BYKdb

Dataset for cluster orphancd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

37 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      MFWEEKPPKDINRITTIDARVKGHSLRVAIIIGSTFPAVHNVTTTGAPPEAFPGGTARPL
K9SGV8          ------------------------------------------------------------
B0CA08          ------------------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
X5JJE9          ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A254WHZ5      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A1U7JBN8      -----------------------------------------------------MPF---P
A0A2W4VXF4      -----------------------------------------------------MPFSSKP
A0A2W7AI98      -----------------------------------------------------MPFSSKP
A0A0A2B4S6      ------------------------------------------------------------
L8M1L4          ------------------------------------------------------------
A0A2W6ZN45      ------------------------------------------------------MLTEAG
A0A081GP61      -----------------------------------------MGGFPPSGAAGRFQAPYPD
K9P6R9          ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A2N6M0S2      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      SLPGTGASGPGLFDPSSQQSPLSPMGESQSGGGGLGGIVRTVKRR--QSIFLITFALVTG
K9SGV8          -------------------------------MNQLQQYLFIIRRRWPVATLVFVSAVLVT
B0CA08          ----------------------------------MSNYWLMLKRRG-LPAGFTFLTVLSL
B0BZC6          -----------------------------MNESVSKVIKIIYRNRW-TTVGTFLSVFTGI
A0A1D8TTM0      ----------------------------------MNRLIAIAIRHW-KPVIGLNIVLSAI
A0A0V7ZGW0      -----------------------------------MKVSAIIQRLW-LPLLGLNGVIVGS
X5JJE9          ------------------------------------------------------------
A0A355DPN1      -------------------------------------------------MLGVFCGVLAI
A0A0V7ZMP6      ----------------------------------MKKATKIAVRHW-KFVLAWNKIILGI
A0A254WHZ5      ----------------------------------MKQIFSIARKHW-LPLLGFNSAVLAA
A0A433W046      ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
K9TU02          ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
A0A2T1FMA8      ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
A0A2P8QV10      ----------------------------------MKQIFSIARKHW-LPLLGFNSAVLAA
B8HQ70          ----------------------------------MFQITSTLRRHW-KPLIALNTVLIGS
A0A2S6V636      ----------------------------------MNHIVNIIRRHW-MPLLLLNGVVLAA
A0A1D9G3S3      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLGA
A0A1D8TWE6      ----------------------------------MKKVAGILNRHW-TFLLVFNSLVLGA
A0A1U7N3U5      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLAA
A0A1U7JBN8      PSSTHEINGNGHGHAKPGFMTVMAPPS-LVEQRDEVDFNQLVGVF--RRRAGIFFGVAAL
A0A2W4VXF4      AAREVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVL--GRRAGIFWGVAAL
A0A2W7AI98      AAREVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVL--GRRAGIFGGVAAL
A0A0A2B4S6      ------------------------------------------------------------
L8M1L4          ---------MNNTIVRSDFVNLPAQETGFSLSDFKQILYRRWKPA--LALGIMAFGVVL-
A0A2W6ZN45      SPTPHSPFGTGSTQVAASALSPTANQPDDASTNVLFKLIRSLKRR--QALFLFVFFVTTA
A0A081GP61      QPLQSPLTPTAEAQAGSGGLG---------------GLVRTIRRR--QTVFLLTFAVVTG
K9P6R9          ---------MGETQSGGGGLG---------------GLVRTVKRR--QSIFLITFAVVTG
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A2N6M0S2      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      VLAINTLRQRIFSPVYQGGFQMQISNPFDNPGTGGGGGGSVESIARS----EIKTDVPSL
K9SGV8          TFHAIFVMK----PRYRASGEMLVTPGDQAIAITNVGVSKTVNQPRSLSG----GYLNTE
B0CA08          ALLQAFQEK----PIYEAVGQLKFEE-SQRSSKLIGLDSAVDDESRQQSSLRWQRSLDTE
B0BZC6          VVYLLITPR-----LYSAKVRLILDQ---RPATSISPLGRDIAQTPGDNN-K---GLATQ
A0A1D8TTM0      ALYNASKVT----EVWAARAKLIIPKSSSDLNANLGTLGDFRDRGVSFSQ-Q-VNPLNNL
A0A0V7ZGW0      VIMIATFSQ----KTWTANAQLILPDTTTNLDASLGTLGQLKEQGVAFTN-E-LNPLKVL
X5JJE9          ---------------MLDDKRVSISQLGQNLTQVSRQYGG-------------PDPVSDQ
A0A355DPN1      AIPIALNKE----PTYQSSMQLLIEP-----YVQQKQEGKPQTEEQFTDS-NVEVDYATQ
A0A0V7ZMP6      AVANIALLP----RVWISKSLLILPTSTSNVDADLDNSDDLKTKEVGFSQ-Q-VNPLNVI
A0A254WHZ5      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTSALNFKD---VSPLDVQ
A0A433W046      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
K9TU02          TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
A0A2T1FMA8      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
A0A2P8QV10      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
B8HQ70          TALIAAFYP----RTWQASARFVVPINTNQLSADIGTLGQLRPGDGVVPS-DLMNPVTLQ
A0A2S6V636      TLYSVIYTKTNVAPVWKATAKLNLPQPTTRLDTNLGTLGQIQNTALGFTR-E-LNPLQIQ
A0A1D9G3S3      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGDSKLAT-K-SHPLNMQ
A0A1D8TWE6      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGDSKLAT-K-SHPLNMQ
A0A1U7N3U5      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGDSKLAT-K-SHPLNMQ
A0A1U7JBN8      SLAGFTLWHLSRPPAYSGSASLLV-EPVTAVNTPGLETVTGAPSP-SGSGL----DYTSQ
A0A2W4VXF4      SFGGLTLWHLTRPPVYNGSANLLV-EPVTVVNTPGLEAVMELPGARSASGL----DYTSQ
A0A2W7AI98      SFGGLTLWHLTRPPVYNGSANLLV-EPVTVVNTPGLEAVMELPGARSASGL----DYTSQ
A0A0A2B4S6      ---------------------MLISDPLNNNKNNSANSIGGVFEQLALNST--DNDLPTL
L8M1L4          ------IPKLLSTPQYRSEAKILLKSPQNQ-----QSAEVQLNALNSRRNYYNLKDLSTD
A0A2W6ZN45      LLAANALRQRIVAPVYIGGFQMLITDPLANVGPS-TPSSGVVESL-AKTTSLGNSDVPTL
A0A081GP61      ALAINTLRQRIFSPVYQGGFQMQISNPFED--KNGGGGGGSVEAI-ARTPL--KPDVPSL
K9P6R9          VLAINTLRQRIFSPVYQGGFQMQISNPFDNPGSGGGGGGGSVETI-ARSEI--KTDVPSL
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A2N6M0S2      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      IVLMRSPLLLGPVAQRQGV----------PLRALESNLSIN---------QESAR-----
K9SGV8          MQIMRSKEVIQRALEIVERPISYG--------EFLGSFGVN---------VIP-------
B0CA08          ILTMKSPRRLSMLALAIESQGLFS---RPSVEQIKSGLDIS---------QFD-------
B0BZC6          EELVRSKSVLTKAIVLFNQSNQDSAIEKVTLGEVKPEVATE---------VIP-------
