BYKdb

Dataset for cluster tadcd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

379 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K9SLA9          --------------------------------------------------------MNKL
A0A168TT23      -------------------MSNYGIHDGRHLKPIEDQNTALAQYDPYQSKANEDDDAIDL
A0A0M1JWX9      --------------------MQTAPNSQPSSFDQNGKQPQIVPLSYLAEVPDADEEELDL
A0A2T1M1V6      -----------------------------------------------------------M
A0A2G7GCS2      -----------------------------------------------------------M
K9XBH8          -----------------------------------------------------------M
A0A1Z4LJ30      -----------------------------------------------------------M
K9RI76          -----------------------------------------------------------M
A0A352AE27      ----------------------------------------------------------ML
A0A3B8JH60      -----------------------------------------------------------M
A0A3C0N766      -----------------------------------------------------------M
K9W9J7          -----------------------------------------------------------M
A0A139WSU3      -----------------------------------------------------------M
A0A433VN22      ------------------------------------------------------------
Q7NF11          ------------------------------------------------------------
A0A1Z4JCS8      -----------------------------------------------------------M
F4XTX2          -----------------------------------------------------------M
Q7NJN6          -----------------------------------------------------------M
U5QCC3          ------------------------------------------------------------
A0A0S3TYD7      ----------------------------------------MKQPQNPSQTPASDAIELDL
U5QL42          -------------------------------------------MVNPQASLGPPSDNFNL
K9QF04          ----------------------------------MTQNVENLTLFKPQALPKPQSDPWEL
A0A3C0N2P0      --------------------MGPDGDYQPLLPNGNGKQLSQLSTLNAAEFSVLNEDKFDL
K9TLQ0          ------------------MDIDGNSPPFFQQLNGPFPSGQTPLPSTILPPLNDDADALNL
A0A076HBF2      ----------------MSNLVAAPGQSPDFDARNVQTVRVHEVGT---NEPIGTEDEIDL
A0A354B169      ------------------------------------------------MGAMGVAEEIDL
G4FMX5          ----------------MSNLSAQP--NPQAVDGLLQ---------------VDGSDEIDL
Q0IDT5          ----------------MSNLIARPGQSPDLVPQTIQDVQVRDLGLNLSNLKAEASDEIDL
A0A2D6FCW3      ----------------MSNLIVNPXQTPDFNRHQAQTVNVQDLGRXVVQA-ADNNDEIDX
A3ZA21          ----------------MSNLIPRAGHSPNLAVQGIQTVQVRDLGTSVAAGPAAADDEIDL
A0A140K3H3      ------------------------------------MNNQLVNPNSLYLPTPETESAFSL
K9XUB8          ------------------------------------MNNQLVNSNTLYLPTPETESTFSL
Q7NEU3          ------------------------------------MTKQPFADPVDKPAQVVEESSFDW
A0A352XE00      --------------------MNLNGDGKVLSINGNAQQSLEVPGINSKNVADIPNHQVDM
B4VS56          --------------------MGSNGEYQPLPPNRNGHLPSELSSLSLYELVETEDDKLDL
A0A352AAQ3      --------------------MALTGDYQPLLPTSNGKQLSELMPIYTNGFSEIQEDKLDL
A0A350Y472      --------------------MGPKVDYQPLLVNANDKPSSVSPPIYPSGFSLVEEEKLDL
A0A355DVB4      --------------------MGPKVDYQPLLVNANDKPSSVSPPIYPSGFSLVEEEKLDL
A0A2P8VVX1      -------------------------------------------MVSTSTLPTSTDQEFGY
A0A2P8WHY0      -------------------------------------------MTHAAYQPIPDEPEFGY
A0A2T1CMT9      --------------------------------------------MDQNNWETETQGDLGY
A0A1D8TX52      --------------------------------------------MKELDLNAAAETDAGY
A0A1U7N5X9      --------------------------------------------MKELDLNAAAETDAGY
A0A1D9G4T2      --------------------------------------------MKELDLNAAGETDAGY
F4XP71          --------------------------------------------MKELDLNAAGETDAGY
A0A2P8QVH5      ----------------------------------MADTSLDNERLSVEHRVENRANATDL
A0A2T1FT70      ----------------------------------MADTSLDNERLSVEHRVENRANATDL
A0A433W4W4      ----------------------------------MADTSLDNERLSVEHRVENRANATDL
K9U5W1          ----------------------------------MADTSLDNERLSVEHRVENRANATDL
A0A254WLA7      ----------------------------------MADTSLDNERLSVEHRVENRANATDL
A0A2W6ZAV2      ------------MPDPLPSPDELLPPGTLVTLGASSGQVVLIPQEAETQPAPGGSEELKL
A0A2G7GMH8      --------------------------------------------MNKDNFAMATEQEAGY
K9W742          --------------------------------------------MTQSNLNTVPDTDPGY
K9SA61          ---------------------------MALVPHTPGNFAPHRSPVTDPRWTDSGDSDGGY
A0A350Y7Z1      -------------------------------------------MIQSNLP--GDETNLGY
A0A352X2A7      -------------------------------------------MTQSNLP--ETESDFGY
K9XPB0          ---------------------------------------------MKQIEWEENSSDLGY
A0A0D8ZYV0      ----------------------------------------MVRGIENN-PNVANETEPGY
A0A3D1PBA3      ----------------------------------------MARVNEHNLPINT-ETDGGY
A0A254WJ87      ----------------------------------------MVRVNESNMPMTVEESDGGY
A0A2T1FP73      ----------------------------------------MVRVNESNMPMTVEESDGGY
A0A433VMS2      ----------------------------------------MVRVNESNMPMTVEESDGGY
K9TYA7          ----------------------------------------MVRVNESNMPMTVEESDGGY
A0A2P8QUE1      ----------------------------------------MVRVNESNMPMTVEESDGGY
A0A2T1DWE8      -----------------------------------------MVVVTVGNLANTVETDPGY
A0A1U7I8L3      --------------------------------------MVNVNTNNLNPAA---ETEAGY
A0A2T1DJL8      MPSVASQKASFSSRSIASFRRFVWHRSDELSFAKGVPIVAESHLNLIAAA----DPDPGY
A0A1Z4J9W0      --------------------------------------MAQSNITLFNASPHAQEPDPGY
A0A0N7Z5K9      --------------------------------------MAQGNITLFNPSPPAQEPDPGY
A0A0S3TXC5      ------------------------------------MIVAQGNITLFNPSSPMQEPDPGY
A0A2T1DNG3      ------------------------------------------MTAAQPKLNLSAATDPGY
