAL1          -------ETHAQEDAA--------------------------------------------
D1C8M3          -------QTQQRQAEI--------------------------------------------
I4EI06          -------QTRDQNVAA--------------------------------------------
A0A3D1U3H5      ----YAAQQSEQQH----------------------------------------------
A0A2N2MEK3      QVEQVGAQIDQLQEQI--------------------------------------------
A0A3B9J9U6      QVGQVGGQIDQLQEQI--------------------------------------------
A0A1W9UQ51      ----SGGSDPEQQE-F--------------------------------------------
A0A3C0LJ76      -----GGQERQQREVF--------------------------------------------
I0I8T2          -----GGQERQQREQF--------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A401ZA55      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A0P6WSP2      IAE--KIQIVEDAVVKEAAGSRGFSAYLTLLVDPSLIIGQGTYSTVTN---SARVASAYG
A0A1F8QGH2      AAN--SVMIVEDAQVLTQEDSFFYEATVTLLVDQVHERSGDNYAAILA---NERLAQTYG
A0A0S8KFR9      RENSVTIVAPAVKPAARDGPQVSYLATATVRVTQPYSA----FPGYAEYGYVERLMNTYV
A0A1Q7TTL6      -----TITLPSDRPPTVGSGSVAGAAGGGGAAGAPDGARDPVFGGFFE------MQITRE
A0A1F8SS27      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A401ZA55      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A0P6WSP2      EIWTGESYMQAVIDELGLDRDADDLANDV---------------YFEPIPSTQLVRLRVD
A0A1F8QGH2      EILAGRKVMEAAISRIKSDESPDDLMNKV---------------KVETVSGTQLIRLSVE
A0A0S8KFR9      ELLKTQPILEEVLQKLDLPELPSALLQQI---------------VIEVLPDTELLRITVE
A0A1Q7TTL6      EARRDRDALERVLAQYGDSGLSAEALAVVGSVQLNGELSQALKELTDKQAQLRAYRYKYS
A0A1F8SS27      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A401ZA55      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A0P6WSP2      DPSAAQAKTLVEVIGRNIVQTTQTQLARPYTDRMQALQKQMDELSAQIESAQAEIMTISA
A0A1F8QGH2      DTNANQAKLLADAIAGAFLDEIQVLLTEPYVTRLEALQTHIDDLYEGIEATQAEIESLSA
A0A0S8KFR9      DRSPERARDIANALAGLLVEQGQTLYSGDTKSAREILQQRLSAVEGNLEQDREALQDLLD
A0A1Q7TTL6      DEYPPVQRLIGDI----------------ATLQRQTIPRLARVLAGQLAAKETELGRRVD
A0A1F8SS27      -----------------------------IQQQLGNLQARIENGQSRLAEIEVEMVQV--
A0A3A4VPK9      -----------------------------NHASIKTIEEQEQWIQEQINVLQQESETLPV
A9B6E3          -----------------------------EAKLLDEVNRQIATLNEEITRTDEEIKTLKA
A0A3D0CW53      -----------------------------VNQQLLTLQTRIEDAQKQVDELEKQLALE--
A0A3C0XJG2      -----------------------------QSTTATQLDEEISSVEADRQRIDDELSRLRA
A0A3D1TRD4      ------------------------------------------------------------
A0A2E0L5X9      -----------------------------INSQIEDMQNQINNLQSQYNQLVQEAATI--
A0A3A0AXU8      -----------------------------MNDLIAVLQDELNYYDDQIRTLDNEIRNL--
A0A3D1JCW0      -----------------------------DAI----IQNNLKQLQSSGENVEAQPTAALL
A0A2N2MJJ0      -----------------------------TVRSAEVLEEQKTNFESQISDTRAQIAELES
A0A3M1LAM5      -----------------------------EGVERDFVLKELNDTQAKIEEAQAQIDQLRD
E8N5M1          -----------------------------EKILQENIS-EVKRTNPDAANGTLSNATIEN
A0A1F8U7F0      -----------------------------NDISEATVQDQLTQVKAQIEPLQTQVTTLET
A5V160          ---------------------------------------EIAKLQADIDATQAEIAVLRG
A0A2A6REI6      ---------------------------------------ELEKLQLEIDTTQAQLNEATG
A0A426TTK3      ---------------------------------------ELEKLQSEIDATQAQLDQATG
A7NIZ1          ---------------------------------------EIAKLQSDIDTTQAELAALRG
A0A0P6XM68      -----------------------------TAATTEQSEQQIEKAKSELDRLQTEILAIRT
A0A2N2MEG3      -----------------------------EAVSSAEAQEAIAKTQTEIERLQGEILALQN
A0A353RQ31      -----------------------------NELSTATVESQLESVQKQILETQSQMTALNV
A0A3B9KNR2      -----------------------------NELSTATVESQLESVQKQILETQSQMTALNA
A0A0P6XME1      -----------------------------AQTSEQSNEKRIQDVTNIISGLQSEINQLQA
A0A3B9Q1T8      -----------------------------DQVTEKNVQEQLITVQSEIETLQSQVTDLEL
A0A0M8KAF3      -----------------------------FAESKANLQAQMERVQAEIEQLQQQLDA---
A0A3M1H759      -----------------------------VQAQLDDLERRIQDAQAEVKKLEAELETA--
A0A1F8PTW9      -----------------------------INQRLNILEVQINETEDEIKKLQEDLGNM--
A0A1F8QH26      -----------------------------INERLSVLETQINDTEEEIKQLQEELGSI--
A0A3D0UNQ0      -----------------------------VQERLQDLQKKIEASQARLDELASAMDVA--
A0A2G6GG97      -----------------------------YADPINNWEERLQEIGDQIETIETEINTLNA
A0A359HML3      -----------------------------ISQQLDTLQKQITDTQAELEDLSQLLGEL--
A0A2U2S5W9      -----------------------------VEQQIADLQAKIEAAQQQVAELEKQLGGA--
A0A3M1EJ46      -----------------------------LTGYEEMLAKQIAEVERDIQALEAERAQINR
A0A3M1ZZ81      -----------------------------YAEPIQNWETRLDEIGNEIQAIETEINALG-
A0A3D0D4X6      -----------------------------FAASKESLQRQLDTLAGDIEDAQGRLT----
A0A1J4ZRV4      -----------------------------VSESKASLEREITSVEADITRTQDALN----
A0A1V5RXW5      -----------------------------LSQSRANLEQEIANTEADIARTTDELS----
A0A3A0B2P8      -----------------------------IADQLDQMEKGITETTAEIERVKTELTGMFS
D1CAL1          -----------------------------TWSGRDELRRQIEEVQQRIEDTSSRIAELQ-
D1C8M3          -----------------------------AGPGADQVQQNIEAIQRQIDEANARIAELQA
I4EI06          -----------------------------TGTSREALQKEIDAAKQQIDDLTTQVANLRG
A0A3D1U3H5      --------------------------------QMSRFSAAIDAIDRQISSYQKDMASATK
A0A2N2MEK3      -----------------------------NRLTMENVEEQIGQAETKIAELQSEIASLEN
A0A3B9J9U6      -----------------------------NRLTMENVEEQIVQAEAKIAQLQSEIASLEN
A0A1W9UQ51      -----------------------------IRRQLEELEAKVGNVGGQIEELTASLSEL--
A0A3C0LJ76      -----------------------------IQEQLRKLEQGMRDTEAEIVRKRDELSSL--
I0I8T2          -----------------------------VQEQLRKLEQSMRSTEEEISRRQTELSAA--
A0A363SX22      -----------------------------EE-----------------------------
A0A2E5F6N9      -----------------------------REKHLADIAEFMGVAQSQGIRIQDDLLVS--
A0A2E6J6X7      -----------------------------IERRLTEIARLQAAASAQGLSDVQSLVNA--
                                                                            

A0A401ZA55      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A0P6WSP2      QKA---------------------------------------------------------
A0A1F8QGH2      EKI---------------------------------------------------------
A0A0S8KFR9      SSA---------------------------------------------------------