A0A1D8TTM0      SSIMTSNDTISQVWEFDPEKSLYP-----RLSGYKSLFDVS---------PEG-------
A0A0V7ZGW0      TSIITSDDAIRPVLLSDPEKDKFR-----SLSSYKKLFKVK---------PTD-------
X5JJE9          AELAKSQPVLERAIAIAMPKSNKL-----TMDALTATLDEGLKVK-----TIP-------
A0A355DPN1      LNLMRSSQLIQKAVDRLHPKYPEI-----QVTDIKESFSLTGVQEEDTDIKDT-------
A0A0V7ZMP6      SSIATSDNVLKKVWEQDPQKTSYK-----QLSEYRGLFDVS---------PEN-------
A0A254WHZ5      LAILTSDAVMERVRVIDPEKSLYS-----KASSFSQLFVVT---------PQP-------
A0A433W046      LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQP-------
K9TU02          LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQP-------
A0A2T1FMA8      LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQP-------
A0A2P8QV10      LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQP-------
B8HQ70          AEIVKSPTLIGQVLAVDPERDQ-H-----TLQSFMPLFEAK---------PQS-------
A0A2S6V636      MAILMSDTVMERTLAVDPEKSLFP-----RLSDYKLAFSAT---------PQE-------
A0A1D9G3S3      ASILTSDALMRRLLESDPEKTDFQ-----RLVQYKKLFAVS---------PDQ-------
A0A1D8TWE6      ASILTSDALMSRLLESDLEKTDFQ-----RLVQYKKLFAIS---------PDQ-------
A0A1U7N3U5      ASILNSDALMRRLLESDPEKTDFQ-----RLVQYKKLFAVS---------PDQ-------
A0A1U7JBN8      IRVLRGPAVINPILAKIQQRYPDI-----TYNSLLNGLNIV---------QEG-------
A0A2W4VXF4      IRVLRGPDVIKPILVNIQRQHPEI-----TYTTLLNDLVIS---------QEG-------
A0A2W7AI98      IRVLRGPDVIKPILVNIQRQHPEI-----TYTTLLNDLVIS---------QEG-------
A0A0A2B4S6      IELLKSPILLNPISKD-----YGI-----PFNKFSKSLKIS---------TPGGLRTQSM
L8M1L4          ILVLKSYSLINKAIEKYPETFSGL-----SAAEVRTKLNIF---------PA---MINDI
A0A2W6ZN45      IQLLTSPVVLKPIAEA-----QAI-----PLGSLIGSLAIG---------ST---RAD--
A0A081GP61      IVLMRSPLLLGPVAQR-----QGV-----PLDLLAANLSIN---------PE---SAA--
K9P6R9          IVLMRSPLLLGPVAQR-----QGV-----SLGALESNLSIN---------QE---SAQ--
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A2N6M0S2      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      VDNVLNVSLRWPDPAKGKAILRQLAK-DYTSFSLTQRQAAVNSGVRFLDEQAPAIEERVQ
K9SGV8          GTDVLRFSYTSGDPKLAVEAANSMMQ-SYAENNIERNRAAVRAARLFIEEQLPKAEQDVE
B0CA08          ETNVVQIRFKSYNREFPKNIVNLLMQ-QYVDNTPKSKQASTQSAISFIEKQLPQVKQRVN
B0BZC6          GTQIIEITFRHTDPGVTSSLLNLIASSVIQENAETIRSEARATR-QFLENQIPRRQQELV
A0A1D8TTM0      ESTIISLSAEGSTPELARQRTAALIE-AFQQRLNELRLDDAVQRSQFMRKELEQAAENLR
A0A0V7ZGW0      QSTNIQLQVTASEPELAKQRAKRLIE-SYQERLNELRQGTANAREQFTQRQLKDAERNLQ
X5JJE9          TTNILELTYAHENADLAAKMLNAVSQAMLEENIKNIKSEAKKVKEFLEKTEVPRARERLR
A0A355DPN1      QTKIVKVVYTSNDPIKTQDVLAAIQT-VYQDYNLQQQQVRLTEGLAFINDQLPTARDNVI
A0A0V7ZMP6      DSTVISLSVEGSTPKLATERAQNLIA-SLKERLQELRQDRVISQSEFIQDEVRQAHRKLM
A0A254WHZ5      ATTLIEVEAQGSRPDLAYKRLFTFLE-VYQQRLNELRRKDAEVRVQYTQEELEQARLNLN
A0A433W046      ATTLIEVEAQGSRPDIAYKRLFTFLE-VYQQRLNELRRKDAEVRVQYTQEELEQARLNLN
K9TU02          ATTLIEVEAQGSRPDIAYKRLFTFLE-VYQQRLNELRRKDAEVRVQYTQEELEQARLNLN
A0A2T1FMA8      ATTLIEVEAQGSRPDIAYKRLFTFLE-VYQQRLNELRRKDAEVRVQYTQEELEQARLNLN
A0A2P8QV10      ATTLIEVEAQGSRPDLAYKRLFTFLE-VYQQRLNELRRKDAEVRVQYTQEELEQARLNLN
B8HQ70          LSPLMTVEVKGTTPELAHQRLSTWIK-LYQKRLTYLRENDASTRQTLPQQELQEASNNLR
A0A2S6V636      QSTIINLQVKASSPDIAQRRLSNLIN-IYQLRLNELRHQDTNVRKQFSQTDLEEAQAQLA
A0A1D9G3S3      ESTTIWLNASGDSPELARDRVKALIS-AYQERLNELRQADGTTRVEFNKKALERAKQKLD
A0A1D8TWE6      ESTTIWLNARGDSPELARDRVKALIS-AYQDRLNELRQADGSTRVEFNKKALERAKQKLD
A0A1U7N3U5      ESTTIWLNATGDSPKLARDRVKALIS-AYQERLNELRQADGTTRVEFNKKALERAKQKLD
A0A1U7JBN8      ESKVLRISYSNADPAVAAFVLNQVVE-GFVNYSVQDRQGDLRRGLTFLDEQLQEKWQEVA
A0A2W4VXF4      ESKVLRISYSDADPEVVTTVMSEVVK-GFVAYSVQDRQGELRRGLEFLDEQLQEKWQEVD
A0A2W7AI98      ESKVLRISYRDADPEVVTTVMSEVVE-GFVAYSVQDRQGELRRGLEFLDEQLQEKWQEVD
A0A0A2B4S6      AQGVLRISFKGENPRIVNSMLVSISK-AYLKSALDQKQQRLSDGLIFLNNQSPKLEGKNK
L8M1L4          PTDILNISFVDSAPEVAQGVLDALSE-VYVEYSLERERSQALNAIQFIEEQLPKAEEELN
A0A2W6ZN45      SQGVLNIQLRWSDPVQGRKILTALAD-SYPKYALIQRQEKLGQGLEFLGQQAPALQQRVN
A0A081GP61      VENVLNISLRWPDPVKGKAILRQLAK-DYTAFSLTQRQAAVNSGVRFLDQQAPAIEARVQ
K9P6R9          VENVLNVSLSWPDPAKGKAILRQLAK-DYTAFSLTQRQAAVNSGVRFLDEQAPAIEERVQ
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      --------------------------------------------------------KQLQ
A0A2N6M0S2      -------------------------------------------------KKVPEARKQLQ
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      KLSQEMLKFRERNNFVDPAA-AAGQILGAREGLVNQLRTLQNEQVQLDSQLKSIQTGKLQ
K9SGV8          NAEQQLRAFREQYNFVSASA-EAEATIDRFRSTESRIEDMQVSLAKIDAQSDQLGNLVAD
B0CA08          SAETALRKFKETYQIADLEI-AKSANATNLSQLQTALDEIDRELVEVQTQQLSL-QNMLK
B0BZC6          KVESSISQFKQQYNIVSLEETDNKRLTQSIAEAEKVAEEISANLRQVQARGLALSKVIDQ
A0A1D8TTM0      QTQAALVAFKASSNLVSAED-QTREMVTAINTLTTEQAQVLAQAQASKAQVETL-SARLE
A0A0V7ZGW0      LVKSKLAQFKKSTGFVSDEE-QTKNLVTAINTLRTTQTDVLAQAKATATRSQEL-SRTLG
X5JJE9          LAEAAENRYRQRSGIVSFDE-QSRSLVESLSTLEQEERTLVSQLQEVESREASLRQITQA
A0A355DPN1      QAEKALEQFRETQNLIDPVQ-QATTITDALSTVEQEQQAIRAQYQETQARYRVL-QQQLE
A0A0V7ZMP6      DAQKKLNKFKEAGNVISDEH-DAKQKVITINALNKSRVEALAEAKAAQAQTRIL-SARLS
A0A254WHZ5      QAQANLSNFQRSTGLVDSPE-QSKGLISAINNLKTTQATLIAQGQANATQAQAA-AVSLG
A0A433W046      QAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQAA-AVSLG
K9TU02          QAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQAA-AVSLG
A0A2T1FMA8      QAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQAA-AVSLG
A0A2P8QV10      QAQANLSNFQRSTGLVDSPE-QSKGLISAINNLKTTQATLIAQGQANATQAQAA-AVSLG
B8HQ70          RTQTQLSVFRQANNITDINE-QIRGLVNSISDLKTEYARALAQAQASNAQQQAL-SQHLR
A0A2S6V636      KAQAELASFQQATGLTEVAE-QTRALIAQQRELRTTYTNVLSQAQANQAQAQAA-SERLG
A0A1D9G3S3      QSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQASQHQLQIL-STRLG
A0A1D8TWE6      QSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQIL-STRLG
A0A1U7N3U5      QSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQIL-STRLG
A0A1U7JBN8      AIEGDLSEFQKRYDLVDVNA-TSESVTQRLNQMLADQEQLRVELSALAPLYENLRE---Q