A0A2P8W9H0      -----------------------------------MASELQLSSKGALHPEGDQEGGLRL
A0A3S0Y9N9      --------------------------------------------------------MEEY
A0A433UNK7      --------------------------------------------------------MEEY
B8HNB0          ----------------------------------MVQFNAERWLQNQQLLNELYFSASDK
A0A1Z4LN32      ------------------------------------------------MENQNLSEEIDV
A0A2I8A9F5      ------------------------------------------------METQNSAEDIDI
A0A218Q6R8      ------------------------------------------------METKNYPDEIDI
A0A0C1XVC4      ------------------------------------------------METKNYPEEIDV
A0A218QGE0      ------------------------------------------------MDTKNYPEEIDV
A0A3B8Y8H9      ----------------------MTDLPNNSLAVNSPQPQVNQTIQSQLREQNEEDISLSV
A0A1Z3HMQ0      ---------------------------------------------MDGKTYQDYVEEIDL
A0A1E5QP61      ------------------------------------------------MDSTDYTEGIDF
A0A3M2GIL5      ------------------------------------------------MENQIYTEDIDF
A0A433NM31      ------------------------------------------------MQSNKQEEYIDL
A0A3M1PML8      ----------------------------------------------MSLVSQDYSEEIDF
A0A352X442      ------------------------------------------------MESTEYIEEIDF
A0A0T7BPZ0      ------------------------------------------------MSNPEHIEEIDL
A0A0M0SHU3      ----------------------------------------------MKESEFKEVEEIDF
A0A1D2PBN3      ------------------------------------------------MESKPNFEEIDF
A0A0C2LVR7      ------------------------------------------------MESKPNFEEIDF
A0A1Z4PQB9      ------------------------------------------------MESKPNFEEIDF
A0A1Z4SFN6      ------------------------------------------------MESKQNLEEVDF
K9PGI8          ------------------------------------------------MESIPKFEEIDF
A0A2W1JVB9      ----------------------------------------------MPAEYQLEEEVIDL
A0A3M1SVZ4      -------------------------------------------------MESGGESTIQL
K9SSQ0          ---------------------------------------------------MKVYSSKVF
A0A2W1JIN9      -------------------------------------------------------MDQSL
A0A318AJV1      ----------------------------------MLKQTSDHRVSHLAPPQDQARLGDAV
A0A254WHG9      -------------------------------------------------------MEQKY
A0A2P8QIL5      -------------------------------------------------------MEQKY
A0A2T1FLY5      -------------------------------------------------------MEQKY
A0A433W447      -------------------------------------------------------MEQKY
K9U1K8          -------------------------------------------------------MEQKY
A0A1U7N2U4      -------------------------------------------------------METSL
A0A1D9G1F2      -------------------------------------------------------MDTSL
F4XV38          -------------------------------------------------------MDTSL
K9UYB2          -------------------------------------------------------MEKSI
A0A0C1XJI7      -------------------------------------------------------MEKGI
A0A218QN17      -------------------------------------------------------MEKGI
K9RKN2          -------------------------------------------------------MEKGI
A0A2I8ADV2      -------------------------------------------------------MGRGI
A0A1W5CKM3      -------------------------------------------------------MGKGI
Q3MEW0          -------------------------------------------------------MGKGI
A0A1Z4KIC7      -------------------------------------------------------MGKGI
Q8YSM5          -------------------------------------------------------MGKGI
A0A1Q4S1H4      -------------------------------------------------------MEKGV
A0A433VBU6      -------------------------------------------------------MEKGV
A0A1Q4RZJ6      -------------------------------------------------------MEKGF
A0A1Z4SNV3      -------------------------------------------------------MEKGF
A0A2H2XJQ1      -------------------------------------------------------MEKGF
A0A3S5K358      -------------------------------------------------------MEKGF
A0A0T7BPJ4      -------------------------------------------------------MAKGI
A0A0C1QS61      -------------------------------------------------------MEKSV
A0A139X3R8      -------------------------------------------------------MEKSV
A0A1Z4I7C5      -------------------------------------------------------MGKGI
A0A0C2MDK7      -------------------------------------------------------MEKGI
A0A1Y0RCK1      -------------------------------------------------------MEKRI
A0A1Z4PWZ0      -------------------------------------------------------MEKGI
A0A0C2QLT0      -------------------------------------------------------MEKGI
A0A1Z4J2K1      -------------------------------------------------------MEKGI
A0A3S0ZSX0      -------------------------------------------------------MEKGF
A0A2N6K4T3      -------------------------------------------------------MEKGL
A0A370CKT2      -------------------------------------------------------MEKGL
A0A0S3TL97      -------------------------------------------------------MEKGL
A0A2N6M8A0      -------------------------------------------------------MEKGL
A0A2N6M9E1      -------------------------------------------------------MEKGL
A0A2N6KJI4      -------------------------------------------------------MEKGL
A0A2N6MZ77      -------------------------------------------------------MEKGL
A0A2N6KT20      -------------------------------------------------------MEKGL
G6FSN3          -------------------------------------------------------MEKGL
A0A0D6YL98      -------------------------------------------------------MEKGL
A0A328I8B9      ------------------------------------------------------------
A0A0M0SU69      -------------------------------------------------------MEKGL
A0A1Z4TIZ8      -------------------------------------------------------MEKGL