A0A1Q7TTL6      ADA---------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A3A4VPK9      EISQMG--------------------NPATPEERDALEQKKARLEQVELLLPLYEQSYTD
A9B6E3          EIEQIG------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A3C0XJG2      ALAALPA-----------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ERARML------------------------------------------------------
A0A2N2MJJ0      EIASLP------------------------AESTSLAAEKRSQVEQLQSLLRSYESAYNT
A0A3M1LAM5      KMLGMT------------------------------------------------------
E8N5M1          LARQIN------------------------------------------------------
A0A1F8U7F0      EIADLQ------------------KNRYPTEEENAQLAEKEATLAQVKPILTLYQQLYTN
A5V160          IDDPTR------------------------------------------------------
A0A2A6REI6      AANAAE------------------------------------------------------
A0A426TTK3      AANAIE------------------------------------------------------
A7NIZ1          IDDPVR------------------------------------------------------
A0A0P6XM68      ALDTLR---------SPKAEAGWYSTPTPSPEIRAEINQKELELKELETTYDLYQQIYTN
A0A2N2MEG3      ELDLVK---------SPGRLPNSLSTPTPSPETRSQINEGTLRLRQLQSTYDLYQQIYTN
A0A353RQ31      EVAKIN-------------------PATATEEEKARLAEYQAQLDQLSSVLSLYQQIYTN
A0A3B9KNR2      EVAKIN-------------------PATATAEELTRLAEYQAQLDQLSSVLSLYQQIYTN
A0A0P6XME1      DIVRIEAERDPILGVNSLGQPARVTPTLTVDQQIEL-TQKRSRLDELRSLLSIYQQIYVN
A0A3B9Q1T8      NIASID-------------------PLYATDEELQQRIQFQAELGQTQSILDLYQELYTQ
A0A0M8KAF3      ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A3M1EJ46      GGSNSR-------------------------SLPTAQNADTDTSSLEASAKDGRQ-----
A0A3M1ZZ81      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A3D1U3H5      KQAQAG-------------------------G----------------------------
A0A2N2MEK3      DIFYTT-------------------------NRGRNPDLAPTEWTARLAQLKSTLELYQQ
A0A3B9J9U6      DIYYTT-------------------------NRGRTPDLAPTEWTARLAQLKSTLELYQQ
A0A1W9UQ51      ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A401ZA55      ------------------------------------------------------HLASQA
A0A1F8RRT9      ------------------------------------------------------GLTRPG
A0A3M1EAN8      ------------------------------------------------------RDDLAV
A0A326UPN3      ------------------------------------------------------QLGGVS
A0A0P6WSP2      -------QIEADLIKEESAKTKLSQD-------YQVLYDQMEQLRKN-------ANQASN
A0A1F8QGH2      -------RAETELARL---ESRLVED----RNDYRALKQDYEQLQLT-------ANDASQ
A0A0S8KFR9      -------RENARIDAL---EMRIRSE----EEVYLSLLRQYEEVRVA-------EASRES
A0A1Q7TTL6      -------RALRQIPARAIEEARLRRDANLAENLYTTLQQKYDEARLA-------EASSLA
A0A1F8SS27      -------KSAEQLSELQRELNTLASLITSWENTYTQYLGFLQ------------AKESPG
A0A3A4VPK9      LIVYGK-QVDGANTSAGSQLTLLNTTQSLYQQIYVSVLNNLESVRLA-------KLQNMP
A9B6E3          -------ADKPAAESLIANLQLKQQSQNQNRQTLSTLYSTA-------------LGNRAN
A0A3D0CW53      -------SSARAIQDIQGQIGALQQTITTWQATYASLLDFS-------------KGSRTN
A0A3C0XJG2      -------FPQGPPADLRSQISQLESTGTARQDTLAQLMRTRDDLRLV-------AARAEN
A0A3D1TRD4      --------------------------------------------RMA-------KGDASN
A0A2E0L5X9      -------TSAFELNQNIEDRGEIEKSIQELRTLLLSLI----------------ENAPRS
A0A3A0AXU8      -------EQGPQSVETTQRTLELRDRILQYRTERIGVLTSLAETQNALSSAFEEPSSDVD
A0A3D1JCW0      ---------------NAAEIDRLETRISQYRQLYASILSSYEQIRLA-------EAQTTT
A0A2N2MJJ0      LMV-----QKKILAADDEELTQLEKTFNLYQQIYLNLLNNREALRLA-------RLQNTL
A0A3M1LAM5      --------SAVELSEAQARLAELEQLKSNYRADYVRLAN------LL-------NTQSPN
E8N5M1          ----------------QAEIDRLETRLAQYRQIYASVLASYEQIRLA-------EAQNIT
A0A1F8U7F0      LVVLGQPVDTGTNTSTRLQ--QLQTTLSLYQGIYVNLLNSLENVRFA-------RVQNTP
A5V160          -------------------RARLEEALVQYRSSYATVLRSLEEVRLA-------EAQLTN
A0A2A6REI6      -------------------RSRLQELLAMYRTSYASLLKSIEEVRMA-------EVQQTN
A0A426TTK3      -------------------RSRLQELLAMYRTSYASLLKSIEEVRMA-------EVQQTN
A7NIZ1          -------------------RARLEEALVQYRSSYATVLRSLEEVRLA-------EAQLTN
A0A0P6XM68      LVVLGESRNENSANVEQE---QMQSTLALYRQIHANLLSSYENIRLA-------RLSSTS
A0A2N2MEG3      LVVLGQNRAVGEADTEQE---QMQSTLALYRQIRANLLSSYESIRLA-------RLSSTS
A0A353RQ31      LVVLKTPAESGTTTATSAQLTQLQTTLNLYQQIYLSSINSLEALRLS-------RAQNTP
A0A3B9KNR2      LVVLKTPAESGTTTATSAQLTQLQTTLNLYQQIYLSSINSLEALRLS-------RAQNTP
A0A0P6XME1      LTF--SPSNQGNSNSTNS---QLQAALVLYQQIYANLLSNYEAIRLA-------RLQSTP
A0A3B9Q1T8      LVVLGKPIDQENPSSRQSD--RLERTLSLYEQIYFSTLNSLEALNLA-------RDQNKP
A0A0M8KAF3      -------LGTPETEAEQTRQQQLQTLLTQQQAAYTTLLRSYEEVRLA-------EAQAVD
A0A3M1H759      -------FSARQIRDLQSDIASWQSLINEWQRTYTNLLDFLQG------------GDSPN
A0A1F8PTW9      -------ISAQQIDETQIQISSLQSKLSTMQDNYGTLLSNTQQ-------------GAIN
A0A1F8QH26      -------ISAQQIEEVRSQISSLQSKLSDMQNTYATLLSNTNQ-------------GAIN
A0A3D0UNQ0      -------PTPEEKSQIQAEMNDLEGILVEWENTYARFLQFIGG------------EESAN
A0A2G6GG97      -------QGKEITPEESATLSRLETNLNEAQIRYTETFNNLNDLQIK-------QAKETS
A0A359HML3      -------NSAREISDTQNQISSLKNSLASLQLNYANLLSNTEK-------------GAIN
A0A2U2S5W9      -------FSARQIQDLQGQINVLQNQINTWQANYAQLLNFIEG-------------GSPN
A0A3M1EJ46      -------QALAEESARLAEVASLDAALQEARGSYARLLESYLQVKSA-------TGGSV-
A0A3M1ZZ81      ---------TPETPEEEAELSRKDTKLKELQIQYTEAFNNLNQLRVS-------QAKESS
A0A3D0D4X6      -------RERAANPRNEDEIDRLESRVTQLRNTQSSLVQSFEQVRLA-------EATSLN
A0A1J4ZRV4      -------AVTDDNQRM-----RLETSLAQYRSTYSSLLSSYQQIRLA-------EAQATD
A0A1V5RXW5      -------RATDDAQKT-----RLETSLAQYRSTYSTLVANYQQARLA-------EAQTLD
A0A3A0B2P8      -------ARQIQDA--RSQITALEAKLATLQANFANLLANSRQ-------------GAIN
D1CAL1          -------QSGASGTAVQTELRTLQTQLSQDQALYASLLEAQQRMELA-------AAQSAT
D1C8M3          -------QPNAGDPAVQEEIRNLQAQLAQFTETHSALIEAQQRILAS-------AAASGP
I4EI06          -------RPDASTAAVQAQIADLEARLGQQQSSYDGLRATQQQIDLA-------NAQANS
A0A3D1U3H5      -------AGNAQTQDLTREIDQDRTAINNLQTQLVTLQSTEAQ--------------TSA
A0A2N2MEK3      IYANLLVLGKPTSSGASDRLTHLQKTLELYQQIYLQLLGSLEEVRLA-------RLQNTP
A0A3B9J9U6      IYANLLVLGKPTSSGASDRLTHLQKTLELYQQIYLQLLGSLEEVRLA-------RLQNTP
A0A1W9UQ51      -------TSAAEIQDVQDRIAALEEVKSTYQSTYADLFNSYRA-------------ESPN
A0A3C0LJ76      -------LSARQIGQTETQISALEAKLTTLRSTYVGLLASTDQ-------------GSIN