A0A2W4VXF4      TIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTSLGPLYENLRS---Q
A0A2W7AI98      TIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTSLGPLYENLRS---Q
A0A0A2B4S6      QVQKELSDFRERNQLIEPTV-EGQELKTRLDYLENELDNIKNERVKLNNLLNSIENGSLT
L8M1L4          KAAFAIRSFRQKNNLVDPDE-YVGRVADFRQSLEEELKRGEIALDIAQTKYRTISNQLIE
A0A2W6ZN45      SLQRTLKQFRESNSFLEPLA-QGGSIISSRDGLLGQLRTLQVEQAELETQLASVRSGKLI
A0A081GP61      KLSNEMLRFRERNNFVDPAT-AAGQILGARDGLVNQLRDLQNEQVQLDSQLQSIQSGKLQ
K9P6R9          KLSQEMLKFRQRNNFVDPAT-AAGQILGAREGLVNQLRTLQNEQVQLDSQLKSIQTGKLQ
A0A328V843      ------QYFKQRNYVVDLGT-EFAISVQEMAQLNRNITTLEAELNAVQSLVNSLGNQVGL
A0A2N6LHT1      EAEQKENRYRQSSGIVSFDE-QTKSLVESLATLEEQENTLSAQLQELRSKEASLQQVTDA
A0A2N6M0S2      EAEQKENRYRQSSGIVSFDE-QTKSLVESLATLEEQENTLSAQLQELRSKEASLQQVTDA
A0A0D6KL48      ----------------------------------------------------------MK
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      F--TPSGAPTALEQLGRNS---------VLVPGRGDSAAEAASGTKTPLDLLNQFEQELA
K9SGV8          EIDSVEQALLRT-ALSQSP------------------------HTAGVMGELQQTKQAIA
B0CA08          V--NPQQAI-----LGIST------------------------AHKNISTSLEEIDKDLA
B0BZC6          S--SGKESYLSA-KAGQNP------------------------ELISLRDQLSNLESQLK
A0A1D8TTM0      L--NPQQAIRSL-SLGENQ------------------------DYQFFRQELSEVEALLT
A0A0V7ZGW0      M--APQQAINSL-RLSENK------------------------EYQALRQKLTEVNTEIA
X5JJE9          G--NVGNAYNNV-RTGQDE------------------------DLRKLRAELVEIEQKLI
A0A355DPN1      R--SPQEALTSS-RLSQSP------------------------RYQALLNELQKTELAIA
A0A0V7ZMP6      L--PPQTALKSL-QTKGTE------------------------TSLSIREKLSKVNISLQ
A0A254WHZ5      I--TPQQAMNSL-RLGENK------------------------EYQATRTQLSQLESTMA
A0A433W046      I--TPQQAMNSL-RLGENK------------------------EYQATRTQLSQLESTMA
K9TU02          I--TPQQAMNSL-RLGENK------------------------EYQATRTQLSQLESTMA
A0A2T1FMA8      I--TPQQAMNSL-RLGENK------------------------EYQATRTQLSQLESTMA
A0A2P8QV10      I--TPQQAMNSL-RLGENK------------------------EYQATRTQLSQLESTMA
B8HQ70          L--TPQAAMTTL-RLGENK------------------------EYQLVRDRLAQVEADLA
A0A2S6V636      I--NAQQAMNSL-RLGENR------------------------EYQAIRQKLSDAETALA
A0A1D9G3S3      L--TPKQAIRSL-GLAENR------------------------DYQFVRQQLTELEATLV
A0A1D8TWE6      L--TPKQAIRSL-GLAENR------------------------DYQFVRQQLTELEATLV
A0A1U7N3U5      L--TPKQAIRSL-GLAENR------------------------DYQFVRQQLTELEATLV
A0A1U7JBN8      VGFDPNTAIRVA-NLNESP------------------------TYQALLGDLREIEQTIA
A0A2W4VXF4      VGFEPSVAIGVA-NLNESP------------------------TYQGLLGDLREIEQTIA
A0A2W7AI98      VGFEPSVAIGVA-NLNESP------------------------TYQGLLGDLREIEQTIA
A0A0A2B4S6      AYGFKQAITTDL-NLNERI---------------PTEGVSFINLDLELLDQYILVKQKLA
L8M1L4          LGQDPETIVTTS-VLGQDG------------------------VYQSLASQLKDLETQYT
A0A2W6ZN45      TLPSPGS-SGSG-VVGQGSPAAGNPQLGLATRPRADSVAPSSNTVVTPQQQLSQLDQQIA
A0A081GP61      FSSSGAP-TAIQ-QLGRNS-------VLVPGRANQNQGAEVAKGTPTPLDLLNQFEQELA
K9P6R9          FTPSGAP-TALE-QLGRNS-------VLVPGRG--NSAAEASSGTKTPLDLLNQFEQELA
A0A328V843      N---LEEAIAVN-TLSQSP------------------------VVRAALQELENVEGELA
A0A2N6LHT1      K--ALNQAYAAV-RGGQDE------------------------ELKALRNKLAEIETQLV
A0A2N6M0S2      K--ALNQAYAAV-RGGQDE------------------------ELKALRNKLAEIETQLV
A0A0D6KL48      L--NTDTAVELT-TLSQSP------------------------GVQQVLTEYQKVQDELA
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      TAKGTFKENSPIVQSLLARRNQLLPVVQRQAADAV-------------------------
K9SGV8          TQLAIYREDSPQIAVLRDQERNLEQLLRQRAKQVA--------------GIPPSE---SI
B0CA08          EAKSNFREDHPAVLELLERQAQLKQLLSQKIEKFA--------------QSDAQL-----
B0BZC6          IRRESLTDDHPDIQKLITEKDAAQALYQQKLATIS--------------PRSRLN----S
A0A1D8TTM0      ETQAKFTNENPQVQALLEQREELQNQIEGYIFQAR--------------AAQPGV-----
A0A0V7ZGW0      VNRGTLTEEHPTVRALLQQRQKLLMALNRQLNAVV--------------PSAD-----GI
X5JJE9          VARNSFTEDHPDVIKLLQERDGVASLYQQRLGRIA--------------PGNQGT----P
A0A355DPN1      QQRVKFTDAEPRVEQLLEQRQRQLALLQEETQRVL--------------GETSTQIAFST
A0A0V7ZMP6      EAQTYLTDNHPRIENLKFQQEELRNELQED-RVSD--------------NSVSSV---AI
A0A254WHZ5      VTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI--------------PGANAA---QI
A0A433W046      VTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI--------------PGANAA---QI
K9TU02          VTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI--------------PGANAA---QI
A0A2T1FMA8      VTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI--------------PGANAA---QI
A0A2P8QV10      VTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI--------------PGARPA---QI
B8HQ70          TARGTLTDDNPRVQDLLEQRQKLTQLLDQNLRAAI--------------GNSSLA---GV
A0A2S6V636      EARSRYTDESPQVQSLLSQRQELMQLLNQQIAIAA--------------PGASAN---QI
A0A1D9G3S3      KAQATYTYAHPEIQNLLLQREQLQQQIQQYIFLA-----------------AGDT---LV
A0A1D8TWE6      KAQTTYTYAHPEIQNLLLQREQLQQQIQQYIFLA-----------------AGDT---LV
A0A1U7N3U5      KAQTTYTYAHPEIQNLLLQREELQQQIQQYIFLA-----------------AGDT---LV
A0A1U7JBN8      AESARFQADTPMIEALTDQRQQLLPLLEAEAQRLV----------------------GSA
A0A2W4VXF4      AESARFQSDTPMIEVLVDQRQQLLPLLEAEAGRLV----------------------GSA
A0A2W7AI98      AESARFQSDTPMIEVLVDQRQQLLPLLEAEAGRLV----------------------GSA
A0A0A2B4S6      IARTKYLEDSEIVKGLKYRVEQIEPTLKSNQISAL-------------------------
L8M1L4          LASVQFKDNYPMMQDLKLQREQLRNLLLERSTQILGEGISPAVLDKVLVSYTQTNIVAAG
A0A2W6ZN45      TARATFKSDSPQLQTLLAQRNRIKPLVQSQGIDQL-------------------------
A0A081GP61      TAKGTYKQNSPIVQSLLARRNQLLPVVQRQASDAV-------------------------
K9P6R9          TAKGTFKENSPIVQSLLARRNQLLPVVQRQAADAV-------------------------
A0A328V843      QEQRRFRDENPRIISLKGKRDNLENLLQREIQVYL---------------------GSSR
A0A2N6LHT1      QARLSLTDNHPTVINLLGQRNGLRALYQQGLARVS---------------------PRNQ
A0A2N6M0S2      QARLSLTDNHPTVINLLGQRNGLRALYQQGLARVS---------------------PRNQ
A0A0D6KL48      VARTRLTEDNPKIINLENQAVALKNQLEGRVAQTI---------------------GNSE