A0A318BG22      --------------------MIRSLTNDTRPGPIDDLQSRRGAMRPAAEVEQWDGGSISL
A0A2T1E9V8      ---------------------------------------------------MEAPENIQF
A0A0P1C0L3      ---------------------------------MQPSIADRGNYPDTPADYREDGLHIDL
A0A3M2GQQ6      -----------------------------------------MQNAIAINPIQDYKNDTDF
K9SGJ5          -------------------------------------------MPEYSLNPGQPEESIDL
L8MYT6          ----------------------------------------MTAYPKATYVGKYVDDSFKL
A0A352JGJ6      ----------------------------------------MTEYPKATYAGKYVDDSFKL
A0A1J5GLS2      ----------------------------------------MTEYPKANYVGKYVDDSFKL
A0A2W4W6M5      ----------------------------------------MSEYPKAISTGKYVDDSFKL
A0A2W7AN33      ----------------------------------------MPAYPKATYVGKYVDNSFKF
A0A256BLV2      ----------------------------------------MTEYPKATYVGKYVDDSFKL
A0A2W6ZXF3      ----------------------------------------MTEYPKANYVGRYVDDSFKL
A0A2Z5WX66      ----------------------------------------MTEYPKANYAGKYIDDSFKL
K9W1T3          --------------------------------------------------------MDEF
A0A0D6YBN8      -----------------------MNMVSPALGSGAPEPVYNEPQQKMVNASPVGESIPGI
A0A318BJ18      -----------------------MSFISSNLGS----PGAIGSAQSAIASPTIADGPSVL
A0A1Q4RTR1      -----------------------------------------------MSALNTENDSINF
A0A1Z4SQV2      ------------------------------------------------MQVNAENDSINF
A0A2H2XGN1      ------------------------------------------------MQVNAENDSINF
A0A433UXH8      ------------------------------------------------MAVNTENDSINF
A0A1Z4RMB9      -------------------------------MLSNNSNEQNTNSAYPSIAPKRDSLDVNF
D5A466          --------------------------------------------MDFSNIEHRESIDLDL
K1XF69          ------------------------------------------MVMDFSNIEHRESIDLDL
B5W297          --------------------------------------------MDFSNIEHRESIDLDL
H1W7M8          ------------------------------------------MVMDFSNIEHRESIDLDL
B4WP72          ------------------------------------------------MRDKEYTEEIDL
A0A318B4H2      -------------------MNTNLTYEEAPFDPSAASVVTPVAVDKPAGQRLDERAVSAL
B4WQE3          ------------------------------------MSSANPPVLRDIIQEPDQEGGLRL
A0A2K3BR24      -----------------------------------------------MPTTTDQEDYIDL
K9YXY1          ---------------------------------MDHQEQLPASSVNPIPTTTDQEDYIDL
A0A2P8W4F7      ------------MPFPPSSTPRETNGHSNGHGNGHGSGRPEFVPMMAPPSLVEKGDDVDL
U5QJM6          ------------------------------------------------------------
A0A1U7HGH0      ----------------------------------------------------MEVTELDL
K9XJD3          ----------------------------------------------------MEVTELDL
K9SX01          ------------------------------------------------MNQSPAEDKNPL
A0A1E5QIR9      ------------------------------------------------MTHLEDSDAIDL
A0A1Z4IBC7      ----------------------------------------------MTMESLRSIEEVDI
A0A1W5CPC7      ----------------------------------------------MTMDSLQGFEEVDI
Q3MDC6          ----------------------------------------------MTMDSLQGFEEVDI
A0A1Z4KM73      ----------------------------------------------MTMDSLQGFEEVDI
Q8YNX7          ----------------------------------------------MTMDSLQGFEEVDI
A0A367R4K6      ----------------------------------------------MTMESLPNVEEVNI
A0A1E2WSV8      ----------------------------------------------MTMESLPNFEEVNI
A0A2R5FRT9      ----------------------------------------------MTMESLPHVEEVNI
A0A2K8T1B6      ----------------------------------------------MTMESLPQFEEVNI
A0A235I9I0      ----------------------------------------------MTMESLPNFEEVNI
A0A2D0HQT8      ----------------------------------------------MTMESLPNFEEVNI
A0A2L2NU95      ----------------------------------------------MTMESLPSFEEVNI
A0A367S084      ----------------------------------------------MTMESLPNFEEVNI
A0A0V7ZFJ4      -----------------------------------------MTHNSFDFNQEDDD-FIDL
A0A0V7ZNJ9      ------------------------------------------MTSSPQVEREDTD-YIDL
A0A367RIS1      ----------------------------------------------MPSHQDDQD-LINF
A0A235IXQ2      ----------------------------------------------MLSDQNNQD-LINF
A0A1W5CNX3      ----------------------------------------------MPSHQDDQD-LINF
Q3MEB7          ----------------------------------------------MPSHQDDQD-LINF
A0A1Z4KHN9      ----------------------------------------------MPSQQDDQD-LINF
Q8YT70          ----------------------------------------------MPSQQDDQD-LINF
A0A218Q4C1      ----------------------------------------------MPSYQEDQD-EINL
A0A166IWU6      ----------------------------------------------MPSYQEDQD-EIDL
A0A2S0Q8C0      ----------------------------------------------MPSYQEDQD-EIDL
W6FSX4          ----------------------------------------------MPSYQEDQD-EIDL
A0A1B7WTD1      ----------------------------------------------MSINQEDQD-SIDI
A0A1B7WX82      ----------------------------------------------MSINQEDQDSSIDI
A0A0R0M9H9      ----------------------------------------------MAINQEETD-VIDL
A0A1S1ZVW2      ----------------------------------------------MPINQETTD-VIDL
A0A1Z4LRU5      ------------------------------------------MTNEMQVNQEEQD-YIDL
A0A1Z4JVB4      ----------------------------------------------MPTKQEDRD-SIDF
K9PIA4          ----------------------------------------------MPTKQEDRD-TIDL
A0A1Z4M597      ----------------------------------------------MPTKQEERE-VIDV
A0A1Z4MWT1      ----------------------------------------------MPTKQEERE-VIDV
A0A1Z4TX53      ----------------------------------------------MPTKQEERE-VIDV
A0A1Z4HVE1      ----------------------------------------------MPTKQEERE-VIDV
A0A252ECZ1      ----------------------------------------------MPTKRDDRD-LIDF