I0I8T2          -------LSARQIRQLEDQIAALEAKMASLQSTYVNLLANTDQ-------------GSTN
A0A363SX22      -------------------------------------------------------LYGVY
A0A2E5F6N9      ------------------------------------------------------QMSSLS
A0A2E6J6X7      ------------------------------------------------------QFTALD
                                                                            

A0A401ZA55      NFNTIDPV-VPTDP---VRPRPSQDSLIGALIGLGLALAIIVIFEWIDDRLT-APEEVNK
A0A1F8RRT9      TVSIVEPASTPASP---VRPRTTLNSIIGALAAVFIAGTVVLIYEYLDDTIK-TAEDVET
A0A3M1EAN8      YIEVVEPASMPAYK---LRPRPYFNTFVGALSAFLLAVVFIFFMHHLDESL--TYTEAEE
A0A326UPN3      QLRVV-PAIEPTRP---SKPQPTQDAIVGALVGFGLAIALIVVFEWLDDRVP-NPEEMQK
A0A0P6WSP2      SVMVVAQPSIPDRP---TQDRL-LYVLLAALLGGTVGIGAAFVLDQLDETVR-IRQDVTS
A0A1F8QGH2      AVSIVEPAQLPESP---EEDRV-LYIGLAALTCAVVAIGIAFLWEYLDDTIR-TPDDISD
A0A0S8KFR9      SASIVAQAGQPDAP---SKPRVKFNLALGTLVGAVGGIALAFLFEYLDPTLH-STDDLEA
A0A1Q7TTL6      DVRVLDYAVVPRRPVKNTRRRVVLLAFFGSFAMAVVG---AVLIDRVDPRVR-YPDQVSR
A0A1F8SS27      TLTIIESAQVSPKP---INPQVQLIAFLATGLGFLLALGFIFLLGHFDDTLK-TAEEITQ
A0A3A4VPK9      NVVQIQPAIVPDDP---VRPRTMLNSVLGGIIALILSAGFLILKENLDTTMK-TSAQVEE
A9B6E3          SISVVEAATVNPTP---IAPRPIRSAILAGILGFALVFGLALLIEYFDDSVQ-TPDEGVD
A0A3D0CW53      YLSVVEPAVVPTTP---ISPNIQRNVSLATAIAFVLAAMAALLLEYLDDTLK-SDEDVDR
A0A3C0XJG2      TVTVWEPAVAPTDP---ESPRVALNTILGAIAGGLLTLTGIAVFTYMVDRIT-DVDEVSE
A0A3D1TRD4      AVSVVAPAQVPASP---VSPRVKLDTVLGMVVGLLAAVGFIALVTYFDDTIK-SHNDVDR
A0A2E0L5X9      EIQVFEPADPNYFP---LTANSVRDLLIAGVAGGVLALLTIVLFTYFDDRLQWDEESSAE
A0A3A0AXU8      TIVVVDPALLPVVA---RQRDFLQPMVAALVAALALGFGLAWLLEYLDYTVK-TPEELDE
A0A3D1JCW0      SFIQVEPATPPEKP---IRPRTLLNTALAAVVGLMLAIGGVFAIDFLDDTLH-DPESITT
A0A2N2MJJ0      TVAKIDAAQVNPAP---IRPRTTLNTLLGGLAGLILAVSIIFLRDFLDDTIK-SREDVKR
A0A3M1LAM5      TLTIMEPASPSRRP---IAPNPKKSAAIAAVAGLILAVGAVILLEFFDDTIY-WYGEQES
E8N5M1          SIIQVEPATPPDKP---VRPQTLRNTAIAALVGIFLAIGIVFALDFLDDTIK-SPDWITT
A0A1F8U7F0      NVVQVEPAVASTSP---ISPRPFQSTALAAAVGLMLAAGIAFLIEYLDDTLK-TMEDIER
A5V160          SVNVVETAVPVTTP---VRPRIVTNTAMAAVAGLLLAVGLALLIEYLSDRVS-SAEDVTA
A0A2A6REI6      SVHTVEAAAVPEYP---VRPRIVQNTALAALVGLLLMVGVALLLEFLNDRVT-SSQQVAE
A0A426TTK3      SVHTVERAVVPDVP---VRPRVMQNTALAALVGLLFMVGVALLLEFLNDRVT-SSPQVAE
A7NIZ1          SVNVVESAAPVYTP---VRPQIATNTGMAAVAGLLLAIGVALLIEYLSDRVN-SAEDVAT
A0A0P6XM68      NIVSIEPAIPPEEP---LSPKPVRTGLLGGTVGLLLAAGIVFLIEYLDDTVK-SAEQAEA
A0A2N2MEG3      NIVAIDLAQVPSSP---IRPQPLSTAGLGAAVGLMLAAAIVFLIEYLDDTIR-SADQAVE
A0A353RQ31      NVVQVEEAQIPSVP---ISPKPGQTALLAGAVGLILTAGAAFLIEYLDDTIK-TPDEVKE
A0A3B9KNR2      NVVQVEKAHPPSVP---ISPNPVQSATLSAAIGLILTSGIAFLVEYLDDTLK-TPDEVKE
A0A0P6XME1      EVVQVEEARVPSRP---VRPQTTTNVLLGGILGLVLAAGIVFVVEYLDDSIR-NGETVTR
A0A3B9Q1T8      TVAQIEAAAVPVEP---FFPRPIETGLLYGAVGLFAVGGLVFLIEYLDDTIR-TPDEAEQ
A0A0M8KAF3      SIVVIDPATPPERP---VRPRVLLNTLLGGVLALVAVGAVVVLIEVLDDRVR-SPEVIER
A0A3M1H759      YLSVVEPAVVPDTP---ISPNIPQNVMLAAATGFLLALGAAFMLEYIDSTIK-TSDDLSP
A0A1F8PTW9      SLTLIEPAALPSSP---IGPKIGLTALLAAALGLMLAVGEAYLLEYLDDTLK-TADDVAR
A0A1F8QH26      SFTVVEPAALPVKP---IGPWLGLSVLLASLAGCALAVGEAYLLEYLNNTLK-SSEDVVR
A0A3D0UNQ0      YIAVVDKAHARLNP---VRPTIRLNTLVAGLVGFILALGVIFILDYLDDTVK-TVDDISQ
A0A2G6GG97      NLIQIEEAKPHEIP---IRPRTETNVLLAAAVGGMIAVGIIFLIEYLDDTIK-TPDQVLE
A0A359HML3      TLTIIEQPHVPTSP---VGSKMLVTVGLSAAVGFTLAAAAAYLLEFLDKTIK-TVDEVKR
A0A2U2S5W9      YLAVIEPAQLPTEP---VSPRTSMNVLLAASIGVLLALGAAFLLDYLDDTIK-SPDDLVT
A0A3M1EJ46      VISIVEPAAMPARK---VKPRVYFNTFVAGVVGLILAIGFIFLLDHLDDTLS-RPEGVEQ
A0A3M1ZZ81      NIVPIEPAQPPQRP---IRPRTFTNTIMATIIGGMVALGFVFLMEYLDDTIK-TPDDVLA
A0A3D0D4X6      SIIVDEPAALPTKP---VRPRPLTNTLLAAVVGAMIGLGTAFLIEYLDERVR-DPAMVES
A0A1J4ZRV4      NVAIAKPARVPELP---IRPRTMTNTLLAAVVGAMIAVGAAFLIEYLDDTIK-TPDDVAR
A0A1V5RXW5      SIVLSEPAIAPERP---VRPRTLTNTALAAVVGALLALGIAFLIEYLDDTIK-TPDDIER
A0A3A0B2P8      TIHVLEPANLPTTP---MSRGLKTNVAVAAALGFALAAAAAYTMYYLDNTLQ-NEDDIQD
D1CAL1          QIRVVEQAVPPTKF---VKPRILVNTALAGALGIVLAAGLVLVAGYLDDTVK-TSEDVQR
D1C8M3          RIRVTADAIPPDAP---IRPRTTLNTALGGVLGTLLGLGVVLVLVYLDDTVK-DAEDVRR
I4EI06          QIRVAEPAVAPTKF---VKPRIVVNTALSGVLGLLIAAGLVALAGYLDDTVK-TSGDVRR
A0A3D1U3H5      NLDVRVPAQVPHFP---SSPHPVRSAAIAAFLALLAATGLLFAREYFAGTLR-NPEEFQA
A0A2N2MEK3      SIVQIEEAAVPGSP---VRPLPFKTAMLGAAVGLMLGFGIAFAIEYLDDSLR-SPMDVDQ
A0A3B9J9U6      SIVQIEEAAVPGSP---VRPLPFQTAMLGAAVGLMLAFGIAFAIEYLDESLR-SPMDVDQ
A0A1W9UQ51      ALALFEPAVTPQWP---IPSKAKLIVAVAGAAGLVLALGAILLIEFLDTSLRWEGDGVQS
A0A3C0LJ76      TINVLDPPVVPTEP---VNDRWYLLVLVAAIIGATVAIAGAYLLEFLDDRLV-DIEQILQ
I0I8T2          TINILDPPAVPTQP---VPNRWWLLVAVAALIGAGVAVAGAYLLELLDDRLE-NVEQIQR
A0A363SX22      DLKILDLAEIPVFP---IKPNWKLNLALAAVLSLAVGMGISFLVEYMDDTLR-EPDEISQ
A0A2E5F6N9      SVSIVEPAIVPTAP---IYPRVRFTVLVATFLATVSTILAIIVVEFFNDKAK-SSEEIER
A0A2E6J6X7      SLYLLEPVSTPTTP---ISPDVQQNITFGIMIGLALALGLTFLISNLRDTVR-NPDDIRT
                                                              .             

A0A401ZA55      LL-GIDALTIIPELS-----RKQRSRN------AEDTPELA--EGCRILCANLNMAQMMR
A0A1F8RRT9      AA-RLPTLGGVARFP-----RRVSSRSGLVVA-STERSAAA--EAYRVLRTNLQFSTLDA
A0A3M1EAN8      VL-QIPTLATIPPLPAKSPLHRRRARSLPLSM-LEPLSAYA--EAYRTLRTNLRFAGNGS
A0A326UPN3      LL-EADALTIIPELSK-----NQQGKN------AEDTPELA--EGCRVLCSNIATAQTQQ
A0A0P6WSP2      KM-GLNLLGCI-------DAQKNGDSGLEMD--VHPRSKVA--EDFRTLAINLCSVNAQN
A0A1F8QGH2      LT-GTSTLAII-------GQLPQGEDELVVL--AKPRSPYA--EAFRMLAANIRFSSLDK
A0A0S8KFR9      AA-GASVMGVIPGF----APHAVSRGKILLS--SDGRSPEA--EAFRMLRGNLLSVASTR
A0A1Q7TTL6      EM-GLTILGAVPHIRA--GARPERSGRRVRP--PEEVAVVV--EALRGVCLNLVYAHGAV
A0A1F8SS27      VS-GLPVLGMIRKLSR----FKNTSDSVYVS--KNPRSPAA--EDFRILRANLELLSTDQ
A0A3A4VPK9      LL-KLNVIGYIAEMQN----SNGETIGLYTT--NQPRSPIA--EAFRSLRTNIEFSSIDK
A9B6E3          LV-NAPLLAAIVKQET---KVTKASQRLVSR--LDPRSPTA--ETFRTLRTNLQFSNVDT
A0A3D0CW53      IL-KLPTLGATTRIPK----IQQPSDHLVTV--HSPRDPIT--EEYRVLRTNIQFTGLSN
A0A3C0XJG2      RL-GVPALGEIPFANE-Q---TLGAHGLFVR--DAPASPEA--EAFRAVRANLVLAALDR
A0A3D1TRD4      AL-QLPVLGLVQRNVG-QAVVTVGADSV------AQDRHSA--EVFRVVRANLGFATASY
A0A2E0L5X9      TILGMRILGPLGIIPR---------NKLPLYVESMPQSIET--EAMRQLRARIALAAGGD
A0A3A0AXU8      LF-GMPTQGAIAGVGG---GNGDQGRGLALVTATDPRSPVA--EAFRALRTSVRMAGVDG