A0A2T1DKP1      VEQTRYRSGHPAIANLERKVDALNALLQERIGQVV---------------------SNGG
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------TKQVEELQRVFIFNRRRLDSLPRLEQQQLQ
A0A2T1CC83      ------------------------------VGALYNSQQDLI---KRAKVLPQLEQKDRE
A0A2T1EZA0      -----------------------KARLLANVAQQDEINRQILLLSENFRNNPQKLAEFEN
K9SGV8          DIDA-LFQIGGLQEQSVQQFYSLDNERVGLLEEISALNDVYSNYRERYRELPKLEQEERR
B0CA08          ------NFDSNQEDDLRSQLIQLDIRRNGLSKQQLKLRQQLSSYRQQARNLPQLEQRQNE
B0BZC6          DGTV-QVANEKVTQELSEKLVLSVVERNELRDKLANTRAYISKLDARRKQYPVLEKTLAS
A0A1D8TTM0      -----NATIGQESAALIRELILAESQTQAYYSQGKQIQTQIDQLGSILKTLPAAQARLVQ
A0A0V7ZGW0      DANFGGNNFKDATIELIAQLIQVESESKGLQQQVLIIQNKLERLQTELKNISTLQAQLLD
X5JJE9          SSNIAGDQISQ---ELTSQLVTTEVQRVALENRFRVVQNERANLQARLAQLPIKQQPLTQ
A0A355DPN1      QNLLTEGQLGSNDLTLSSQLAEAQTTLQALQARDRSLAITQQQLRAKLNRLPELMAEYER
A0A0V7ZMP6      NPNL-------ADRHIVHKLILAESQAEAMSSKAQQLQIQINYLREQLKKLPTKQGILMD
A0A254WHZ5      DTTL-GNGPNDSRLELMVELIRNQTLAQGAQQQAKQIQKQVDKLNTELNFITKNQAQLLD
A0A433W046      DTTL-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELSFITKNQAQLLD
K9TU02          DTTL-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELSFITKNQAQLLD
A0A2T1FMA8      DTTL-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELNFITKNQAQLLD
A0A2P8QV10      DTTL-GNGPNDSRLELMVELIRNQTLAQGAQQQAKQIQKQVDKLNTELNFITKNQAQLLD
B8HQ70          DRSLAGSAAGDSRIALIADLIRTQSTANGQQSQAQQLQQQLGQQVTALNRLSNKQVQLLE
A0A2S6V636      DPTLGGNGTRDSRIEMIAELIRAQNNAAGLQQQANQIASEINRVNAELNNIAQNRAQLIN
A0A1D9G3S3      DPTL--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQIKSTLTVIPVHQSRLLE
A0A1D8TWE6      DPTL--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQMKSTLTVIPVHQSRLLE
A0A1U7N3U5      DPTL--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQIKSTLTVIPVHQSRLLE
A0A1U7JBN8      VEAETLGYQGSVSQDLMQQLVNTANQMQVLQTQDQAIGQAVQLLRAEIQRLADLSRSYQQ
A0A2W4VXF4      VDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQLRAEIQRLADLSRSYQQ
A0A2W7AI98      VDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQLRAEIQRLADLSRSYQQ
A0A0A2B4S6      ---------------------ISAREIIDKNIQNAKI--KIKSLKEKFEKQPKLISEYKT
L8M1L4          DSGSQVSTSGSTLQQLAEQLLSTQTEYLSLQSQINQINQAKANVEADFQRLPQLQEIYTR
A0A2W6ZN45      -----------------------SSQLFANQAQQNELNRQILLLNKNFKQSPEEIRKYEE
A0A081GP61      -----------------------KARLLSNLAQQDEINRQILLLNQNFRNNPQKLSEFEN
K9P6R9          -----------------------KARLLANVAQQDEINRQILLLSENFRNNPQKLAEFEN
A0A328V843      PFSRGLLRVMDVKNNKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQE
A0A2N6LHT1      SISSGSVAGDQISQDLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTP
A0A2N6M0S2      SISSGSVAGDQISQDLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTP
A0A0D6KL48      YMPEQNLQIGNLKQTLTENLVKSEVERLALTNQVAELKQVLLVNKNRLDSLPRLEQQQLQ
A0A2T1DKP1      PVPTGNLQLGDLQQGLISDLVRSEAERVGLSERLSSLSNAQSAYRARANALPRLEETQRE
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      LQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVPELPVSPKIPLNLALGGFL
A0A2T1CC83      LVRQAESAGKTYETLLNNLQEATIAANSKSGNADVVEYAAVPDKGNSGRAVL-MGMGLIM
A0A2T1EZA0      INQRLSIAREQYSSYIQARERYRLEMARSISPWEVIGPPDFGSSPVEPNIQRNLLRAIMI
K9SGV8          LERKVTVAESTYAELLQQLQEVRIAEQQNIGNTRILSLASTPIDIVTPRRPRNVSLGLLL
B0CA08          LERTAKASASTYRNLLEQIQELKVTENQSPLTVSILESAT-DPEPSKTTFISAAMRGGLA
B0BZC6          LQRKKEGATESVNLLRQKLDEARIAEAQLVSNLRIIEEANKPTLPSYPNIPSFLVLGMMA
A0A1D8TTM0      LQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSVQVFEEPRADSKPSGPG-RRPIALGTIL
A0A0V7ZGW0      LQRQYDIAEGVYKGIVAQLEQSKIAAFNAYPNLQVLDQPTVDPKPTSPK-KSLIAIGGIL
X5JJE9          LTREREEAAESLKTLQRKLEEARIAEAQKVEKLRVIEKAKPPRLPTSPKPAVVLVLATVF
A0A355DPN1      LQPEVQIRRDTLQKLLEARQELGIEIARGGFKWQVVEPPKPGKQMGPDT-RRDLMLSVVV
A0A0V7ZMP6      LQRRYDMTKKIYNGLVTQAEKVRLSAFDTYPSFQLLDEPFVNNEASSPN-IQLIILGAVL
A0A254WHZ5      LQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPRPSIPN-LRLITTGGML
A0A433W046      LQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPRPSIPN-LRLITTGGIL
K9TU02          LQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPRPSIPN-LRLITTGGIL
A0A2T1FMA8      LQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPRPSIPN-LKLITTGGML
A0A2P8QV10      LQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPRPSIPN-LRLITTGGIL
B8HQ70          LQREYSIAEGVYKGVMAQFQQAKISTLSSYPSVQVLDGPLNSPRPE-PR-RMLIILGGLM
A0A2S6V636      LQRQYEIAEGVYKSILAQVEQTKTNPFNVYPNVQTLDAPAIDPKPEEPS-KRAIALGGIL
A0A1D9G3S3      LTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEKPAGPK-KLLIIANGFL
A0A1D8TWE6      LKRQYDVAAGVYNGLVAQIEQVNLDAFSAYPNVQVLDPPTVDEKPAGPK-KLLIIANGFL
A0A1U7N3U5      LKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEKPAGPK-KLLIIANGFL
A0A1U7JBN8      ISRELTVAETSLDQLLASRQDLRFQMARQASPWELISPLNETSIAQTSNLPRNLLLSTVL
A0A2W4VXF4      IDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSVTEMTNLPRKLLLSTVV
A0A2W7AI98      IDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSITEMTNLPRKLLLSTVV
A0A0A2B4S6      LQQKALLAAKNLEGLSSAKEKFQLEIAQRSVPWSIIAPPKVYPVPVSPDIPLNLSLSLIF
L8M1L4          LQRNIKIQSQAVDYLLQRKQELQIAAAEEITPWQILDKPYLPAQPISPNIQKALVSSLVA
A0A2W6ZN45      LQQKIEVAQANYLSYIQARENFRLEVAKQTVPWQVISPPVFGDVPIEPDLSREFLRALFI
A0A081GP61      INQRLSIAREQYSSYIQARERYRLEMARSITPWEVIGPPDFGASPVEPDIQRNLLRAIMI
K9P6R9          INQRLLIAREQYSSYIQARERYRLEMARSISPWEVIGPPDFGSSPVEPNIQRNLLRAIMI
A0A328V843      LERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVPDEGK-TAKVPLLALGVMG
A0A2N6LHT1      LTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPPTQPSLPNKRTVLAIAIVV
A0A2N6M0S2      LTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPPTQPSLPNKRTVLAIAIVF
A0A0D6KL48      LQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVADKSVSPIIPLNLALGGIL
A0A2T1DKP1      LERRLKAAQTTYEVLLSRLQEVQVAENQNIGNARALSSAIVSERSSNR--KMGLALGGGV
A0A355DU96      --------------------------------------ASIPEAPVSPKKKLILVGGIVA
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      GVLLGAGTALLLESMNQSLKNIEEANRLLGFPLLGTIPQHGEKNPKNPQ-----------