A0A1Z4G5Y1      ----------------------------------------------MPTKRDDRD-LIDF
A0A252DNA2      ----------------------------------------------MPTKRDDRD-LIDF
A0A252E1Q4      ----------------------------------------------MPTKRDDRD-LIDF
A0A2A2TNQ5      ----------------------------------------------MPSHEEDTDY-INL
A0A3S1C4K5      ----------------------------------------------MPSNQEDQNE-VDF
A0A1X4G3D5      -------------------------------------------MPINQVNQEESDV-IDL
D4TNI2          -------------------------------------------MPINQVNQEESDV-IDL
A0A1Z4H6Z8      -----------------MNVIGAIILFVGTEGSDSPNYIWYFGTLFMPTKQDDRDL-IDF
A0A1Z4NPM1      ----------------------------------------------MASEYEEQDY-IDI
A0A3F3KPR9      -----------------------------MLIFCVMVEPVIATGVYMPINKKETDV-IDL
D4TGN7          -----------------------------MLIFCVMVEPVIATGVYMPINKKETDV-IDL
A0A1Z4UZW9      ----------------------------------------------MSINQEDQDSSIDI
A0A0K2M5H0      ----------------------------------------------MSINQEDQDSPIDI
A0A1B7VSH4      ----------------------------------------------MSINQETQDSSVDI
A0A1B7W126      ----------------------------------------------MSINQETQDSSVDI
A0A3D4C6Q6      ----------------------------------------------MSINQETQDSSVDI
K7W0A4          ----------------------------------------------MSINQEDQDSSFDI
A0A1B7UTR1      ----------------------------------------------MSINQEDQDSSLDI
A0A1B7UVJ4      ----------------------------------------------MSINQEDQDSSIDI
A0A2T1CIL7      --------------------------------------------MIPTIVPSTHEEQIDF
A0A1Z4RPC6      --------------------------MTNLQTTNSLSSN------------HREELDINI
A0A2T1CMZ0      --------------------------MTNLQRNNVYNPN------------RRAEFDINI
L8M4F7          ---------------------------MFKIPNNNSAYSSQTEGEANASINSRDSIDLDI
L8LZE9          -----------------------------MYPVNNSSSNGSYTQGNYPE--SKEKFEVEI
A0A140K2P2      --------------------------MTNNYPANNSNNY-NYPSETLSA--SREAIDVNI
K9XWX4          --------------------------MTNNYPANNSNNY-NYPSEVSSA--SREAIDVNI
A0A140KB14      -------------------MSNFTGMSNGQTPENLSLNN-SY-----TA--SRESIDVNL
K9XX88          -------------------MSNFTGMSNGQTPENLSLNN-SY-----TA--SRENIDVNL
A0A433V7A0      ----------------------------------------MKYPKHTTTIDSREPEEIDF
A0A0C2LBE2      ---------------------------------------------MSAMEPVPNSEEIDF
A0A433NN38      ---------------------------------------------MDSIKHTHSLEEIDF
A0A2N6K0T2      -----------------------------------------------MKESEFHVEEIDF
A0A2N6ML72      -----------------------------------------------MKESEFHVEEIDF
G6FQZ6          -----------------------------------------------MKESEFHVEEIDF
A0A2N6MQX9      -----------------------------------------------MKESEFHVEEIDF
A0A2N6KXT6      -----------------------------------------------MKESEFHVEEIDF
A0A2N6KGB9      -----------------------------------------------MKESEFHVEEIDF
A0A2N6L3Y5      -----------------------------------------------MKESEFHVEEIDF
A0A0S3TIS7      -----------------------------------------------MKESEFHVEEIDF
A0A1U7GW28      -----------------------------------------------MKESEFHVEEIDF
A0A2N6LW63      -----------------------------------------------MKESEFHVEEIDF
A0A1Z4TQ63      -----------------------------------------------MKESEYQLEEIDV
A0A0D6YFE2      -----------------------------------------------MKESEFKVEEIDF
A0A328IH74      -----------------------------------------------MKESEFKVEEIDF
A0A1Z4NDS1      ---------------------------------------------MDSVTSTTNVEEIDL
K9F4D9          ---------------------------------------------MASQDNSVKEIEIDL
U9VXM0          ---------------------------------------------MASQENSVKEVEIDL
A0A2T1FTR8      --------------------------------------------------------MDEI
K9UA41          --------------------------------------------------------MDEI
A0A1Z4SMD6      -------------------------------------------------MNQGFIEEIDV
A0A2H2Y096      -------------------------------------------------MNQGFIEEIDV
K9S8M8          -----------------------------------------------MEFQHYPEE-IDF
A0A1Z4NFV0      -----------------------------------------------MENPSYLEE-IDV
B0CAX4          ----------------------------------------------MPMSNEYSHESIDV
U5DPF5          -------------------------------------------MEAIDRNLRQDDDFLDL
A0A350Y0P6      -----------------------------------------------MESKQYVED-IDF
A0A352X940      -----------------------------------------------MESKQYVED-IDF
B8HTN4          -------------------------------------------------MQALEDDRIDL
A0A2A2TPF8      -----------------------------------------------MEKQSNS-DDLDL
A0A1Z4R0P8      -----------------------------------------------MEKQSYP-DELDL
A0A0T7BUI3      -----------------------------------------------MEKQKAL-EELDI
A0A1Z4LP32      -----------------------------------------------MQNKKNN-QEVDI
K9REP9          -----------------------------------------------MKNKNNA-QEIDI
A0A1Z4SIJ3      -----------------------------------------------MENEGYPLQEAEI
A0A2H2XPG4      -----------------------------------------------MENEGYPLQEAEI
K9V3C7          --------------------------------------MLINQEKPDMKPQHYT-EEIDL
A0A1Z4T6Y7      ----------------------------------------------MEQQNNRS-EDIDI
A0A2H2Y561      ----------------------------------------------MEQQNNRS-EDIDI
A0A1Q4S362      ----------------------------------------------MEQQHNRS-EDIDI
A0A3S1CIN8      ----------------------------------------------MEQQHNRS-EDIDI
A0A2A2TC28      -----------------------------------------------METKGYL-EEIDI
A0A0C1NCB0      ----------------------------------------------MEETKGHQ-EEIDI
A0A2N6K7Q9      -----------------------------------------------METNSYT-QEAEI
A0A2N6MXH6      -----------------------------------------------METNSYT-QATEI