A0A3D1JCW0      LS-GLPILASISEHEV-------EDGGPITQ--AHPRSPVS--EAFRSLRTNVQYSSVDR
A0A2N2MJJ0      MF-GLTTLGQIPEHGA------AKETGLFIA--SQPRSPVS--ETYRALRTNLEFASVDN
A0A3M1LAM5      IV-GARLLGTIGRFPA-------KSDKVIVR--RAPRSPAA--EMVRQLRSKILLAQPGR
E8N5M1          QT-KLPVIGTIHTFDP-------KAGDPVAL--SSPRSPVT--ESFRSLRTNVRYASVDH
A0A1F8U7F0      VM-QLPVVGYIAEIQY----ESGSDESLYVT--RQPRSPVS--EAFRLLRTNLEFAGVDR
A5V160          AT-HVGMLAAIGRIDG-----AEPSDKLVML--RDPFSQVA--EAYQMLRVKLEIARFEK
A0A2A6REI6      LL-DTSVLAAVGEIDG-----QRSMDKLVTL--ISPHSKFS--EAYQMMRVRLEIARYGH
A0A426TTK3      LL-DTSVLAAVSEIEG-----QRPMDKLVTL--ISPHAKVS--EAYQMMRVRLEIARYGQ
A7NIZ1          TA-RVGMLAAIGRIDG-----AAPSDKLVML--KDPFSQVA--EAYQMLRVKLEIARFEK
A0A0P6XM68      AL-GVPVIGFIAELEH-------DQDKAYVA--ENPRSPVS--EAFRTLRTNLEFAGVDR
A0A2N2MEG3      AL-GLPVIGYIAELEH-------DQDKAYVS--ENPRSPAA--EAFRTLRTNLEFASVDK
A0A353RQ31      IL-NIPVIGLIGELHK---KNKDDKLGNYVV--YHQRSPVA--EAFRALRTNLEFSSLDF
A0A3B9KNR2      LL-NLPVIGLVGELRK---KSNNDKFGSYVI--SNPRSPVA--EAFRALRTNLEFAGIDS
A0A0P6XME1      VL-ELPVLGYINEING---KTPYEDYPPHVI--AQPRSLIT--EAFRSIRTNLEFVEIDR
A0A3B9Q1T8      IL-GQPVIGTIGDINSSLLKRGGKKSGVHVA--NQPRSPIA--EAFRSLRTKLEFYNIDQ
A0A0M8KAF3      LT-GLPMIGAIAHIEG-----TNGDGVLVAR--EQPRAPVS--EAYRVVRTNLQFAEVQS
A0A3M1H759      SL-GLTPLGSIARIKG-----KGYADRLVTL--HNPFSAAS--EAYRVLRSNIQFMAGEQ
A0A1F8PTW9      LF-SAPIIGHIFEQKN-----GKKQHHLYDT--ADLRHPIA--EAFRILRTNIEVAEANQ
A0A1F8QH26      LF-SAPVIGHIFEYKD-----GKTGNHLVDL--TDLQQPLS--EAFRVLRTNIELSGSDR
A0A3D0UNQ0      DL-NLTPLGTIGQYGN-----GKFQGRMIVS--EDPRSPVA--ESYRIIRSNIQFMFIDN
A0A2G6GG97      KT-NLATLGAIAIIKD-----HTIGSGLITQ--NAPRDPIS--EAYRIIRTNLSFSTVDK
A0A359HML3      LI-KAPILGYIPEIPR-----KEDRWHFVT---NHPRSPIS--DAFRNLRINVDLLGVET
A0A2U2S5W9      TA-GLTPLGAITRMRG-----EGYENKLVTM--RHPRSSVA--EAYRTLRTNIQFSTLDK
A0A3M1EJ46      AL-RIPTLAAIPAVRM-----RTSKNGNPFAA-NHPTSPFA--EAHRTLRTNVQFSSGDV
A0A3M1ZZ81      DT-NLPTLGAIAFIKG-----SAPNQRLITH--HTPRDPIS--EAYRVLRTNLTFSAVDS
A0A3D0D4X6      LV-GLPILGQITELPH-----EHSTPAQAVILANAPRSPLA--EAYRMLRTNLQFAMVDR
A0A1J4ZRV4      VS-GLSTLGAIARLKE-----TGGTRQLVAWLQT--KAPES--EAYRTLRTNIQFSSVDK
A0A1V5RXW5      VT-GLSTLGAIARLKD-----AGSARERIAWLRT--SAPES--EAYRTLRTNIQFSSVDN
A0A3A0B2P8      HL-ALPALGLVPKNHA-----AEGRAGL-----EGDDERAALNDAFSALRLNIQAALGGD
D1CAL1          LT-GRGALGLIPELRS-----PESIEAI-----AHPDSVGS--EAYRTARTNLQFVAVGQ
D1C8M3          LT-GRPALGWIPRFRG-----PSGIALV-----TAPRSPVS--EGYRSLRTNLQFATLGQ
I4EI06          LT-GKAPLGSIPVLVS-----ADGVESL-----RAPHSPAA--ERYRSLRTALQFATLGQ
A0A3D1U3H5      LMSGAPVLGVVGDLNR-----ETKRPGLSVT--ENRRSLGA--EMYRMVRTNLLFSGADA
A0A2N2MEK3      VL-GLPVLGYIADMKP-----ANGPRQLHVA--AFPRSPAA--EAFRNLRSSIEFSGEDR
A0A3B9J9U6      VL-GLPVLGYIADMKP-----AEGPRQLHVA--AFPRSPAA--EAFRNLRSSIEFSGEDQ
A0A1W9UQ51      VL-GLPVLGAVPQV---------SRKNALSS--DNPP---------------------DQ
A0A3C0LJ76      VT-GLTTLGTVPEIKL-----DTASQGLVML--QNPHSTDA--EAIRVLRTNLLFASVDH
I0I8T2          VT-GLTTLGVLPESNV-----DSSERPLIML--SAPHTSDA--EAFRVLRTNLLFASVDR
A0A363SX22      LF-QAPLIGFIPVMS------KAAAHSLYMV--KLPQSVVA--EAFRSLRTNLEFASVDK
A0A2E5F6N9      RT-GLTRIATILRWTP----KEIGAKEVTLL--SQPRSSHA--EAFRQAKVNVQFLSLTP
A0A2E6J6X7      KF-GVSVLGMVFEWSS----KEVNENDLIVD--TSPKSSFA--EAFKQIRTNLQFAATKS
                                                                            

A0A401ZA55      PFKLVMVTSPMAGEGKSTIAANMASFLAMSGKRVLLVDADLRHPVLDQHF-QLNNQKGLS
A0A1F8RRT9      Q--ALLVSSANPGEGKTTTVANLAVAIAQTGLRVIVIDSDLRRPALHRIF-GLSNGAGLT
A0A3M1EAN8      PPGALLITSALPGEGKTTVAANLGTVMAQAGRKVLLVDADLRHPDLHRLF-DVPNRRGVA
A0A326UPN3      PFKLIMLTSALAGEGKSTIAANLATFLAMSGKRVLLVDADLRNPVLDKHF-HINNQNGLA
A0A0P6WSP2      PIRTLLISSPGMAEGKSVVTANLALALARLGLKILVVDADLRLPSLHRIF-GVDQENGLS
A0A1F8QGH2      PLQSLLVTSPSSQEGKSIVLANLAAAMAGSGQRIVVVDADLRLPRLHQVF-KLDGKEGLT
A0A0S8KFR9      PLKTLLITSAEPGAGKSTVLVNLAAAMAQAGQKVVVVDGDLRYPCLHEVF-ELPNDMGLS
A0A1Q7TTL6      APMVVTLTSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDLRRGVLHRRL-GARRRPGVS
A0A1F8SS27      PLKTILVTSCDKATGKSFISTNLAMILAHSDREIILLDADLRNSNIHKMM-SIPNEYGLS
A0A3A4VPK9      PIRTILVTSPEVSTGKTIISTNLAAIYAQKGEKVLLLDADLRRPRVHKTM-GITNHIGLT
A9B6E3          KARTLIVTSSQPEEGKSTVAANLAWVLAQAGQKVVLIDADLRKPMMHRVF-EVSSEYGLT
A0A3D0CW53      RSTTLLITSAALGEGKTTIAANLAVIMAMAGKRVILVDGDLRRPSVHRFF-GIPNRLGLT
A0A3C0XJG2      PPRTIMVTSALSDEGKSLVAANLALAFAESGSLTVLVDADMRKPMQHLLY-GLDSTVGLA
A0A3D1TRD4      RSKILLVTSTQKAEGKTTTIAKLAVALAEAGKRVVLVDADLRLSSLHRMF-KLDNRRGLS
A0A2E0L5X9      MPHILTVVSYDSGEGKTLTTANLALESAQTGLRTLIIDGDMRRGDMHEIF-QLPNMYGLG
A0A3A0AXU8      PVHSLMVTSAGPGEGKTFVASNLAVVFAQEGRRTILVDLDLRKPQVGARF-GLRREPGFS
A0A3D1JCW0      PLRRIIVTSPTPEDGKTTIVANLAVVLAQGGINTLLLDADLRRPRLHKIF-KCENKLGLS
A0A2N2MJJ0      PLKTILVTSAGPGEGKSTVACNLAGALAQAGKKVLLIDTDLRRPRIHQYL-GLGNRFGLS
A0A3M1LAM5      TFRTLLVTSAAPQDGKTVAVANLGAAMASAGMRTVVVDADFRAPSLHESF-DLPNVLGLA
E8N5M1          PLRVLLVTSPTPEDGKTTVAINLAVVIAQSGNRSVLIDADLRRPRIHKVL-GLDNRQGLS
A0A1F8U7F0      PIRRLLVTSAGPGEGKTTIAVNLAAIMAQGGKRVVLVDADLRRPKIHRFL-GLSNKVGLS
A5V160          PLHTLLVTSSSPGEGKSTTAANLALAIARSGKRVILVDTDLRRPSLHRFF-RHANLRGVT
A0A2A6REI6      AFKTVLVTSGNQGEGKSITAANLAVVLARAGKRVLLVDADLRRPTTHTYF-AHHNLRGLT
A0A426TTK3      PLRTILVTSGNQGEGKSITAANLAVVLARAGKRVLLVDADLRRPTIHTYF-AHHNLRGLT
A7NIZ1          PLHTLLVTSSNPGEGKSTTAANLALAIARSGKRVILVDTDLRRPSLHRFF-RHANLRGVT
A0A0P6XM68      PIRSILVVSAHPGEGKSTVATNLAITMAQGGKKTLLIDADLRRPRVHQYL-NLPNRVGLS
A0A2N2MEG3      PIKTLLVVSAHPGEGKTTVATNLAVTIAQGGKRVLLIDADLRRPRVHHHL-GLNNRVGLS
A0A353RQ31      SLKSILVTSSGETEGKTTVACNLAIILAQGGNRVLLMDTDMRRPNVHVQF-NLHNRIGLS
A0A3B9KNR2      PLKSILVTSSGETEGKTTVACNLAVILAQGGKKVLLLDTDMRRPNVHTQF-NLHNRVGLS
A0A0P6XME1      PLKTLLVGSPSPDEGKTTIAVNLAIVIAQAGKRVLLIDTDMRRPQIHERL-RLPNRFGLS
A0A3B9Q1T8      PLKVLLVTSAGLEEGKTTVAANLAAIMANNNKNVLLIDADMRKPKIHTHL-GLSNRYGLS
A0A0M8KAF3      PLHSLVVTSSEPGEGKTTTAANLALVMAQAGRKVVLVDADLRKPLVHRLF-QLSNAQGLT
A0A3M1H759      PPKTIMLTSTTPEEGKSLTAANLSVVMAQADFKTILVDADLRKPSIHKIF-EISNSQGLS
A0A1F8PTW9      PLKTILVTSADIGDGKTSVATNLALFVAQRNKKVVLLDADLRSPNIHKYF-NLANDRGLV
A0A1F8QH26      PLKTILVTSADASDGKTFVAANLAMFMAQRRKKVVLVDADMRRPTIHEYF-NLDNDKGLT
A0A3D0UNQ0      PGRAILVTSAVPGDGKSTTAVNLAIAMAHNEKRTVIVDADLRNSELHEIF-GVSNSNGLT
A0A2G6GG97      ELKSYLVTSASPGEGKSTTAANLAVVLAQTGKKVVLIDADLRRPIQHKIF-NLPNNMGLT