A0A2T1CC83      GAFLANLSVILLEMQDRSISSLAEIKKKFPYQTVGI-------TRLEPP-----------
A0A2T1EZA0      GLLAGLGAAILRERTDNVFHTPMEVEKDLQLPVLGLIPYLPL---EPGV-----------
K9SGV8          GLSAAGGAVFLLEAFDKKIKSTAAARELLGFPLLGVIPNFK----KVPLFPVASGNRIGR
B0CA08          GILLASGVVYVLERIDRKLKSKDEIRQVYPYRVLGEIPLFD----ESEA-----------
B0BZC6          AVALSAGVTLSAEGMDGRLRDLESIAENTNVPVLGVIPKQK----NSRL-----------
A0A1D8TTM0      ASVFGSAAIVLFLESRNPLLSLQDLQ-AISIPVLRSIPPFK----HLVL-----------
A0A0V7ZGW0      TSVFASLALILFSESRNPLLKQKDLQ-DIELPLLARIPIFK----SAPL-----------
X5JJE9          GAVLATGIILLLEITDNTLQDPLEAEELVKLPLLGVLPRLP----ESAL-----------
A0A355DPN1      GLFLGGLAAFGREALDDAVHSSEELKRQVALPLLGIIPELP----RTG------------
A0A0V7ZMP6      ISIFGSVAIILLQERRDPLISPKDIQ-QKNFPVLASVPYMK----GLDT-----------
A0A254WHZ5      AAIFGSMALIFFLENRNPLLKPKDLQ-QVELPVLGSIPHLK----QPSM-----------
A0A433W046      AAIFGSMALIFFLENRNPLLKPKDLQ-QVELPVLGSIPHLK----QPSM-----------
K9TU02          AAIFGSMALIFFLENRNPLLKPKDLQ-QVELPVLGSIPHLK----QPSM-----------
A0A2T1FMA8      AAIFGSMALIFFLENRNPLLKPKDLQ-QVELPVLGSIPHLK----QPSM-----------
A0A2P8QV10      AAIFGSMALIFFLENRNPLLKPKDLQ-QVELPVLGSIPHLK----QPSM-----------
B8HQ70          AIAFGSSALVLLLESRNPLLSPADIQ-KVKQPILAKLPRLK----APSQ-----------
A0A2S6V636      AGLFGSISLIFFLEKRNPMLRPKDLE-QVEFPVLGRISRLK----RADM-----------
A0A1D9G3S3      ASAVGSIALVLLLERRNPLLSPKDLQ-AIKFPMVVNIPHLR----HAGM-----------
A0A1D8TWE6      ASAVGSIALVLLLERRNPLLSPKDLQ-AIKFPMVVNIPHLR----HAGM-----------
A0A1U7N3U5      ASAVGSIALVLLLERRNPLLSPKDLK-AIKFPMVVNIPHLR----HAGM-----------
A0A1U7JBN8      SLMLGGVAALLRDRLDQAFHSVDDLVKATQLPNLAGVPNAPALQKQPLL-----------
A0A2W4VXF4      GLLLGGVAALVRDRADTAFHSADELVKATQLPNLALVPNAPALQKQPLL-----------
A0A2W7AI98      GLLLGGVAALVRDRADTAFHSADELVKATQLPNLALVPNAPALQKQPLL-----------
A0A0A2B4S6      GPVLGLIVGLIRDKVDHVYHSPDEVKENLNLPLLAELPYI-----ESFV-----------
L8M1L4          GGLWAIAIAFLLHQLDNRIKLVEEVKRITHLPLLGAVPQV-F---DPLI-----------
A0A2W6ZN45      GLAVGIAAVLLREKTDDAYHTPKEASQELGLPILGLIPYLPI---VSSD-----------
A0A081GP61      GLLAGLGAAILRERTDNVFHTPMEVEKELQLPVLGLIPYLPL---EPGV-----------
K9P6R9          GLLAGLGAAILRERTDNVFHTPMEVEKDLQLPVLGLIPYLPL---EPGV-----------
A0A328V843      GLVASTTLLLLMEMGDKSLRTVAETRDLFGYTLLGIIPSFA----APPFYRYLTGGDRSS
A0A2N6LHT1      GTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLP----GHAI--------ALE
A0A2N6M0S2      GTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLP----GHAI--------ALE
A0A0D6KL48      GIILGAGTALVLESIDNSLKTVEEAKRLLDYPLLGAIP--Q----AEKAKGSEGVGEVEL
A0A2T1DKP1      GILLAVAAAFAADLLDRSVKTLKEVKDLFGYTLLGVVPLLN----GKPVRQRSHFEGTAH
A0A355DU96      GSLLYIVTAFVLDLMDPSIKTAKEIRQLFKYTWLGMIPESRKKGLFWQQKINGNVPQLVV
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------MSFLPV
                                                                            

A0A1B7WWU1      ----------------------EGRQELPLLDDPYSPVSTSFEMLQTNLGFTVSDKE---
A0A2T1CC83      ----------------------MYQGKIVTRDEPDSFSSEVYRMIQANLKFLTNDKP---
A0A2T1EZA0      -DIATSISKMSSSERF--------------------AIKESLRSLFTTFRLLRADNN---
K9SGV8          TVPELV-VREAPNS----------------------PISEAFRMLQTNLKFLSLKKR---
B0CA08          -ESLKLPTLSDPAS----------------------HLSEAYRMLQSSLKFHGLEHS---
B0BZC6          -FPSLPFAELYNNL----------------------PLLESVRALSKNIEYKNSTES---
A0A1D8TTM0      -DVDPS-FGT-------------------------------------AIEFQRLASA---
A0A0V7ZGW0      -GLTME-SDA-------------------------------------QIPFQRLAST---
X5JJE9          -ILKPA-DQFLDRV----------------------GFVEPYRMLFKNLEFRSLEKL---
A0A355DPN1      ---GSG-LLV-------------------------------------HLPFRRTQVAAAS
A0A0V7ZMP6      -SMGEG-INE-------------------------------------KVEFQRLASA---
A0A254WHZ5      -ERNLA-AEI-------------------------------------DIEFQRLASS---
A0A433W046      -ERNLA-AEI-------------------------------------DIEFQRLASS---
K9TU02          -ERNLA-AEI-------------------------------------DIEFQRLASS---
A0A2T1FMA8      -ERNLA-AEI-------------------------------------DIEFQRLASS---
A0A2P8QV10      -ERNLA-AEI-------------------------------------DIEFQRLASS---
B8HQ70          -VWNLD-AEP-------------------------------------LLGFHRLASA---
A0A2S6V636      -ERNLS-GEV-------------------------------------AIELQRLASA---
A0A1D9G3S3      -GLELG-TET-------------------------------------DVEFQRLASV---
A0A1D8TWE6      -GLELG-TET-------------------------------------DVEFQRLASV---
A0A1U7N3U5      -GLELG-TET-------------------------------------DVEFQRLASV---
A0A1U7JBN8      -MVPNLSATMADVL--------TQNQSPHKLYTSF-SFAEAFYSLEANLRMLSSD-T---
A0A2W4VXF4      -MVPDLTATMADVL--------TQNQSPDNLYTSF-SFAEAFYSLDTNLRMLSSD-T---
A0A2W7AI98      -MVPDLTATMADVL--------TQNHSPDNLYTSF-SFAEAFYSLDTNLRMLSSD-T---
A0A0A2B4S6      -NLRENNESIFNVEDKLNATKNEKSSESYLGYQRF-FYQEAFRGMYTSIKFINTQ-N---
L8M1L4          -VIEDNTVKQSYSY-------------------RYSSFTESLRAIAMNISYTVVDTR---
A0A2W6ZN45      -SILKSLKELPGTE-------------------RF-AIKESLRSLFTTFRLLRAD-R---
A0A081GP61      -DIATSISKMSSSE-------------------RF-AIKESLRSLFTTFRLLRAD-N---
K9P6R9          -DIATSISKMSSSE-------------------RF-AIKESLRSLFTTFRLLRAD-N---
A0A328V843      V--QVPVVDT-----------------------PGSLISEIYRMIQANLKFLGSDRK---
A0A2N6LHT1      P--SAQFLDH-----------------------VG--LVEPYRTLFKNLEFRSSE-P---
A0A2N6M0S2      P--SAQFLDH-----------------------VG--LVEPYRTLFKNLEFRSSE-P---
A0A0D6KL48      P-----VLNN-----------------------PYSPVSSAFEMLQTNLSFSISDKM---
A0A2T1DKP1      PIPRVYVREL-----------------------PFSSAAEAYQMLQANLRFLRSDKE---
A0A355DU96      RDVPHG------------------------------ITSEAYRMLEANLKFLSPDQV---
A0A1Q8BLE0      ------------------------------------------------------MRA---
A0A2T2S1W0      RDAPRS------------------------------PLSESFRMLQANLRFSQADRR---
                                                                            

A0A1B7WWU1      -----------------------------LRVILVTSATPGEGKSFVAANLALAGAYVGK