A0A2N6M5A8      -----------------------------------------------MENNSYT-QATEI
A0A2N6LL61      -----------------------------------------------METNSYT-QATEI
A0A0S3TP66      -----------------------------------------------METNSYT-QATEI
G6FP91          -----------------------------------------------MENNSYT-QATEI
A0A1U7GYR5      -----------------------------------------------METNSYT-QATEI
A0A2N6KY52      -----------------------------------------------METNSYT-QATEI
A0A2N6KMP5      -----------------------------------------------METNSYT-QATEI
A0A2N6MA45      -----------------------------------------------METNSYT-QATEI
A0A1Z4TLC8      -----------------------------------------------METNSYT-QETEI
A0A0M0SFT2      -----------------------------------------------METNNYT-QETEI
A0A0D6Y7R4      -----------------------------------------------METNSYT-QETEI
A0A328IGA1      -----------------------------------------------METNSYT-QETEI
A0A0C2LFH0      -----------------------------------------------METRGYQ-EEVEI
A0A1Z4IYV4      -----------------------------------------------METKGYQ-EEVDI
A0A1Z4Q0T6      -----------------------------------------------METKGYQ-EEIDI
A0A0C2PT44      -----------------------------------------------METKGYQ-EEIDI
A0A1D2P6J4      -----------------------------------------------METKGYQ-EEVDI
A0A3M9ZEU1      -----------------------------------------------MHPKDHLEE-VDL
A0A1Z4JK72      ------------------------------------------MTSMKMETKQYSED-FDL
A0A0N7Z489      ------------------------------------------MTSMNIETKRYSED-FDL
A0A0S3TXS2      ------------------------------------------MTSMNIETKRYSED-FDL
A0A1Z4RN12      -----------------------------------------------MDSNLHLEEYIDF
A0A2T1CMF9      -----------------------------------------------MDSNLPIGEHIDF
Q7NDC5          ---------------------------------------------------------MGL
U5QGK3          ---------------------------------------------------------MGL
A0A2W4UY24      ------------------------------------------------MPQKELE--IDF
A0A254WLE3      ------------------------------------------MQERLIETSESLD--LDF
A0A433W533      ------------------------------------------MQERLIETSENLD--LDF
A0A2P8QWJ3      ------------------------------------------MQERLIETSENLD--LDF
A0A2T1FKP8      ------------------------------------------MQEQLIETSENLD--LDF
K9U6L7          ------------------------------------------MQEQLIETSENLD--LDF
A0A2T1GMT4      -----------------------------------------------MESQESID--LNL
K9UI51          -----------------------------------------------MESQESID--LNL
K9TYI2          -----------------------------------------------MESRESID--LNL
A0A254W5G5      -----------------------------------------------MESRESID--LDL
A0A2T1FXY4      -----------------------------------------------MESRESID--LDL
A0A1Z4QL41      -----------------------------------------------MESREAVD--LDF
A0A252D4T4      -----------------------------------------------MESRESID--FDL
A0A252DJH5      -----------------------------------------------MESRESID--FDL
A0A252EB80      -----------------------------------------------MESRESID--FDL
A0A1Z4HPW5      -----------------------------------------------MESRESID--FDF
A0A1Z4MSN1      -----------------------------------------------MESRESID--FDL
A0A1Z4U1C2      -----------------------------------------------MESRESID--FDL
A0A0D6KV51      ------------------------------------------------------------
A0A1Z4MKF8      -----------------------------------------------MESRESID--FDL
A0A2C6WC43      -----------------------------------------------MESRETLD--LDL
A0A1Z4L5A1      -----------------------------------------------MESRETID--LDL
A0A367QD86      -----------------------------------------------MESRETID--LDL
A0A235IZ96      -----------------------------------------------MESRESID--LDL
A0A2L2NGP0      -----------------------------------------------MESRESID--LDL
A0A2K8SM78      ------------------------------------------------------------
A0A2R5FPC0      -----------------------------------------------MESRESID--LDL
K9QM62          ------------------------------------MKAKTLEVDSTIKSREAID--LDF
A0A1Z4FWI3      -----------------------------------------------MESRESID--LDF
A0A1Z4JYE7      -----------------------------------------------MESRESID--LDL
A0A140KBA0      -----------------------------------------------MESNLYIDEYLDF
K9XSG1          -----------------------------------------------MESNLYTDEYLNF
A0A0F5YE28      -----------------------------------------------MEDRESID--LDI
U7QEH7          -----------------------------------------------MEDRESID--LDI
A0A3S1ATK5      ------------------------------------------MSKTPMESREDID--LDL
A0A2Z6CPH0      ------------------------------------------MAKNIMESRESLD--LDF
A0A1Z4GT50      -----------------------------------------------MESRESID--LDL
A0A1Z4GIX0      ------------------------------------------MSKNSMESRETID--LDI
A0A2H6LC24      ------------------------------------------MSKNSMESRETID--LDI
B2J6N5          ------------------------------------------MSAKSTESRESID--LDL
A0A367RMI4      ------------------------------------------MSEKSMESRESID--LDL
A0A235HUM0      ------------------------------------------MSEKSMESRESID--LDL
A0A2L2NW47      ------------------------------------------MSEKSMESRESID--LDL
A0A1E2WUR1      ------------------------------------------MSEKSMESRESID--LDL
A0A235IKU3      ------------------------------------------MSEKSMESRESID--LDL
F4XKF3          -------------------MAGLVANSHQYQKLFYCAIYLGGAPEELMESRSSID--LDL
A0A1D9FX10      -----------------------------------------------MESRSSID--LDL
A0A1D8TNX9      -----------------------------------------------MESRSSID--LDI