A0A359HML3      --KTIMISGSAISEGKSTIALNYAQIATQANKKVVFVDGDLRKSKMKEAL-KLEQDTGLS
A0A2U2S5W9      PARTLLVTSPSALEGKSVTSANLAVSMAQAGFKTVLVDADLRRPVQHKIF-GLSNQQGLT
A0A3M1EJ46      TAETLLITSALPRAGKTTTVANLGVVMAQAGMKVLLIDTDLRAGNLHQVF-GVPDRPGLT
A0A3M1ZZ81      ELHSLLITSSSPGEGKSTTTANLAVVMAQTGKQVILVDADLRRPTQHKIF-QLSNNQGLT
A0A3D0D4X6      PLHILVVTSPGPREGKSVTSANLAVAVAQTGARVILVDADLRRPSQHTLF-TLPNQTGLT
A0A1J4ZRV4      PVRSLLVTSAGPSEGKSTTAANLAVVMAQTGQRVVLVDTDLRRPVMHKVF-GVANNTGLT
A0A1V5RXW5      PVRRLLVTSSSPGEGKSTTAANLGVVLAQTGQRVILVDTDLRRPTLHKVF-GIPNNTGLT
A0A3A0B2P8      VPKTLLVGSPAVGDGKSSVAANLALAFVEAGYRALLVDADLRRPSLHRQF-NLPNQRGLT
D1CAL1          SLRSFVVTSPRPGDGKTTTAVNLAAVLAQGGQRVILVDADLRRPQVHRYFAGLNTRSGLS
D1C8M3          EVRSILVTSARPGDGKTTTVVNLGAVLAQGGQQVIVVDADLRRPRLHAALGNVPNRFGLT
I4EI06          PIRSLVITSPRPGDGKTATATNLGAVLAQAGQRVILVDADLRKPQLHTHFAGVKNRAGLT
A0A3D1U3H5      ANKVILMTSCGEGEGKTTTSMNVAMVMAEIGRKVLLIDADLRRPHIHQVA-GIENRGGLT
A0A2N2MEK3      PPKTLLVTSSRPGEGKTTVASNLAAIFAQSGKRVVLVDADLRRPSVHRAL-GIPNRLGLT
A0A3B9J9U6      PPRTLLVTSSRPGEGKTTVASNLAAIFAQSGKRVVLVDADLRRPSVHRAL-GIPNRLGLT
A0A1W9UQ51      PYKVLLLTSPGASEGKSFVIANLAVVLAAAGNRVIVVDADMRRPSLHELF-DRPNVTGLA
A0A3C0LJ76      KLSSLLVTSPTPGEGKSFISSNLAVAFAQTGKRVILVDADLRKPTLHRVF-GLVNNIGVT
I0I8T2          GLGALVVTSPTPGEGKSFVSSNLAIAFAQTGQRVILVDADLRKPTLHRAF-GLVNNVGVT
A0A363SX22      PLKTILVTSNGSSDGKSSIATNLAVAFAQSGKKVVLLDADLRRPSLHGFF-SIPNQTGIS
A0A2E5F6N9      PPKRYLVTSPGPGVGKTTFSVHLATAIAQEGKNVILIDSDFRRPGVPPYF-SLSNQMGLS
A0A2E6J6X7      ESRVYLTSSPGPGDGKSTLISNLAVAIAQTGKKVLIVDGDLRRPTLHRRFKNITRDTGLS
                        .     **:    : .   .      :.:* *:*               *. 

A0A401ZA55      NAFLGIWNQVETELD---GQPT--EIPSLRVLTAGVL-----PSNPSELLQSQLASQLFN
A0A1F8RRT9      NALLS--RQPEIQRF---LQPT--AFEGLSVLTSGPL-----PPNPSELLSSRRMDAIVD
A0A3M1EAN8      DLLLN--GQLPDETW---LVET--SQPRLYLLPGGPFTADPRSPTPAELFDATRLQALLD
A0A326UPN3      QILMGVWGNNEMALDGIPT-----EIPTLRLMPAGTR-----PQNPAELLISDTARRLFK
A0A0P6WSP2      EAL-----VS-GKGT-DHLKTT--KEAGVKIMTSGSL-----PPNPSELLNSKKLTILLE
A0A1F8QGH2      DSL-----IN-SSLD-GNLQAT--KMDGLKVITSGKL-----PSNPVEVIGSAHMRIFLK
A0A0S8KFR9      NVL-----SDLRRMS-TALQET--NIEGVRVLTSGPV-----PPNPAEPPPLSKLPQLLG
A0A1Q7TTL6      DFL-----RGEVPLE-AIVQAT--PYPSFSLIGCGTR-----AYNAPELLGSQAMSQLFT
A0A1F8SS27      DILRNGMNVSQALRNYDGVNGG--------VITGGTV-----APNPFELLGSKKMDEILA
A0A3A4VPK9      DLL-----RGSHDLQDVIQKMD--GAENLTIVSSGSL-----PPNPAELLGSARMEQILL
A9B6E3          NLL---TNNEDPTIR-ERTVLS--VAENLWLIPSGPL-----PPNPSELLSSKRMEMLIW
A0A3D0CW53      NLL----VDEALALE-TVLMET--PVAGLKIIPSGPV-----PPNPAELLSSERMKQRGN
A0A3C0XJG2      DLLRETVP----LAD--IRKFE--VMPNLIVLPTGRP-----PLNPAEPLSSTKMLSLIL
A0A3D1TRD4      NLLVDPVASPAELLP--YLQQT--PLPTLRVLTAGVM-----PPNPTELLQSENMATLLA
A0A2E0L5X9      DIL--QSNEPLANLLPNVLLDS--GYENLNIIPAGRS-----EADPAALLGRTRLNNLID
A0A3A0AXU8      NLV----VDRELAVE-HCLQAT--AIPHLLVIAAGTI-----PPHPSELLGSVRAGEVIE
A0A3D1JCW0      SLFVQPMD---GLEK-VIVHSQ--RTEGLHLITSGGT-----PPNPAELLGSQKMKEILN
A0A2N2MJJ0      DLFLSHGK--LADVT-QVYEGP--NNTHFEVVTTGAI-----PPNPGELLSSERMKTLLA
A0A3M1LAM5      ELLSAGRDEYQALLD-KALLET--NVERLTLLPAGRP-----PLDPTMLLTSPRFPELLD
E8N5M1          G-LFIQNP---TMLN-GALQQT--RLETLKVLPSGGT-----PPTPSELLGSRKMKEILD
A0A1F8U7F0      D-LFRGVV---AVRM-VSQQVQ--DVETVSVLTSGSL-----PPNPTELLASVRMEQILQ
A5V160          TALVRDPS---DSLY-NHMIAT--GLENLLVLPSGPV-----PSDPAVMVSSKKMLDLID
A0A2A6REI6      TALVREGD---TPVD-FHLHST--KLNNLLLMPSGPL-----PSDPAAMLSSPQLVELIE
A0A426TTK3      TALVREGD---TPVD-FHLHST--KLSNLLLMPSGPL-----PSDPAAVLSSPKLVELVE
A7NIZ1          TALVRDPS---DSLY-NHMIAA--GEENLLVLPSGPV-----PSDPAVMVSSKRMLDLID
A0A0P6XM68      N-LFRDAK---SLHE-VMGQWK--E-TTLQVITSGGL-----PPNPTDLLASDRMAAVLQ
A0A2N2MEG3      N-LFRDSI---AIGD-VAHAWQ--D-SNLSVITSGGV-----PPNPADLLASERMAAILE
A0A353RQ31      D-LVRGKL---SLHE-VVRSIP--EVKNMDIITSGSL-----PPNPAELLASERMRNLLD
A0A3B9KNR2      D-LVRGRL---TLEE-VVRTIP--EVKSMDIITSGSL-----PPNPAELLASERMRKLLE
A0A0P6XME1      D-ILREHG---SLDE-SLHHLA--T-EGIDVITSGIL-----PPNPAEVLSSERMAKLME
A0A3B9Q1T8      D-LILGRS---A-SV-VQRAGS--N-KKFSVVTSGSI-----PPNPSELLASEKFTRIID
A0A0M8KAF3      SAL----MHPEIAVDRFLQRVDAGGGQTLWVLPSGPL-----PPNPAEVVGSRRMQELLD
A0A3M1H759      DLI----SNPDMEPE-AVLQDT--TVKNLRVLTSGPL-----PPNPAEKLSSQRMSQLVH
A0A1F8PTW9      DLI-----SNGATSN-DVLRVI--EDGKLTILTSGNT-----PPNPTELLSSNKMDQLLS
A0A1F8QH26      DFF-----SKNASIS-DVLRIG--ENRKLGVITAGKP-----NPHPAEFLSSNKMNQFLS
A0A3D0UNQ0      EQL----RQPESQKK-IHLFDT--KVEGLQLLTAGEP-----PPNPSELLGSQRMVKLVD
A0A2G6GG97      TSI----LDGRTPVT-AHLQQT--KISNLGLLTSGPI-----PPNPSELLNSRRMQDVLK
A0A359HML3      TLLNSPAKLKDVVFT---------LDQRLTIIPSGSC-----PPNPTELLGSEKMDRILT
A0A2U2S5W9      NAL---LQPGEPSAD-GHLQST--EIENLRVLTSGPI-----PPNPSELLGSAKMQALLQ
A0A3M1EJ46      DLLLSNAVPDE-----SMLLKT--EVLNLYLLPSGPL-----PPTPSELLSSDRMVSLIE
A0A3M1ZZ81      TAI---L-DSLTPVS-YHLQKT--RVPGLRVMTSGPI-----PPNPAELLNSHRMKQVLE
A0A3D0D4X6      SAI---V-SDEVDLQ-ALLKPT--TMSGLSVMTSGPI-----PPNPAELLNSERMSHLLQ
A0A1J4ZRV4      SAL---LNGEQVVLD-GHLQGT--EVENLSLLTSGPI-----PPNPSELLGSHRMARLVE
A0A1V5RXW5      TAL---LASQDTPIM-EQLQPT--EVPDLHILTSGPI-----PPNPSELLGSQRMAYLIE
A0A3A0B2P8      TLL---LGE-EHNLE-LLIQQP--AQQRLSLLTSGPL-----PPNPTRLLSRKELRGVLA
D1CAL1          NLL---LSEWDVKLT-PTLRQT--TIAGLTVLPAGPL-----PPNPLDLLSSPRMREVLD
D1C8M3          NLL---LADDEVDLA-ALLQET--DVPGLRVLTTGPL-----PPNPTDVLDSPRMHELIA
I4EI06          NLL---LAQPGDGLADALLQPT--EIPGLRVLTTGPL-----PPNPADVLNLPRMREILT
A0A3D1U3H5      ALL--LGMDGGDIMT-STVQSE--ADPHLYFLPSGPI-----PPNPTALLSSQRMRDLLH
A0A2N2MEK3      TLF-----RDSLKLE-SVWKHSNGISRGMLVITSGSL-----PANPSELLGSEKMLHILA
A0A3B9J9U6      TLF-----RDSLKLE-SVWKHSNGISRGMLVITSGSL-----PANPSELLGSEKMLHILA
A0A1W9UQ51      DVLSDHKVDDEGLLS-VPLLET--DFDNLYLLPAGRP-----PADPATLLTSPRLFALLD
A0A3C0LJ76      SAL----VSDAADVE-AALQAT--ATPELRVMTSGPL-----PPNPSELLSSHKMQELLT
I0I8T2          SAL----VSNLDEFT-AALQQT--IVPELRVMTSGPL-----PPNPSELLSSRRMQELLD
A0A363SX22      DII----RG-QVSLE-EAIYRS--AKGGVALILAGPL-----PPNPAEMLGSKKMENILA
A0A2E5F6N9      SLL----ANPELQLE-DLLQST--AIPTLKVLTAGPN-----PPNSVELLGSSRMEAIMD
A0A2E6J6X7      NYL----SDNTETLG-AVTQTS--GVSGVDVITSGPI-----PPNPSELLNSPRMKDGIE
                  .                           .:  *          .              