A0A2T1CC83      -----------------------------PKVILVTSSVPEEGKSTVTANLAAAISQLGR
A0A2T1EZA0      -----------------------------IRMVGITSSTQGEGKSTAVAVFSRTLADLGL
K9SGV8          -----------------------------LKVIVVTSSVPREGKSTIAANLAATIAELGQ
B0CA08          -----------------------------PRVLMMTSAINQEGKSTTCANLAVSLAQMNH
B0BZC6          ------------------------------KVLVITSAISGEGKSFVATNLAVLSAMLSK
A0A1D8TTM0      ----------------------VSMKPLKNRRLMISSATSGEGKTTVTLGLASALITLGF
A0A0V7ZGW0      ----------------------ISLMSLENHRLMVTSSTAGEGKTTVTLGLAKALMVLGF
X5JJE9          ------------------------------RLIIVSSTISGEGKSVVASHLAATSAMLSR
A0A355DPN1      TLPMVYWLPFRESLDLIYKHIQLLNSAATLRSIVVTSALPSEGKSTFVVGLAFSAARLHQ
A0A0V7ZMP6      ----------------------ISLLHLENKSLMIASANSGEGKTTVTLGLANALLELGF
A0A254WHZ5      ----------------------ILML--EHPCLMVTSATAGEGKTTVTLGLALALVNFGF
A0A433W046      ----------------------ILML--EHPCLMVTSATAGEGKTTVTLGLALALVNFGF
K9TU02          ----------------------ILML--EHPCLMVTSATAGEGKTTVTLGLALALVNFGF
A0A2T1FMA8      ----------------------ILML--EHPCLMVTSATAGEGKTTVTLGLALALVNFGF
A0A2P8QV10      ----------------------ILML--EHPCLMVTSATAGEGKTTVTLGLALALVNFGF
B8HQ70          ----------------------ISFLDLATPRLMITSAMYGEGKTTIAIGLAAALARLGF
A0A2S6V636      ----------------------VLML--EHQRLLVTSSTSGEGKTTVTLGLALALVNFGF
A0A1D9G3S3      ----------------------ISLRSGEDRRILITSAMVSEGKTTVTLGLATALVDLGF
A0A1D8TWE6      ----------------------ISLRSGEDRRILITSAMVSEGKTTVTLGLATALVDLGF
A0A1U7N3U5      ----------------------ISLRSGEDRRILITSAMVSEGKTTVTLGLARALVDLGF
A0A1U7JBN8      ----------------------------PIQVVALTSSEPGEGKSTICAHLAIAAANMGR
A0A2W4VXF4      ----------------------------PMQVIALTSAVPGEGKSTICAHLAIAAANMGR
A0A2W7AI98      ----------------------------PMQVIALTSSVPGEGKSTICAHLAIAAANLGR
A0A0A2B4S6      ----------------------------SLKILSISSCIPSEGKSLISTMFAKTISELGL
L8M1L4          ----------------------------KIKSLVTTSSTSSEGKTTVTYNLALALTELDA
A0A2W6ZN45      ----------------------------EIRLVVITSSTQNEGKSTAASVFGNTLADLGL
A0A081GP61      ----------------------------NIRMVGITSSTQGEGKSTAVTVFASTLADLGL
K9P6R9          ----------------------------NIRMVGITSSTQGEGKSTAVAVFSRTLADLGL
A0A328V843      -----------------------------VRVIVVSSSVPQEGKSTVSANLAAAIAQLGH
A0A2N6LHT1      -----------------------------LRSIVVSSTITGEGKSVVGSHLAAISAMLSR
A0A2N6M0S2      -----------------------------LRSIVVSSTITGEGKSVVGSHLAAISAMLSR
A0A0D6KL48      -----------------------------LKVIAISSSIPGEGKSFVAANLAVAVAQLGR
A0A2T1DKP1      -----------------------------IKTVVVTSSVAQEGKSEVAANLAASMAQVGR
A0A355DU96      -----------------------------LKRIVVTSSVAQEGKSTVSANLAIAMAQVGR
A0A1Q8BLE0      -----------------------------VSRIVITSPGPEEGKSTTAANLAIAFAQQGH
A0A2T2S1W0      -----------------------------LQAIAVASSVPGEGKSTLVANLGLALAEVGQ
                                                :  :*    ***:     :.        

A0A1B7WWU1      RVLLVDADMRRPRQHRVWEIHNLLGLSNILAGQTQLKNAVQEVS---PLVKMLPAGKIPP
A0A2T1CC83      SVLLVDADLRRSSQHHLWGVDNQKGLKDIVVDNVSPLSVIRQPM---PKLSLLTSGMVES
A0A2T1EZA0      RVLVIDSDMRLPMQARYLGVEQGDGLSTLLSDSSRKPTDFIHSIA--ENMDVLPAGPKPP
K9SGV8          RVLLVDADMRHPAQHRIWQLPNENGLSDLLTGQSPLSEVAHHVM---PTLEVMPAGSKPA
B0CA08          RVLLIDADIRLASQHQIWELGNQEGLTHILLNKHFNYHQELPTHKVADNLEIITAGRISS
B0BZC6          RTLLIDADMRRPSIHKIFQLPQDPGLQDYLRGSVKEGLPAAIHRTSVKNLSVMTSGKFSY
A0A1D8TTM0      RVLVVDGDFRKAELSQRLGWDR----------YAMSEVPSTPVQIR-PGLDLLSL-RPDE
A0A0V7ZGW0      RVLMVDGDFRKAKLSRQFGHVM----------HPQSNDLPQPMQIS-PGLDILPTAPNQN
X5JJE9          RTLLIDADLRRPVQHNLFNMVPKTGIGDVLQGGMTLQEAVQPTSVE-NLF-ILPC-GELH
A0A355DPN1      RVLLIDADLRRPSLHKQLNLPNEQGLATLLVEDSSIPSPQRLSLSG-SEIDVLTAGPIPP
A0A0V7ZMP6      RILIVDADFRKCELTQSLGYY----------GQSIGDLQLRPINVF-ENVDLLAM-RVPE
A0A254WHZ5      RVLVIDGDLRKAEMSRRLGKNR--------LENPANASPPMPVSVS-PGFDLLPALSIPK
A0A433W046      RVLVIDGDLRKAEMSRRLGKNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPK
K9TU02          RVLVIDGDLRKAEMSRRLGKNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPK
A0A2T1FMA8      RVLVIDGDLRKAEMSRRLGKNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPK
A0A2P8QV10      RVLVIDGDLRKAEMSRRLGKNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPK
B8HQ70          KILLVDGDLRRARLTEQLSDRY---------QGSWNPRETAVVPLS-PGLDLMPAPAIPN
A0A2S6V636      RVLIVDGDLRQAELSQRLGQPQ---------K-KLKDGQPSPVSVC-LGLDLLPAPALSK
A0A1D9G3S3      RVLVVDGDFRQATLSQRLGHDH---------D-PLKPGQ--PVKIQ-PSLDLLPT-SHKK
A0A1D8TWE6      RVLVVDGDFRQATLSQRLGHHH---------D-PLKPGQ--PVKIQ-PSLDLLPT-SHKK
A0A1U7N3U5      RVLVVDGDFRQATLSQRLGHHH---------D-PLKPGQ--PVKIQ-PSLDLLPT-SHKK
A0A1U7JBN8      RVLLIDSDLRKPSQHLIFGHANRQGLSDLITQPLDDPMDLVQVIPGNPNLHLLTAGARPP
A0A2W4VXF4      RVLLIDGDLRKPSQHLIFSQRNHQGLSELITQGLENPTDLVLAIPGNPNLHLLTAGARPP
A0A2W7AI98      RVLLIDGDLRKPSQHLIFSQRNHQGLSELITQGLENPTDLVLTIPGNPNLHLLTAGARPP
A0A0A2B4S6      SVLLIDTDLRKPQVHARLGLDNLIGFSNLLIDSSDNYKKYIQSVPTQDNFDVITSGSIPP
L8M1L4          KVLVVDADLRKPKIHKMAKISNEQGLSEVISDNKHSWTEVVQNVT--GNLDVITAGANVA
A0A2W6ZN45      HVLLVDADMRLPVQHKHFAVDNVKGLSDYLGDTDDNIQDYIKPIT--SNLSLITAGSRAP
A0A081GP61      KVLIIDSDMRLPMQTRYLGVEPGDGFSTLLSDSSRKTTDLIQTIA--ENMDVLPAGPKPP
K9P6R9          KVLVIDSDMRLPMQARYLGVEQGDGLSTLLSDSTRKPTDFIHSIA--ENMDVLPAGPKPP
A0A328V843      RVILIDGDMRQPIQHHIWGLTNAVGLSDVLVEEATLSEAV-KPGI--DQLDILTAGVTPP
A0A2N6LHT1      RTLLIDADLRRPILHTLFNLAPRPGITDVIDSERSLEETVQRTNI--PNLSVLTCGELYR
A0A2N6M0S2      RTLLIDADLRRPILHTLFNLAPRPGITDVIDSERSLEETVQRTNI--PNLSVLTCGELYR
A0A0D6KL48      RVLLVDADMRRPRQHKIWEQNNLVGLSNILVGQTELQTTS-KEAL--MTLDIITAGTIPP
A0A2T1DKP1      RVLLVDADMRYPVQHHVWDLVSTIGLSNVIVEQFVPDVAI-QEVA--PNLYALPSGIIPP
A0A355DU96      RVLLVDADMRHPMQHHIWDLANTVGLSEVIVHQTQFEFAVREVM---DNLDVLPSGVIPP
A0A1Q8BLE0      RVLLVDCDLRRTRIHKIFDETNLPGLTSVLVGGETIASAIRQTRV--PGLNILPSGPLPP
A0A2T2S1W0      HVLIVDADLRNPSQHGIWEYANAVGLSNLLVGESSLEQACHPAS---EGLDLLTAGQVPP
                  :::* *:*                                       .  :.      