A0A1U7MYU6      -----------------------------------------------MESRSSID--LDI
A0A3C0NJ41      -----------------------------------------------MESRESLD--LDF
A0A352AG88      -----------------------------------------------MDSAESLD--LDL
A0A350Y374      -----------------------------------------------MQSTDSPD--LDF
A0A355DPX0      -----------------------------------------------MQSTDSPD--LDF
A0A0D8ZUV2      --------------------------------------------------MEFID--ADI
A0A433VDI0      ----------------------------------------MEPTKPIVEYSESIN--IDF
A0A3D1PG43      -----------------------------------------------MESREAID--INL
A0A2P8QQ72      -------------------------------------------MESRVESREAVD--INL
K9TZQ7          -------------------------------------------MESRVESREAVD--INL
A0A2G7GPR0      -----------------------------------------------MESNETID--IDL
K9XH68          -----------------------------------------------MESNETID--IDP
A0A1U7HW70      -----------------------------------------------MQSNDTID--IDL
A0A2S6VEJ8      -----------------------------------------------MESNETID--IDL
                                                                            

K9SLA9          NRGWV------ALRQHKFPALV--AFGIIFGGAALVTV--RIQ---PIYEAKGQVL----
A0A168TT23      LEIWRT-----ILKRKWVVVSILAVFIATAALSSWLTI--------PVYRATAVVQ--IN
A0A0M1JWX9      GQLFA------VIRRRAFVILG--VAIAVTGAVWVWTD--NQT---PQYEGKFQLL--VE
A0A2T1M1V6      NHALS------VVRRHWPPLLALNLLLIAATVYVITNIEKFVS---PTWKANAQLN--IP
A0A2G7GCS2      NHIVN------IIRRHWMPLLLLNGVILAGTLYAVIYTKTNVA---PVWKASAKLN--LP
K9XBH8          NHIVN------IIRRHWMPLLLLNGVVLAATLYAVIYSKTSVP---PVWKANAELN--LP
A0A1Z4LJ30      NRIAK------IAIRHWKLLLAWNILILGITAINIKVA----P---RVWSSQAQLI--LP
K9RI76          SRIAT------IAIRHWKLLLAWNILLIGITAINIKLT----P---RVWEGKAQLI--LP
A0A352AE27      ARIAT------ITARHWKFLLALNVLVLAAAASNYVTS----P---KVWTAKAQLI--LP
A0A3B8JH60      GKIAA------IASRHWKSLLVLNLLVLAATAGKLATS----P---KVWTANAQLI--LP
A0A3C0N766      GKIAA------IASRHWKSLLVLNLLVLAATAGKLATS----P---KVWTANAQLI--LP
K9W9J7          GKVAA------IATRHWKSLFILNLLVIAATAGKLATS----P---KVWTATAQLI--LP
A0A139WSU3      NKLVT------ISTKHWKSLIAFNVLVVLATAVAVSNA----K---PVWIAKTQLI--LP
A0A433VN22      ---MT------IAARHWKSLLVLNALVVSATIAAYSTS----K---PVWTTTAQLI--LP
Q7NF11          MHVIQ------VLKRHWRPLLVLNGLVLAATIGVACYY----P---RTWTATTRII--LP
A0A1Z4JCS8      KKIAL------IASRHWKALLGLNAVVIFGTLGAMLTT----P---KVWTAQAQLI--LP
F4XTX2          KKVVA------ILNRHWILLLVFNSLVLAASFGAFSLL----K---PFWIAKAQLI--LP
Q7NJN6          SSIVA------IGRRHWRPLLALNTVLLAATVGIAVFY----P---RTWTASAQLI--LP
U5QCC3          MSTLA------IARRHLRPLLILNGAILTTAIGIALFF----P---KSWTATTQLI--LP
A0A0S3TYD7      RKTFM------MLTRYWLPATL--AFSLVTVPAAVFLM--TRK---SSYQATGAVL--VK
U5QL42          LSIWR------TLRKRKLLSLS--VAVAVFGGVAAFTY--TRP---YIYESETLIL--VD
K9QF04          HQLGA------IARRRLVVFIA--VSGVIIAGVICKQW--LQK---PIYKQQFQLM--LD
A0A3C0N2P0      RRLLA------VARRRIILVAG--VAIAVTSGVAAKVL--RQV---PIYEGSFQLL--VG
K9TLQ0          RHLLS------VARRRIFVFAG--VSIAVACGVLVKVL--TQT---PIYEGNFRLL--VE
A0A076HBF2      RELWR------ALQRRKKLVGV--TAGSIIVLAALFTT--YQRLFRPVYEGSFSLL--IT
A0A354B169      RELWL------ALRRRRKLVTV--TASTVLALTVMVTA--YQRIFTPVYLGSFSLL--IT
G4FMX5          RDLWR------ALKRRKKLVGV--TAAGVISLTCVSTA--YQRIFRPVYQGSFALL--IT
Q0IDT5          RELWR------ALKRRKKIVGF--TAAAVLVLSGVVTT--YQRLFMPVYEGSFALL--IT
A0A2D6FCW3      RELWR------ALRRRKNLVGV--TAAGVLALSGLNTA--YQRIFRPVYQGSFALL--IT
A3ZA21          RELWR------ALKRRKKLVGV--TAAAVVALAGMVTA--YQRIFRPVYQGSFALL--IT
A0A140K3H3      TELKQ------TLSRQWKPALL--VASTVCAGIFLSTV--LQN---PKYQSQTLIL--LE
K9XUB8          TELKQ------TLSRQWKPALL--VASTVCIGMFLSTV--LQT---PKYRSQTLLL--LE
Q7NEU3          QTYAR------TIWRRRYAFIG--VFVATFSLAAAYTF--LSN---PVYEGEMLLL--LE
A0A352XE00      RQIIA------IARRRFILTAG--VAVAVTSGVATRVL--QQV---PKYEGKFQLL--IG
B4VS56          RQILA------VARRRALVVAG--MAIAVTSGIVTKVL--QQT---PNYEGKFQLL--VG
A0A352AAQ3      GQILG------VVRRRFIVIAG--VAIAVTSGIVARVL--KQT---PNYEGKFQLL--VG
A0A350Y472      RQILA------VAQRRAIIIAG--VAIAVSGGIVSQVL--KQE---PNYEGKFQLL--VG
A0A355DVB4      RQILA------VAQRRAIIIAG--VAIAVSGGIVSQVL--KQE---PNYEGKFQLL--VG
A0A2P8VVX1      GQLFQ------ILLRRWPWIIA--SLGVATAGAVFVSL--RQE---PIYRSNMQLL--VE
A0A2P8WHY0      GQLLG------ILLRRWPWIAG--TLVLSVAGAVLVFL--RED---PTYRSSMQLI--VE
A0A2T1CMT9      GELFS------KLWHRRLWFIG--AFTGVLAIAVPLAL--LKP---AVYQSYMQIL--AE
A0A1D8TX52      GQLLA------VLWRRRLWIIS--VLLTSLPIAFYLTI--KKE---PNYISSLQLL--VE
A0A1U7N5X9      GQLLA------VLWRRRLWIIS--VLLTSLPIAFYLTL--KKE---PNYISSLQLL--VE
A0A1D9G4T2      GQLLA------VLWRRRLWIIS--VLLTSLPIAFYITL--KKE---PNYISSLQLL--VE
F4XP71          GQLLA------VLWRRRLWIIS--VLLTSLPIAFYITL--KKE---PNYISSLQLL--VE
A0A2P8QVH5      RQLFT------VLLRRRLLILS--LFCIPLSASSFLAL--MAK---PTYQSSMQLL--VS
A0A2T1FT70      RQLFT------VLLRRRLLILS--LFCIPLSASSFLAL--MAK---PTYQSSMQLL--VS
A0A433W4W4      RQLFT------VLLRRRLLILS--LFCIPLSASSFLAL--MAK---PTYQSSMQLL--VS
K9U5W1          RQLFT------VLLRRRLLILS--LFCIPLSASSFLAL--MAK---PTYQSSMQLL--VS
A0A254WLA7      RQLLT------VLLRRRFLILS--LFCIPLSASSFLAL--MAK---PTYQSSMQLL--VS
A0A2W6ZAV2      GNLLP------ILRRRQRLLVA--VFAATVAIGAAATL--FQRVVSPVYQGDFRLL--VS
A0A2G7GMH8      GQLLS------VLMRRRFLLLS--VFFGILSMATVLTI--ITK---PTYKSSMQLL--VE
K9W742          GQLFA------ILIRRRLWLLG--ILCLALGIATFKAF--TTK---STYVSSLQLL--VE
K9SA61          GQIFA------VLARRRLWLLG--VFGSVVAAAAGLTF--LTT---PVYQSSLQLL--VE
A0A350Y7Z1      GQLFS------ILLRRRFWMLG--VFCGVLAIAIPIAL--NKE---PTYQSSMQLL--IE
A0A352X2A7      GQLFA------ILLRRKFWLLG--VFCSVLAIAIPIAL--KKE---PTYQSSIQLL--IE
K9XPB0          GQLLG------ILWRRRFWIGG--VFLGVLAVAIPLAL--MKQ---PLYMSQMQLL--IE
A0A0D8ZYV0      GQLFA------VLSRRRYWLLG--VLGGVLTIATALTL--TAE---PTFQSTMQIL--IE