A0A401ZA55      HFRNSQKFDY--IIFDTPPLLPIADAQIMAAYMQVTIMVVNASRTPRKA---MVRAKQAL
A0A1F8RRT9      AARKEA--EI--LLFDSPPALAVADASILAGKVDGAILVVDTGRTRAHA---LQRASEAL
A0A3M1EAN8      HLRFLA--EV--IIVDSSPVLEVPDGLELAALVDGVLLAMQNGRSGRYE---VQDAVRRL
A0A326UPN3      HYQDTN--RFDYVIFDTPPLLPVADAQIVASYAEVSVLVVAASRSPRRL---LNRAMQIL
A0A0P6WSP2      KLSQQA--DL--VLVDSPPILSVADSIILAGELDGTMLVARSGMTTRKM---LREAEENL
A0A1F8QGH2      EFEEKT--DL--VIIDSPPVLPVADAAILTSLVDRVILVLRAGQTRHRA---AQQAVKSL
A0A0S8KFR9      KLAKEA--DL--VLLDSPPILAIADAATMASMVDGVLLVAAKDQATGRR---VQRALQQM
A0A1Q7TTL6      TLRPNY--DV--ILVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDV---AAAKLEVL
A0A1F8SS27      KLKK-S--DY--VIIDSPPLF-VSDSMVLSPKVDGVLLVAELSQTKKKQ---IRRTVEQL
A0A3A4VPK9      ELGNKY--NI--IVIDSPPSI-VADSQILSSKVDAVLLVIQPGKTSKEA---AKATEDLI
A9B6E3          LLQQEY--DW--ILFDTPPILTVTDPIALIPRVDGVVLVAEAKRTRRDM---LAKCRAAV
A0A3D0CW53      EMKELA--DV--IIFDSPPALVVTDATILGTLSSGIVYVVNAGRTRSGV---VRRGKETL
A0A3C0XJG2      SLSQLA--DAATVVIDTSPVLAVADAHALSTMVDGCVVVVDSARTPARA---SRRAVDVL
A0A3D1TRD4      MLAELA--DV--VLIDSPPVLAVADAMTIAPNVQGILFIIESGSIRLGR---LNEALGRL
A0A2E0L5X9      LLSKRY--DA--IFIDAVPTIGGSDSVFLGEISDGVIIIVNARRTRLSS---LRRSKDEL
A0A3A0AXU8      QIKALA--DM--VIFDTAPAATVTDALLVVPHMDGALQVVDAGSTRRDL---ALRCKALL
A0A3D1JCW0      RLSQSF--DT--LLLDTPPVLTVTDTVALSKAVDGILIVVRLGKTKRGE---FLQAIEHL
A0A2N2MJJ0      EAVKNS--EI--VILDSAPSL-VADSQSVSASADGIIIVVEAGGTRAEP---VRAMLESL
A0A3M1LAM5      LLLERF--DA--IVMDSPPVLLAPDAVILATRADGTVMVVSAEHTSRQA---ARRAIKVL
E8N5M1          SVASEA--EM--IVVDTPPVLSVTDAAVLSPLVDGVLLVVKMGTTKQSA---LLQAVEQL
A0A1F8U7F0      EAEQDA--DI--VIIDSPPSL-VADVQVLAGKVDGVILIIHPGHTQEDA---SLATLEML
A5V160          ELKRMA--DV--VVFDSPPILAVADAIPLAHICDATLLVVLAGATRTSQ---LRRACDQL
A0A2A6REI6      ELKTQV--DV--LVFDSPPLLQVADASMLMQLCDTVVLVATDGKTRTSA---LRHSMQLL
A0A426TTK3      ALKAKV--DI--LVFDSPPLLQVADAALLMQLCDTVVLVATDGKTRTSA---LRHSAHLL
A7NIZ1          ELKRIA--DV--VVFDSPPILAVADAMPLAHVCDATLLVVLAGVTRTSQ---LRRACDQL
A0A0P6XM68      SALEEA--DV--VVVDAPPFL-VADASILASRVDGVLFVIHPGRTPVDA---AQATLEQM
A0A2N2MEG3      SANKLF--DM--VIVDAPPFL-VADASILAARADGVVLVIRPGKTPLDA---AMTTLEQM
A0A353RQ31      ELKKSY--DV--IVLDSPPLI-VSDSQILATRVEGVLYVIVPGSTRIES---AKRPLEEL
A0A3B9KNR2      ELKSHY--DV--IVMDSPPLV-VSDSQILSTRVEGVLYVIIPGFTRIDS---ARRPLEEL
A0A0P6XME1      EVAQRY--DK--VILDGPPFL-ISDAIVLASRVDGVLLVLRARNTSQSV---ALEVLDQL
A0A3B9Q1T8      KVSQQF--DM--VVIDSPPGF-VTDAQILGTKVDGVIFVIRAGKTRANI---ARMSLDEF
A0A0M8KAF3      ELMTFA--DI--VILDTPPVLVVADPALLARMSDGVLLVTRMNVTHRQA---LQRAIEQL
A0A3M1H759      LLEETA--DV--VIFDTTPVMAVTDAAVLANRVDGVILVIRSGRIPRAT---LKKAVARL
A0A1F8PTW9      KLKEIY--DI--VIIDSPPFI-IADTMILASKVDGVLLVVRPGHTRQPL---AQVTTEQI
A0A1F8QH26      KLKTVV--DY--IIIDSPPFI-ISDAMILAAKVDGLLLVVRPGHTRQPL---AKVTKEQI
A0A3D0UNQ0      TLNSEA--DV--VIFDSPPAAYVTDAAILSRLVDGVVLVISAGKTRRDE---ARQAIFNL
A0A2G6GG97      ELEDNS--DL--VIFDTPPVLTVADASIIGPQVNGVLLVINTGRTRQEA---FINAVDRL
A0A359HML3      HIKGMA--DL--IVVDSPPLF-VTDAAVLAKKVDGILLVVQLGKSRRDT---VKEMMVQI
A0A2U2S5W9      RLKEEY--EV--VIFDSPPALVVTDASVLATRVDGVVIVTDSGHTRRDT---VVRAREAL
A0A3M1EJ46      HFRGRV--DV--LLMDSPPVLAVTDAAILASLVDGVLLVIESGRTSKGE---AQRALHTL
A0A3M1ZZ81      ALQQEA--DL--IIFDTPPVLTVADAAILAPRVNGCVVVAEAGSTRRPL---FLQAIERL
A0A3D0D4X6      ELAAQA--EL--VILDTPPTLAATDAAILAAKADGTLLVIDTNLTKRTE---LVHTTEQL
A0A1J4ZRV4      KLAGQA--DL--VIFDSPPVLAVTDAAVMGRQVDGVVLVVDAGQTREQV---LAQAAAEL
A0A1V5RXW5      MLAEIA--DI--IIFDSPPVLAVTDAAVLGRQMDGVLLVVDTGTTREQV---LGNAVAEL
A0A3A0B2P8      EMAQKF--DI--VLLDTPPLTATVDASILATHVEAMLLVVAAGRTQRTP---TQRVVKSL
D1CAL1          WLAEQA--DV--VIFDAPPLAVS-DALVLSRLTNGVILVSETGRVRTAE---IADAVQQI
D1C8M3          GLERMA--DM--VLVDAPPVPVS-DALVLAGLVDRVLLVAYSGRTRSAE---LARAVEEL
I4EI06          SLEDAA--DV--VLVDAPPMAVS-DPLIIAGLVDGVLLIMTGGRTRSGE---LTQVVQEL
A0A3D1U3H5      AFKQSF--DT--IIVDSPPLLAVTDSAVLSTMADRVVLVADPRKATRHTLLRAKDV---L
A0A2N2MEK3      ELRQKA--DI--IIFDGPPMM-VADAQILASLMDGVLLVLQPGKSPADE---AKSTLAQL
A0A3B9J9U6      ELRQKA--DV--IIFDGPPMM-VSDAQILASLMDGVLLVLQPGKSPADE---AKSTLAQL
A0A1W9UQ51      SLGSQM--DM--VLIDSPPVLGPPDAMILATLVEGTVLVVSAGVTRRETIQQAKERLLGF
A0A3C0LJ76      HLQSLC--DV--VIIDSPPVLVVSDTAVLASRADGVLLAFTHEKLRRDP---ARNTIGAL
I0I8T2          RLRSDC--DL--LVIDSPPVTVVSDTAALASRTDGVLLVFSREKMNRDL---AHKTMGAL
A0A363SX22      SLEEIA--DV--VILDSAPLL-VADAWALSAKVDGVVLVVEPGRLKRKT---AQAIMDRI
A0A2E5F6N9      EVAARG--DI--LVIDSAPIMAVTDSSILASKQIETVLLVDP-NTRMGW---LKDCIGAL
A0A2E6J6X7      KAKDIY--DI--ILVDCPPVLMVADTPIISTVVDMAILVVDSFTTKTSS---FGATVETL
                            :..*  *     *   :       :                      .