A0A1B7WWU1      NPV-TLLDSQCMADLVEEASK--DYDFVIIDTPPLT-AVTDPLIVGKYVDGLLLVVRPGK
A0A2T1CC83      NPL-AILDSPKMSDFIGRSRR--EYDLILIDVPPLP-VTADVLTVSKLVDGILFVTRPGI
A0A2T1EZA0      DPA-KLLNSSRCKEIMEEIRALPGYDIIIVDAPPCL-MLADPILLGEKLDGILFLVGLGK
K9SGV8          NPVALLNSQATSNL---IDYGSSNYDVMIVDTPPMA-VAADASILGKIADGIVMLCRVGV
B0CA08          NPLP-MLESEQFANFVQVQIEH--YDYILIDAPPLV-SVADPLIIGKVVDGILLVARPGH
B0BZC6          DNVFSFETQRAKELFTEVQQH---YDVIVIDTPPVM-ACSDALVLSQEGRQTVVVARLDV
A0A1D8TTM0      DKIAEFVARGSFEECLSAAQGSGHYDYILIDSAPVS-LTSEAALMASVVPNVLLVVWLGK
A0A0V7ZGW0      NKVMEFVARGGFEKYLNTIQTNGNYDYVIVDTAPVT-STSETALMAKVIANVLPVIRLGI
X5JJE9          GRPSQMLESEAMQALL--IEAQSLYNCVILDTSPLS-DCADAATLGQHSDGLVMVTRPSF
A0A355DPN1      DPV-KLLSSQRMRQLMAGFEQS--YDLILVDTPPIL-GMVDALQAASFCNGVVIVGRISR
A0A0V7ZMP6      ERIAEFVARGGFEQRLNAIKNSAQYDYILVDSPPVA-LTSEAAIIGKIIHNILFVVRTGI
A0A254WHZ5      QKIPEFFARGSFERNIKAMRDSGGYDYVLIDSPPVG-LASETNLMSAVVCNILFVLRSGT
A0A433W046      QKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGT
K9TU02          QKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGT
A0A2T1FMA8      QKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGT
A0A2P8QV10      QKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGT
B8HQ70          DRIVNYVAKGGFEQQLQTLQQSGEYDYVLVDTAPIT-LTSETGLMTTSVNNLLFVVRPGT
A0A2S6V636      GKIPEFFARGSFQQYLDQIQADGGYDYVLVDSPPIG-LASETNLMSSVVRNVLFVVRSGK
A0A1D9G3S3      GKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRNLLFVVRPEI
A0A1D8TWE6      GKIVELVTQGKFEHSLATAEASGDYDYVLIDSAPVS-MTSETALMAAVIPNLLFVVRPEI
A0A1U7N3U5      GKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRNLLFVVRPEI
A0A1U7JBN8      APG-RLLSSRKMQQIAEQYRC--HFDLIILDTPPLAGGMVDAKLAAAHADGLLLVARLNR
A0A2W4VXF4      PPG-RLLSSRKMQQITEQYRR--HYDLIIFDTPPLA-GMIDAKLTAAHADGLLLVVRLNQ
A0A2W7AI98      PPG-RLLSSRKMQQITEQYRR--HYDLIIFDTPPLA-GMIDAKLTAAHADGLLLVVRLNR
A0A0A2B4S6      DPT-RLLGSDSMKKFIETIRSENKYDYVILDTSPIL-SISDSTLIAQYCDSLLMVVSLNN
L8M1L4          NPI-ALLRSQIMSELLKEWEA--AYDYVLIDTPPIG-AMADAQSLVHQVDGVMLVTGINK
A0A2W6ZN45      DPA-RLLNSLRCSDMVQHLRALPGYDLIIFDTPPCL-LLSDPVILGEKVDGILYLVGLGR
A0A081GP61      DPA-KLLNSSRCKEIMDEIRALPGYDIIIVDAPPCL-MLADPILLGEKLDGILFLVGLGK
K9P6R9          DPA-KLLNSSRCKEIMEEIRALPGYDIIIVDAPPCL-MLADPILLGEKLDGILFLVGLGK
A0A328V843      NPL-ALLDSRRMTSLIRNFSE--EYDFVIIDTPPLL-LAADALTLANMASGVLMVARPRI
A0A2N6LHT1      LPS-HLLESEAMKSLLIEAVR--QYEFVVIDTPPLS-ACADAHTLGRQSDGIILVTRPGF
A0A2N6M0S2      LPS-HLLESEAMKSLLIEAVR--QYEFVVIDTPPLS-ACADAHTLGRQSDGILLVTRPGF
A0A0D6KL48      NPA-ALLNSQRIATFIKEATQ--EYDFVIIDCPPLT-LVADALMLSKLVDGILLVVRPGV
A0A2T1DKP1      NPI-ALLDSKRMASLVEGFAR--DYDLIIFDTPPLA-GKADAAILGKMTDGILLVVRPGI
A0A355DU96      NSL-ALLNSKRMASLVEYFSQ--KYDFVIFDTPPLV-LTADAMTLGKMTDGILLVARPKV
A0A1Q8BLE0      NPA-ELLGSAQMTALLDKLSE--NYDLLILDTPPLL-AASDAAIVSRIVDGALVVVRAGR
A0A2T2S1W0      NPV-ALLDSQRLATLLQQWRQ--AYDYVLLDVPPLQ-AATDAVIVGKLTDGTLLVVRPGV
                                        :: ::.* .*      :           : :     

A0A1B7WWU1      VEYSAVNAAKSLL-TQAKLPILGMVVNGIVKE--------SGY----GGYYYSSGYYGGK
A0A2T1CC83      VEHESAELAQEAL-ATTGQKILGMVVNGVKANEFDRYSYHGRY----GKKYFEKGNVQYE
A0A2T1EZA0      VSRELAPQASRRI-RASGVDVLGIICNQVNFPSRL------------NDYGYEYGYYYHY
K9SGV8          ADTNNLTFSKELL-EQSGQNILGMVVNASLPED--------------DPYGYYYSYYYNY
B0CA08          LEREYAQKAHELL-IHSNLSVLGTVINGILNKN--------------ELYSYYSRY----
B0BZC6          TPKQVLNRSIDIL-NSNNVNVVGLAINGVTAST--------------DKY-YR--Y----
A0A1D8TTM0      SNRNPFRDTLEQL-MRHRAQILGLVVNGVDTQP--------------EG--YL--Y----
A0A0V7ZGW0      SDRYMVQETIEQL-MRHNANIIGLALNGIEQRS--------------EG--YI--Y----
X5JJE9          TIKEVLQRTVSEL-NKNRIPVLGIAVNGITGFS--------------ERY-YRYPV----
A0A355DPN1      VTQSELTEAIAML-SHLNA--IGIVANGANGST--------------NR--YIAYA----
A0A0V7ZMP6      SSRNCFHDSVEQL-KRYRAEVIGLTVNDVDSHN--------------EK--YIYSY----
A0A254WHZ5      SDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT--------------SV--YRYGY----
A0A433W046      SDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT--------------SV--YRYGY----
K9TU02          SDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT--------------SV--YRYGY----
A0A2T1FMA8      SDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT--------------SV--YRYGY----
A0A2P8QV10      SDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT--------------SV--YRYGY----
B8HQ70          SSRYSVLDSFEEL-SLRKVNVVGVTINGIETNS--------------EE--YY--Y----
A0A2S6V636      SDRYAVMDGFEQL-AQHHAQIMGLVVNYVEPKD--------------VG--YR--Y----
A0A1D9G3S3      SKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS--------------KP--YL--Y----
A0A1D8TWE6      SKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS--------------KP--YL--Y----
A0A1U7N3U5      SKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS--------------KP--YL--Y----
A0A1U7JBN8      SERTEIQRVLADLGNTVQAPLLGLVVNGVPHSRQ-------------SGYDYYYGYYGRP
A0A2W4VXF4      SERSEIQRVLADLGNTAQAPLLGLVINGVPQSRQ-------------RGYS-YYGYYGRP
A0A2W7AI98      SERSEIQRVLADLGNTAQAPLLGLVINGVPQIRQ-------------RGYS-YYGYYGRP
A0A0A2B4S6      VDMDLPLLAKNKL-KKTNRPLIGFVSNQIKKPKTFSKNRYYGYSNYSNNYGYNSNYISYY
L8M1L4          VNQKAIVNTLEVL-QSSNCNLIGFIANMVE---KD------------LDY-YSYSYYSHY
A0A2W6ZN45      VGREIAPQAIKRI-KATGVDILGLMCNQVAYPTRL------------NDYGYEYGYHYNY
A0A081GP61      VSRELAPQASRRI-KATGVDVLGIICNQVNFPSRL------------NDYGYEYGYYYHY
K9P6R9          VSRELAPQASRRI-RASGVDVLGIICNQVNFPSRL------------NDYGYEYGYYYHY
A0A328V843      LDRDSAKAAKEIL-GRSGQRILGTVINGISKNE--------------STK------YFYH
A0A2N6LHT1      TIKEVLQRAVSEL-THNQIPIMGVVVNGITDQT--------------ERY------YRYA