A0A3D1PBA3      GQLFS------VLMRRRFWLLG--VLGSVLTIATVFTL--ISK---PTYQSTMQLL--IE
A0A254WJ87      GQLLA------VLMRRRYWLLG--VMGAVLTIATVFTL--ISK---PTYQSEMQLL--IE
A0A2T1FP73      GQLLA------VLMRRRYWLLG--VMGAVLTIATVFTL--ISK---PTYQSEMQLL--IE
A0A433VMS2      GQLLA------VLMRRRYWLLG--VMGAVLTIATVFTL--ISK---PTYQSEMQLL--IE
K9TYA7          GQLLA------VLMRRRYWLLG--VMGAVLTIATVFTL--ISK---PTYQSEMQLL--IE
A0A2P8QUE1      GQLLA------VLMRRRYWLLG--VMGAVLTIATVFTL--ISK---PTYQSEMQLL--IE
A0A2T1DWE8      GQLVA------ALFRRKLWLLG--IFLTVLSAVTIYTL--LKK---PIYQSSMQLL--VE
A0A1U7I8L3      GQLLA------ILLRRRYWLLG--IFSVVLAITAIVTI--TTK---PTYKSSMQLL--VE
A0A2T1DJL8      GQLLS------VLMRRRLWLIG--GLGLSLIGAALFTL--FSK---PTFRSSMQLL--SE
A0A1Z4J9W0      GQLFG------VLLRRKLWFLG--ALAGTLALAAGVTA--VLP---PTYRSTMQLM--VE
A0A0N7Z5K9      GQLFG------VLMRRKIWFLG--AVAGTIALAAAVTA--FMP---PTYRSTMQML--VE
A0A0S3TXC5      GQLFG------VLMRRKIWFLG--ALAGTIALAAGVTA--FMP---PTYRSTMQML--IE
A0A2T1DNG3      GQLFA------ILKRHYLWVLA--AGTVSVAIAFAYTL--KQE---STYISGMQFL--VE
A0A2P8W9H0      DRFVA------ALRRHLLLIAG--ITTLTASAAVLKAI--TDA---PTYQSSFDILTPSS
A0A3S0Y9N9      LQYWL------IFKRRWLPVSI--VFFTVVALSIVKTL--LET---PIYQATAQLV--L-
A0A433UNK7      LRYWS------ILKRRWLPTSI--VFLSLLALSIVKTV--LET---PIYQAGGQLV--L-
B8HNB0          VELLR------TLKKRWIPALA--TAVTVFAGCYIYSA--LQT---PLYRSEALIL--T-
A0A1Z4LN32      QKYLL------VLKRRWLIASV--VFAGFASFGVLHWV--SQK---PAYQATGKLL--F-
A0A2I8A9F5      QKYLL------VLKRRWLVIAG--VFVLFATLGGTLAL--KQP---KSYEATGKLL--F-
A0A218Q6R8      QKYWL------VLKRRWLIIAA--VSTACAALGGVNFF--IQP---TTYQASGKLL--F-
A0A0C1XVC4      QKYLL------VLKRRWLIASG--VFAVFATLGGINFV--MQP---PVYEGSGKLL--F-
A0A218QGE0      QKYLL------VLKRRWLIASG--VFAVFATLGGINFV--IQP---PVYEASGKLL--F-
A0A3B8Y8H9      SQIVP------WLRRRFWLIGS--ISLAVSLSAVSYAF--TRA---PVYEESFQIL--VD
A0A1Z3HMQ0      QRYWL------VLKRRWLPASL--VFAACVVAAALVGL--SQK---DTYQASGKLL--F-
A0A1E5QP61      QKYWL------VLKRHWLPASS--VFALIVTLATYKAA--TAD---PVYEAQGKLL--FK
A0A3M2GIL5      QKYWL------VLKRHWLPSSC--VFLLIFALAFAFAY--TRK---PTYEASGKLL--IK
A0A433NM31      RQYWL------ILKRRWLPASA--VFGFVLLLTALVTF--LQK---PVYQAQGKLL--LK
A0A3M1PML8      QKYWN------VLKRRWLPATS--VFLTLTLLSAAVAI--RQK---SSYQAETLLQ--V-
A0A352X442      QKYWL------VLKRRWLPAVG--VFGGIVAVAGLAVI--RQV---PSYQAQGTIL--I-
A0A0T7BPZ0      TKYWL------ILQRRWLPTLG--IVGIALTMAFGYVL--SIK---PTYKAQGSIL--I-
A0A0M0SHU3      QKYLL------VLQRRWMTAVG--IFGAVVTLALLYAF--SLK---PTYTAQASLL--I-
A0A1D2PBN3      QKYLL------VLQRRWVSAVG--VFGVVVTVASLYAF--SLK---PTYNAEGSLL--I-
A0A0C2LVR7      QKYLL------VLQRRWVPAVG--VFGAVVTLVSLYAF--SLK---PTYNAEGSLL--I-
A0A1Z4PQB9      QKYLL------VLQRRWVPAVG--VFGVAVTLVSLYAF--SLK---PTYKAEGSLL--I-
A0A1Z4SFN6      QSYLL------VVQRRWLAAVS--VFGVVVALASLQAF--SSK---PSYEAQGSLL--V-
K9PGI8          QKYLL------ILQRRWIPAAG--VFGVVVTLAFLYAV--SLK---PAYKAEGSLL--I-
A0A2W1JVB9      GKYWL------ILKRRWLPATI--IFLLMFSTATLAAF--LKA---PIYQSQGTLR----
A0A3M1SVZ4      DRAFP------IVKRRWLPASV--VFAAIFTVFYIAAQ--KDR---PVYIAEGEIL--IE
K9SSQ0          SPLLSTFLVRRLVRKHLVTVIS--TTALTLGGAAIYTF--NQP---FLYESKGSLL--IE
A0A2W1JIN9      SRLPL------VFSRHRWSALA--AFSAVMCGLCLYVV--FAP---RLYTSKVRLI--LD
A0A318AJV1      AAAKR------MLRRRWATMLG--VSSVVFVVALSVVA--CLP---PRYVAVARIR--ID
A0A254WHG9      ALLPT------IFYRRRLPALA--TFISVMLGALVYLI--FAP---RTYEAEARLM--LD
A0A2P8QIL5      ALLPT------IFYRRRLPALA--TFISVMLGALVYLI--FAP---RTYEAEARLM--LD
A0A2T1FLY5      ALLPT------IFYRRRLPALA--TFISVMLGALVYLI--FAP---RTYEAEARLM--LD
A0A433W447      ALLPT------IFYRRRLPALA--TFISVMLGALVYLI--FAP---RTYEAEARLM--LD
K9U1K8          ALLPT------IFYRRRLPALA--TFISVMLGALVYLI--FAP---RTYEAEARLM--LD
A0A1U7N2U4      SSLPL------ALRRRLLAALA--TFTSVIGGGMAYLV--VTP---PVYQVKARLM--LE
A0A1D9G1F2      SSLPL------ALKRRLLPALV--TFTSVIGGAIAYLV--VTP---PVYQVKARLM--LD
F4XV38          SSLPL------ALKRRLLPALV--TFTSVIGGAIAYLV--VTP---PVYQVKARLM--LD
K9UYB2          SSVFT------ILKRRSFPALL--MFAAVLGGAYAYIS--TAP---KMYESAIRLM--VD
A0A0C1XJI7      SSLLA------VLKRRAFPALV--TFTAVIGGAFAYLT--VTP---RLYEASARLM--QD
A0A218QN17      SSLLA------ILKRRALPALV--TFTAVIGGAVAYLT--VTP---RLYEASARLM--QD
K9RKN2          SSLLT------IVMRRSLPALA--TFVAVMGGAFAYLS--ITP---RVYETSARLM--LD
A0A2I8ADV2      STLFA------VLRRRGLPAVS--TLAAVIGASVAYLA--ITP---RFYATSAKMM--VD
A0A1W5CKM3      STLLG------VLGRRGFPAVT--VFASVIGASFAYLA--VTP---RLYETSARLM--LD
Q3MEW0          STLLG------VLGRRGFPAVT--VFASVIGASFAYLA--VTP---RLYETSARLM--LD
A0A1Z4KIC7      STLLG------VLGRRGFPAVT--VFAAVIGASFAYLA--VTP---RLYETSARLM--LD
Q8YSM5          STLLG------VLGRRGFPAVT--VFAAVIGASFAYLA--VTP---RLYETSARLM--LD
A0A1Q4S1H4      SSLWT------VAKRRSLPAFL--TLSAVIAGAVTYLA--VAP---RMYETSSRLM--VD
A0A433VBU6      SSLWA------VVRRRSLPAFL--TLSAVMAGAVTYLA--VAP---RMYETSSRLM--LD
A0A1Q4RZJ6      WSVLS------VLKRRGLPALI--TFTAVIGGAVAYLK--VTP---RLYESSSRLI--FD
A0A1Z4SNV3      WSVLA------VIKRRGLPALI--TFTAVISGAVAYLK--VTP---RLYETSARLI--FD
A0A2H2XJQ1      WSVLA------VIKRRGLPALI--TFTAVISGAVAYLK--VTP---RLYETSARLI--FD
A0A3S5K358      WSVLS------VLKRRGLPALI--TFTAVIGGAVAYLK--VTP---RLYESSSRLI--FD
A0A0T7BPJ4      SSLVA------VLKRRGLPAAA--AFVAVMGAAGAYLL--LSP---KLYEASARMM--LD
A0A0C1QS61      SSVLG------VLKRRSLPAVA--AFVATIGGAIAYLA--VTP---SQYEASARLM--LD
A0A139X3R8      SSVLS------VLKRRSLPAVA--AFVAAIGGAIAYLA--VTP---SQYEASARLM--LD
A0A1Z4I7C5      STLLA------VLGRRGFPAIT--VFAAVIGTSFAYLQ--VTP---RLYESSARLM--LE
A0A0C2MDK7      SSVLA------VLRRRSLPAVA--AFVAVMGGAIAYLA--VTP---SKYEAYARLM--LD
A0A1Y0RCK1      SNVLA------VLKRRSAPAIA--AFAAVIGGAIAYLA--VTP---SKYEAYARLM--LD
A0A1Z4PWZ0      SSVIG------VLRRRSLPAIA--AFVAVIGGAMAYLT--VTP---SKYAASARVM--LD
A0A0C2QLT0      SSVIG------VLRRRSLPAIA--AFVAVIGGAIAYLA--VTP---SKYEAYARLM--QD
A0A1Z4J2K1      SSVIA------VLRRRSLPAIA--AFVAVIGGAIAYLA--VTP---SKYEASARLM--QD
A0A3S0ZSX0      SSLLL------IFKRRAFPALA--TFAAVIGGAIAYLQ--VTP---HRYQTSARLM--LD