A0A401ZA55      -ARTGTRILGVALNKSYWPEYG-----------EVHDYLSNIQSRPRADIAMAMPPNTPA
A0A1F8RRT9      -ALSKTKVLGAVLNKLTGRG-Q-----------GYYYYSYHYYSSSDDGK------NGHR
A0A3M1EAN8      -QYARAELLGTVLTRCQGRG-G-------------YTYTVHPAPAPHTPKVVPLVAPPDG
A0A326UPN3      -RRTGTRVLGLAINRSQWPEYG--------DIHDYRGSVQTQGAPLLKAAPAAQQRVPQQ
A0A0P6WSP2      -RQVRGNLIGVVLNGVPR-DQH-----------SAYRYESGEEERP----------SAQR
A0A1F8QGH2      -QQAGAQQIWVVLNAVPH-HMD-----------GYNSY--------------YTNEHEDK
A0A0S8KFR9      -ARVGAKPLGVVFNRASAADGD-----------YYYPYGRGIIGGAEPVLPSFLGNFVGR
A0A1Q7TTL6      -QRLPVRLLGAILNAVPAGEAY-----------RYYSY------------------YLPG
A0A1F8SS27      -NRTGAQVIGVVLNRATGESLK------------YYGAKQYVGYGLEEADEKLPNVKSYL
A0A3A4VPK9      -KRAGGHIIGVVFNRIPRDRVD-----------YYSGNYQYQYYSKD-------------
A9B6E3          -QTVGGRVIGLVFNKLDPRSEG-----------YGVYYTYYYDQHHTSNRGRRFWNRKDD
A0A3D0CW53      -DQVGLKILGVVLNNSTSHRAR-----------GYYYQRYYYSHESTGERRGRRLRAGAV
A0A3C0XJG2      -NAVHARILGVVLNKVPAIQLD------------YYQSYA--------------------
A0A3D1TRD4      -RRSGTPILGVILNKVKADTEG------------YY-YYAYDGYYSSSGKPATEHVNGVI
A0A2E0L5X9      MAAPNVNILGVVFNRVRLQVTS-----------KYNNTYYRQTPALTPEKLSREMARSGS
A0A3A0AXU8      -ERAGARLLGPVLNRVEAGDLG------------YYANYYSYGGYYHEEAEEAKGGFWRG
A0A3D1JCW0      -RQVNANLVGVVINGVSPRHAR---------YHYYYRNYYYY------------------
A0A2N2MJJ0      -RRTHTRILGLVINRMK----------------AHHGEYGHY------------------
A0A3M1LAM5      RDQEGVNFLGVVVNRIP------------LHHYAYYLPPQVTGEAAAVSLPRRVWRRLTG
E8N5M1          -QQVNARILGVVVNGVNPKKSHYYYRNYGYYQYYYYGDNGNL------------KKKRKT
A0A1F8U7F0      -NRAGARTLGVVLNRIP-RGRS-----------DYYGGYRHY------SPYYSGYHYYHS
A5V160          -LQAGVEPQGVVLNRVT-KEQGGYDH-----YYYYYGQNRKRSR---RGVLSRLFKRRRR
A0A2A6REI6      -EQSGVKLAGVVLNRVR-KSRYGYGYGYGYGYGYGYGYEPEPEKLTWRRRLRRMWRRLLG
A0A426TTK3      -AQSGVKLAGVVLNRVR-KSRYGYGYGYGYGYGYGYGYEAEPEKLNWWRKFRRALRHLRG
A7NIZ1          -LQAGVEPQGVVLNRVT-REQVGYEH-----YYYYYGGERKRSSRSALSRLFKRRRRRQS
A0A0P6XM68      -RRVGANVLGLVLNRIP-RNRP-----------NYYGGYRYY------SGYYKGEYSY--
A0A2N2MEG3      -KRAGANILGVVLNRIP-RNRP-----------NYYGGYRHY------SGYYKGEYSYHN
A0A353RQ31      -ERINAHLLGVVMNRIP-HNRS-----------YYYGGYDYY------SPYSSRDKYRHS
A0A3B9KNR2      -ERINAHILGVVMNRIP-QNRS-----------YYYGGHDYY------SPYSARDKYRHS
A0A0P6XME1      -DRVKARVVGAVLNRVQDTTSN-----------HYYRSLKSY-----------------T
A0A3B9Q1T8      -NRVGAKVVGLVMNRVP-RNQR-----------YYYGGYQYYGLKGEVNAAYDQGDPSEN
A0A0M8KAF3      -RYAEARILGVVVNDLTARDGG-----------YYYYAYSQYYHHDDGSGGDGTRPERKR
A0A3M1H759      -KQIRANILGAIVNQTPGKGDG-----------YAE---YFTPLA--QIQTETAKRPWWK
A0A1F8PTW9      -NLVGARLVGVVLNRIPLHGAD-----------YYTGKNYLYTYYLSNYGAERDDLIIDD
A0A1F8QH26      -GQIGANLIGVVLNRIPLRNAV-----------YYTGEGYLYTHYMSGYGAAKKTNNNGE
A0A3D0UNQ0      -EQAGANILGVVLNGMAEKRGG-----------YYY--RYGSSPHDQSLIGNRIRAGLQQ
A0A2G6GG97      -RRTGTHIFGAIFNRVKLDRSS-----------YGY--YYYSSYE--YNAKSKKRRSRRL
A0A359HML3      -ERTGTSVLGVIINKISS-GSN-----------YYS--KYYGSYYNIPDSEQNDADISET
A0A2U2S5W9      -RKVGANLLGGVVNRLSPRSGG-----------YYY--YYYYYYAADGNGEQKRKRKKKH
A0A3M1EJ46      -QAVGGRVLGAVLTRSKAEGIG-------------------------YRYDRRGVTPSQL
A0A3M1ZZ81      -ARTGTNLYGVVMNRSKPGRAS-----------YYD--DYYYYAT--YEYVEGRRKKRRR
A0A3D0D4X6      -QRVGATLLGATLNRLRRHNLA-----------GYY--YYYYDVS--SDHNESGPAPAQR
A0A1J4ZRV4      -QQTGANLLGVVLNRLDSRR-G-----------GYY--YYY--YY--YSEEEGG----QR
A0A1V5RXW5      -QKTGVNILGVALNRLDTRR-N-----------GYY--YYYYHYY--YQEDESG----ER
A0A3A0B2P8      -RHLQVNLLGVVLNAVPV-SQT-----------VYH--AGYGYAVPRAADAEGTRRGALQ
D1CAL1          -QQSGSTLLGIILNRFPLEKSG-----------GYY--TYYRSQEDDAGGARRGESPSVI
D1C8M3          -TRAGTPLLGVLLNRAEA-GAG-----------GYD--LYYAEYY--SAEPDTGDQDGSG
I4EI06          -TRTSTPLIGAVINRVDV-KGD-----------GFY--AHYASYY--GAGSDRVGDGNPV
A0A3D1U3H5      -ERVGSRVSGVVLNRVGEESSG-----------YYG--YYYYGGY--SAYVTDGQKVSSG
A0A2N2MEK3      -KRSGAKVIGTVFNRVP-KNGG-----------------QHYGGY--RYYSTDSYNTYEQ
A0A3B9J9U6      -KRSGAKVIGTVFNRVP-KNGS-----------------QHYGGY--RYYSTDS------
A0A1W9UQ51      -DQREVNLLGLTVNRAK-LDGS-----------------YHYSSD--QEGGEQKQKGTSR
A0A3C0LJ76      -RQVQARILGVVLNRVEGSQHG-----------------YYYSYH--KSYGNRYYTTPYS
I0I8T2          -RQVNASVLGIVLNRVTSGEHG-----------------YYYSYH--KSYSSRYYSGYYA
A0A363SX22      -QLSRVRIVGLVLNRVKK-------GSESDYYSGYLADASKYDSQASNKRKANLQDIQST
A0A2E5F6N9      -RKADATVLGYIHNRINARRFGYGYT-----YYNYY------------------------
A0A2E6J6X7      -NNSGVEIAGVIMNKLKKPKFGYGYGYNYGYYYNYY------------------------
                             .                                              

A0A401ZA55      I-----------------------------------------------------------
A0A1F8RRT9      K-----------------------------------------------------------
A0A3M1EAN8      K-----------------------------------------------------------
A0A326UPN3      A-----------------------------------------------------------
A0A0P6WSP2      W-----------------------------------------------------------
A0A1F8QGH2      N-----------------------------------------------------------
A0A0S8KFR9      F-----------------------------------------------------------
A0A1Q7TTL6      Y-----------------------------------------------------------
A0A1F8SS27      N-----------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          H-----------------------------------------------------------
A0A3D0CW53      S-----------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3D1TRD4      E-----------------------------------------------------------
A0A2E0L5X9      GLFGMRRHIITTGRGERLFSVSACAARLGVKRRTVQGWIETGHLQAESRFMRQWIPESAI
A0A3A0AXU8      R-----------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      FLKPIRRRLGLGRERIHEDGRVLLSLAEAAHLLGVRKETARRWCASGRLPAVKRGLRWWV
E8N5M1          A-----------------------------------------------------------
A0A1F8U7F0      M-----------------------------------------------------------
A5V160          R-----------------------------------------------------------
A0A2A6REI6      R-----------------------------------------------------------
A0A426TTK3      G-----------------------------------------------------------
A7NIZ1          G-----------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      Y-----------------------------------------------------------
A0A353RQ31      Y-----------------------------------------------------------
A0A3B9KNR2      Y-----------------------------------------------------------
A0A0P6XME1      Y-----------------------------------------------------------
A0A3B9Q1T8      T-----------------------------------------------------------
A0A0M8KAF3      R-----------------------------------------------------------
A0A3M1H759      P-----------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      G-----------------------------------------------------------
A0A3D0UNQ0      A-----------------------------------------------------------
A0A2G6GG97      S-----------------------------------------------------------
A0A359HML3      E-----------------------------------------------------------
A0A2U2S5W9      T-----------------------------------------------------------
A0A3M1EJ46      A-----------------------------------------------------------