A0A2N6M0S2      TIKEVLQRAVSEL-THNQIPIMGVVVNGITDQT--------------ERY------YRYA
A0A0D6KL48      ANTGSVNATKMLL-EQSGHQVLGMVANGVTPES--------------SYGGYYAKSYYGA
A0A2T1DKP1      IDSASANAAKEFL-KQSGQNVLGMVINGVDVRS--------------EPDSYF---YHTR
A0A355DU96      VDRVSATASKEFL-LRSGQQVLGLVINGVSVEG--------------EPDSYFHHAKAYY
A0A1Q8BLE0      TERSALQTAVQQL-ATVGARVLGTVLN--DPDA--------------EVPKYARYYGYYY
A0A2T2S1W0      AECDAVEASRDTL-ARLQQPVVGMVANGVNPRN--------------ERSSYYHYYNYGN
                            :        :*   *                                 

A0A1B7WWU1      GERN------------KQNAEASVR-----------------------------------
A0A2T1CC83      SQNNLNGSQNLSNMPEGNNANSSVSRAKL-------------------------------
A0A2T1EZA0      AYASASGYAKSASEPST-GGFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFRED
K9SGV8          SSKPGQRQRQEASRQDQDQNQQETINQ---------------------------------
B0CA08          ------------------GHNSNQEKTAIKRNLLKQVISK--------------------
B0BZC6          ------------------LKEDYALAA---------------------------------
A0A1D8TTM0      ------------------GHKIAEVSS---------------------------------
A0A0V7ZGW0      ------------------KHDSSQVNS---------------------------------
X5JJE9          ------------------KGYQPVLEKPVKRLVGSTAVESRTEISE--------------
A0A355DPN1      ------------------EQNGSPLFQLN-------------------------------
A0A0V7ZMP6      ------------------NVNQQIQ-----------------------------------
A0A254WHZ5      ------------------GRQRELLENEA-------------------------------
A0A433W046      ------------------GRQRELLEHEA-------------------------------
K9TU02          ------------------GRQRELLEHEA-------------------------------
A0A2T1FMA8      ------------------GRQRELLEHEA-------------------------------
A0A2P8QV10      ------------------GRQRELLEHEA-------------------------------
B8HQ70          ------------------GKQRELAATEL-------------------------------
A0A2S6V636      ------------------GRQRELIETEA-------------------------------
A0A1D9G3S3      ------------------RSSDSLVKS---------------------------------
A0A1D8TWE6      ------------------RSSDSLVKS---------------------------------
A0A1U7N3U5      ------------------RSSDSLVKS---------------------------------
A0A1U7JBN8      RVAAGIED-G--------------------------------------------------
A0A2W4VXF4      AVASGIDERG--------------------------------------------------
A0A2W7AI98      VVASGIDERG--------------------------------------------------
A0A0A2B4S6      ADNK-----------------------IRDKFTKRNLTFE--------------------
L8M1L4          YNQPSNG-----------------------------------------------------
A0A2W6ZN45      SYAG-----------------------YRDTYSQRLASKDVAEALPDN------------
A0A081GP61      AYASASGYAKSANQGKSYGGFGSYVQRYRDSYMKGAPSNAYFNAHQQNGDLDVRSYYQQE
K9P6R9          AYASASGYAKSASE-PSTGGFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFRED
A0A328V843      AQRYFPLQKSHRRDRSAPPKISSRSSS---------------------------------
A0A2N6LHT1      VNSYEPL---------SSRRLSRGSSA---------------------------------
A0A2N6M0S2      VNSYEPL---------SSRRLSRGSSA---------------------------------
A0A0D6KL48      KQSHKN--------GKVDASISKIRIL---------------------------------
A0A2T1DKP1      ERGKRNVAALDTITDSIPTEVER-------------------------------------
A0A355DU96      KE------ELITSTIPDSKTKKNHIRF---------------------------------
A0A1Q8BLE0      NN-------YYDYSNATEYSNGNGAKA---------------------------------
A0A2T2S1W0      NNGGPPRQGWRRWLPGNPFARNGKGSQ---------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      EDQATAPVATNGGIGPSASSTSPLPPADSVPSRRHRPSREGGGGPMGWLRRRFGNRG---
K9SGV8          ------------------------------------------------------------
B0CA08          ------------------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
X5JJE9          ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A254WHZ5      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A1U7JBN8      ------------------------------------------------------------
A0A2W4VXF4      ------------------------------------------------------------
A0A2W7AI98      ------------------------------------------------------------
A0A0A2B4S6      --------------------------------NSKDNFLISKIKKFRNKVLDFISWLDR-
L8M1L4          ------------NGNGNGNGNGNGNGNGNGNGNREAGSMNSIMQ-----------QFRRR
A0A2W6ZN45      -----------PSDQAQSSAASGSAAKPDSNQSGSSGGLNRLKG-----------WFRR-
A0A081GP61      DGSGASAATRPPSEDSKGSGVSIRSSLPDSGRESTGSHAGDSQGVRKGASQGPIGWLRQR
K9P6R9          EDQASVPVA---TNGGIGPSAGSSSSLPPAESVPSRRHRPSREG-----GDGPMGWLRRR
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A2N6M0S2      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      -------
A0A2T1CC83      -------
A0A2T1EZA0      -------
K9SGV8          -------
B0CA08          -------
B0BZC6          -------
A0A1D8TTM0      -------
A0A0V7ZGW0      -------
X5JJE9          -------
A0A355DPN1      -------
A0A0V7ZMP6      -------
A0A254WHZ5      -------
A0A433W046      -------
K9TU02          -------
A0A2T1FMA8      -------
A0A2P8QV10      -------
B8HQ70          -------
A0A2S6V636      -------
A0A1D9G3S3      -------
A0A1D8TWE6      -------
A0A1U7N3U5      -------
A0A1U7JBN8      -------
A0A2W4VXF4      -------
A0A2W7AI98      -------
A0A0A2B4S6      -------
L8M1L4          -------
A0A2W6ZN45      -------
A0A081GP61      FGRGSQR
K9P6R9          FGNRG--
A0A328V843      -------
A0A2N6LHT1      -------
A0A2N6M0S2      -------
A0A0D6KL48      -------
A0A2T1DKP1      -------
A0A355DU96      -------
A0A1Q8BLE0      -------
A0A2T2S1W0      -------
                       

© 1998-2019