A0A3M1ZZ81      R-----------------------------------------------------------
A0A3D0D4X6      R-----------------------------------------------------------
A0A1J4ZRV4      R-----------------------------------------------------------
A0A1V5RXW5      R-----------------------------------------------------------
A0A3A0B2P8      I-----------------------------------------------------------
D1CAL1          P-----------------------------------------------------------
D1C8M3          P-----------------------------------------------------------
I4EI06          A-----------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      K-----------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A1W9UQ51      D-----------------------------------------------------------
A0A3C0LJ76      Q-----------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A363SX22      S-----------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A401ZA55      --------------------------------------------------------NHAI
A0A1F8RRT9      --------------------------------------------------------GRLF
A0A3M1EAN8      --------------------------------------------------------ETLF
A0A326UPN3      -----SPVANQPQMQPAQMQPMQQMQPGHQMAPNSPSMMPNAPSMAPGSAPMMPPLNGSR
A0A0P6WSP2      -----------------------------------------------------FDVLQYW
A0A1F8QGH2      -----------------------------------------------------SGGSTLQ
A0A0S8KFR9      -----------------------------------------------------SIIRRIW
A0A1Q7TTL6      -----------------------------------------------------EAVDEEA
A0A1F8SS27      ---------------------------------------------------AVRAIPNYI
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ----------------------------------------QPVPSMSEPAPLDLHDPALD
A0A3D0CW53      ---------------HRFAVNGQGTGQLKSSTTDHPTTSEDDVR----------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3D1TRD4      -------------------------------------------------------VVEHG
A0A2E0L5X9      DMVLSQRITTVEPPTPASGVSEESPDSSNGTHGTPGDLRAQREAILDFVSRPNKSDSEN-
A0A3A0AXU8      ---------------------------------GGRRAAPVRESALPAAPQPARPAVASR
A0A3D1JCW0      ----------------------------------QYSAYYGEGEKRKPSSNGSRSNGKHA
A0A2N2MJJ0      ---------------------------------------------SNSYYQDDIEGNNGK
A0A3M1LAM5      EEEALQAMLNVQLGWDPDGWRQVVREQARGVTGHRGAEAPGQPGDAAPAMEPVAVDSNLV
E8N5M1          -ISE-----------------------------------------------------PGS
A0A1F8U7F0      -DGQ---------------------------------DLKPSRMRRLFGKLSPFNHNGHK
A5V160          -NAVPGVVDTLDTVMSGSGQTLYGAPDVVEATVHRRAPDMTTHPDAQPAVTATTAVQGLD
A0A2A6REI6      -KAAPQ-PSTASGVAGGDWEDLTAIEQMETTHANGQNGH-NGHNGQNSQPQPVQQKSDTG
A0A426TTK3      -KTRAH-PRPVPSGSPEDWEDLVALEQMEGVSGNGHNGNGNGKEHARPGDSATPTGNASS
A7NIZ1          -MPGMVDTVDAGVTGIASGTRPDRGAPIDIVMDGFYATPTPETIDRHPVSAGAVVATRTD
A0A0P6XM68      ------------YDDEARGNGKKH----------------------------STFRWRTR
A0A2N2MEG3      -YDEGSSSNQRAYRGNGNGNGKSK----------------------------MTSWFGRA
A0A353RQ31      -GSE-----------------------------------------------------EST
A0A3B9KNR2      -GSE-----------------------------------------------------ENI
A0A0P6XME1      -VSK-----------------------------------------------------ETD
A0A3B9Q1T8      -VDL-----------------------------------------------------QKE
A0A0M8KAF3      ---------------RADASRKGVMARLLSFVNVKS------------------------
A0A3M1H759      ---------------SFLR-----------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ---------------GEVGEGGEVGEGGEGGEGGEGGEGE--------------------
A0A3D0UNQ0      ---------------RNTLTSAYERLRKKEDVIQDSTQLPDEGKEMTHNIP---------
A0A2G6GG97      ---------------KSSRIPSWITSIIKRS-----------------------------
A0A359HML3      ---------------IENNPQEPGVETDATSEPPKDEMKPDPEIILNEQNREISSHSEDV
A0A2U2S5W9      ---------------NHSEQGGFLRGLFGRSQEHTGSSGEGRTENVQHS-----------
A0A3M1EJ46      ---------------DMVSMLTPSGKGLS-------------------------------
A0A3M1ZZ81      ---------------SRSLLPGWITAIIKR------------------------------
A0A3D0D4X6      ---------------KRKGFLGSARHTAE-------------------------------
A0A1J4ZRV4      ---------------RSISPHGADEEGAPARGRARFPWPRLRA-----------------
A0A1V5RXW5      ---------------KHSSRRGTGV-------RFRLPWPRKAA-----------------
A0A3A0B2P8      ---------------QANGQAGAHTLP--ALQEGIKPASNPLYQALRKR-----------
D1CAL1          ---------------HWADGAGDRVVIRRSLRPTISKPADSET-----------------
D1C8M3          ---------------GASTRLSQRLGTLVSGRA-VDATQRGNQ-----------------
I4EI06          ---------------SLGTDLDGRHAS--PDRP-VRRVGDPGD-----------------
A0A3D1U3H5      -------------------------------SRNGKRAAK--------------------
A0A2N2MEK3      ---------------KPATPIRVMAPVPAAFEPTTRPNGHHSVELVN-------------
A0A3B9J9U6      ------------------------------------------------------------
A0A1W9UQ51      ---------------GAWLTLGEAAARLGVSKDQARRWCKSGRLPATKKWQLWWRIDPGG
A0A3C0LJ76      ---------------H--------------KPKSGKRSAPTARTVSQPGA-------NGA
I0I8T2          -------------------------------PRRHAKAAAETTMVVSPQPVPHRSINNGA
A0A363SX22      ----------------------------GLGLSLIPKKTPGNSHRFRNAQKQNKPTPINE
A0A2E5F6N9      ------------------------------------------NY-YKSYNEGGSDDARAP
A0A2E6J6X7      ------------------------------------------YYNYKYSLEDTNPESKSS
                                                                            

A0A401ZA55      DATNTAILPSTNNKR
A0A1F8RRT9      RGKRSQPAEETRTHA
A0A3M1EAN8      PPEQHPG--------
A0A326UPN3      GLLSQQQPQQNNQRR
A0A0P6WSP2      VKTPWFKKK------
A0A1F8QGH2      VSLEGEEKNASPTLD
A0A0S8KFR9      ERAPGLDEDRSPEDQ
A0A1Q7TTL6      ERASG--GKGQPFVI
A0A1F8SS27      ARRFSRSNEAKLEKK
A0A3A4VPK9      ---------------
A9B6E3          RSEAAYEMASHERSK
A0A3D0CW53      ---------------
A0A3C0XJG2      ---------------
A0A3D1TRD4      AAPVGDGKSGSRRQG
A0A2E0L5X9      ---------------
A0A3A0AXU8      MAGAREKGGRVSDGG
A0A3D1JCW0      PVPHPAGESAPREPL
A0A2N2MJJ0      KSRLRLPWAKKVQQD
A0A3M1LAM5      REEDADGPA------
E8N5M1          QPVTSINPPSKPTSR
A0A1F8U7F0      KVEAGVVEENVIEKP
A5V160          ERRNGRAPHQ-----
A0A2A6REI6      RQQSSRSRGRRRSGD
A0A426TTK3      RQSSSRPRSRRRSGD
A7NIZ1          ERRNGMTPHQMNQTK
A0A0P6XM68      KNQTQEEKTAESGQE
A0A2N2MEG3      KKAPGEAPAQEQEKQ
A0A353RQ31      EVALTEQKGNKVLHH
A0A3B9KNR2      DLAFTEQKGT-----
A0A0P6XME1      ELTLLEN--------
A0A3B9Q1T8      GIQRMDN--------
A0A0M8KAF3      ---------------
A0A3M1H759      ---------------
A0A1F8PTW9      ---------------
A0A1F8QH26      ---------------
A0A3D0UNQ0      ---------------
A0A2G6GG97      ---------------
A0A359HML3      PQGRNPKLRGLLTFG
A0A2U2S5W9      ---------------
A0A3M1EJ46      ---------------
A0A3M1ZZ81      ---------------
A0A3D0D4X6      ---------------
A0A1J4ZRV4      ---------------
A0A1V5RXW5      ---------------
A0A3A0B2P8      ---------------
D1CAL1          ---------------
D1C8M3          ---------------
I4EI06          ---------------
A0A3D1U3H5      ---------------
A0A2N2MEK3      ---------------
A0A3B9J9U6      ---------------
A0A1W9UQ51      LERMLEDTWELKAKV
A0A3C0LJ76      GATHVTEAAPSKKRA
I0I8T2          PLEPESVGQPKSVK-
A0A363SX22      PNSGEINRNISNKLL
A0A2E5F6N9      SFIGRIRNKLFSS--
A0A2E6J6X7      KNPFRIFRSIFNR--
                               

© 1998-2019