A0A2N6K4T3      SSLPS------ILKRRALPALV--TFAAVIGGAIAYLQ--MTP---RQYQTSTRLM--LD
A0A370CKT2      SSLPS------ILKRRALPALV--TFAAVISGAIAYLQ--ITP---RQYQTSTRLM--LD
A0A0S3TL97      SSLPS------ILKRRALPALV--TFAAVIGGAIAYLQ--ITP---HQYQTSTRLM--LD
A0A2N6M8A0      SSLPS------ILKRRALPALV--TFAAVIGGAIAYLQ--ITP---HQYQTSTRLM--LD
A0A2N6M9E1      SSLPS------ILKRRALPALV--TFAAVIGGAIAYLQ--ITP---RQYQTSTRLM--LD
A0A2N6KJI4      SSLPS------ILKRRALPALV--TFAAVIGGAIAYLQ--ITP---RQYQTSTRLM--LD
A0A2N6MZ77      SSLPS------ILKRRALPALV--TFAAVIGGAIAYLQ--ITP---RQYQTSTRLM--LD
A0A2N6KT20      SSLPS------ILKRRALPALV--TFAAVISGAIAYLQ--ITP---RQYQTSTRLM--LD
G6FSN3          SSLPS------ILKRRALPALV--TFAAVISGAIAYLQ--ITP---RQYQTSTRLM--LD
A0A0D6YL98      SSLPF------ILKRRALPALV--TFAAVIGGAIAYLL--ITP---RLYEISTRLI--LD
A0A328I8B9      -----------------LPALV--TFAAVIGGAIAYLI--ITP---RLYEISTRLI--LD
A0A0M0SU69      SSLPF------ILKRRALPALA--TFIAVIGGAIIYLQ--ITP---RLYETSTRLI--LD
A0A1Z4TIZ8      SSLLF------ILKRRTLPALA--TFAAVIGGAIAYLQ--ITP---RLYETSTRLI--LD
A0A318BG22      QRYVA------TLTKHRLLILG--TTIAAALLALIVTM--LTE---PRYVARTTFE----
A0A2T1E9V8      YNYWC------IFKRHWLPALA--IFSTITGGSYLYTS--AKT---PIYSAQGQIL--F-
A0A0P1C0L3      ARYWI------EARALRFWIAA--IIALALIAGLVVTL--LST---PLYRAGARIE----
A0A3M2GQQ6      VELGR------TLVKRWSIIAI--VMTSVFATVAVSTL--RTT---PQYRSETLIL--V-
K9SGJ5          SRFLR------TLRKRWLVVAS--ISATLFATVAAYTY--IKE---PVYQSETSLL----
L8MYT6          AKFLR------VLRKRWIVIVA--VSVTVFAGNTYYTI--TRI---PQYRSSASLL----
A0A352JGJ6      AKFFR------VLRKRWIVIVA--VSASVFVGNAYYTF--TRT---PQYRSSASLL----
A0A1J5GLS2      AKFFR------ILRKRWIVIVA--VSASVFAGTTYYTF--TRV---PQYKAGAALL----
A0A2W4W6M5      AKFFR------VLRKRWIVVAA--VSVTVFAGNAYYTF--SRT---PQYRSNASLL----
A0A2W7AN33      AKVLR------VFRDRWTVIAT--VSVTMLAGSALYTF--TRT---PQYRSIASLL----
A0A256BLV2      AKFFR------VLRKRWIVIVA--VSVSVFAGNTYYTF--TRT---PQYRSSASLL----
A0A2W6ZXF3      AKFFR------VLRKRWIVIVA--VSASVFAGTTYYTF--TRT---PQYKAGAALL----
A0A2Z5WX66      AKFFR------VLRKRWMVIVA--VSVTVFAGNTYYTF--TRT---PQYRSNASLL----
K9W1T3          TQYWF------IFKRRWLPASL--VFTLVLGVTALVTF--QQK---PIYQAQGQIL--I-
A0A0D6YBN8      RQYLR------MALRWRFVILG--AIALCLIIGLIVTL--LMT---PQYTAGATIE--I-
A0A318BJ18      RHYLR------IAMRWRWVILG--VTIACVLLGLVVTL--LMT---PTYTATATVE--I-
A0A1Q4RTR1      RQAWR------ILKRRWLAVTI--VISSAIGVTGAITF--SQT---PIYEAEGKLT--FN
A0A1Z4SQV2      RQAWR------IMKRRWLAVTV--VLSSVVGITGAVTF--SQT---PIYEAEGKLL--FN
A0A2H2XGN1      RQAWR------IMKRRWLAVTV--VLSSVVGITGAVTF--SQT---PIYEAEGKLL--FN
A0A433UXH8      RQAWR------IMKRRWLAVTI--VLSSVVGITGAVTF--SQT---PIYEAEGKLL--FN
A0A1Z4RMB9      NEYLL------KVKRRWKPALG--VFLLTLGVTGALSL--LQT---KTYQAEGKIL--F-
D5A466          GRYLQ------TLKRRWFWLLG--VFVLTVSGAVYATQ--FLS---PTYQNSGKIL--F-
K1XF69          GRYLQ------TLKRRWFWLLG--VFVLSVSGAVYATQ--FLT---PTYENSGKIL--F-
B5W297          GRYLQ------TLKRRWFWLLG--VFVLSVSGAVYATQ--FLT---PTYENSGKIL--F-
H1W7M8          GRYLQ------TLKRRWFWLLG--VFVLSVSGAVYATQ--FLT---PTYENSGKIL--F-
B4WP72          QKYWC------VLRRRWRLATF--VFSSSICLTVLALA--SQE---AEYEATGKLL--I-
A0A318B4H2      ERYWR------AMLNRRLLILA--VLLASMTVGVIVYL--MAT---PQYLATARIE----
B4WQE3          GRVVD------VLKRHVFLITG--ITALATSAVVARAL--TET---PLYRADFELLTPLV
A0A2K3BR24      QQYWM------ALKRRSLSAII--VFASTIGIAAAYSF--QQE---PIYQAKAKLL--F-
K9YXY1          QQYWM------ALKRRSLSAII--VFASTIGITAAYSF--QQE---PIYQAKAKLL--F-
A0A2P8W4F7      KRLLG------VFKRRAGVFLG--VAALSFGGLTLWHL--SQP---PAYSGSVNLL--V-
U5QJM6          --------------------MM--TMAATFTLAVAYTF--LSQ---PVYKSEMLML--L-
A0A1U7HGH0      HKYWY------ILKRRWLPAVA--AFGTVMGITYLHTL--SRV---PIYQAQGELL--F-
K9XJD3          HKYWC------ILKRRWLPAVA--AFGTVMGITYLHTL--SRV---PIYQAQGELL--F-
K9SX01          FELLS------IVRRYWFLEIS--IFSLVFGVSAFLTF--QEK---PIYQATGSLL--F-
A0A1E5QIR9      KQYGL------VFKRRFFPAAI--VFCAAIGATAAITF--LQK---PTYQAQGELL--F-
A0A1Z4IBC7      HKYIE------VLQRRWLAVVG--VFGLSLALGCLYAF--SLK---PSYKADGSLM--I-
A0A1W5CPC7      HKYVE------VLQRRWLAVVG--IFGLSLTLGCVYAF--SQK---PSYKAEGSVM--I-
Q3MDC6          HKYVE------VLQRRWLAVVG--IFGLSLTLGCVYAF--SQK---PSYKAEGSVM--I-
A0A1Z4KM73      HKYVE------VLQRRWLAVVG--IFGLSLTLGCVYAF--SQK---PSYKAEGSVM--I-
Q8YNX7          HKYVE------VLQRRWLAVVG--IFGLSLTLGCVYAF--SQK---PSYKAEGSVM--I-
A0A367R4K6      QKYLE------VLQRRWLTVIG--IFSIAVTLGCLYAF--SLK---PSYKAEGSLM--I-
A0A1E2WSV8      QKYLE------VIQRRWLPLVG--IFSIAVTLGCLYAF--SLK---PSYKAEGSLM--I-
A0A2R5FRT9      QKYLE------VIQRRWLPLVG--IFGITVTLGCLYAF--SLK---PSYKAEGSLM--I-
A0A2K8T1B6      QKYLE------VIQRRWLPLVG--IFGISVTLGCLYAF--SLK---PSYKAEGSLM--I-
A0A235I9I0      QKYLE------VFQRRWLPLVG--IFAISVSLGCLYAF--SLK---PSYKAEGSLM--I-
A0A2D0HQT8      QKYLE------VFQRRWLPLVG--IFAISVSLGCLYAF--SLK---PSYKAEGSLM--I-
A0A2L2NU95      QKYLE------VIQRRWLPLVG--IFAISVTLGCLYAF--SLK---PSYKAEGSLM--I-
A0A367S084      QKYLE------VFQRRWLPLVG--IFAISVSLGCLYAF--SLK---PSYKAEGSLM--I-
A0A0V7ZFJ4      QQYWL------TLKRRWLPALI--VSSSVFGMAAFNTL--KQE---PIYSAEGKLR--FN
A0A0V7ZNJ9      EQYWL------ILKRRWVPASV--VAGSVVGLAALVTF--MQK---PIYEAKAELL--FN
A0A367RIS1      QQYWR------ILKRRWFLIAI--IMGSVFGVTGLVAF--SKK---PIYESEGKLL--FN
A0A235IXQ2      QQYWL------TVKRRWFLILI--IIGSVFGVTGVVTF--SEK---PIYEAEGKLL--FN
A0A1W5CNX3      QQYWL------IAKRRWLLIAT--IMGSVFGVTGLLTF--SQK---PIYEAEGKLL--FN
Q3MEB7          QQYWL------IAKRRWLLIAT--IMGSVFGVTGLLTF--SQK---PIYEAEGKLL--FN
A0A1Z4KHN9      QQYWL------IVKRRWLLIAA--IIGSVFGVTGLVTF--SQK---PIYEADGKLL--FN
Q8YT70          QQYWL------IVKRRWLLIAA--IIGSVFGVTGLVTF--SQK---PIYEADGKLL--FN
A0A218Q4C1      QQYWL------TVKRRWLLIAT--IITSVFGFTAFVTF--SQK---PIYQAEGKLI--FD
A0A166IWU6      RQYWL------AVKRRWLLIVI--IIGSVFGITSFVTF--NQK---QIYEAEGKLI--FD
A0A2S0Q8C0      RQYWL------AVKRRWFLIVI--IIGSVFGITSFVTF--NQK---PIYEAEGKLI--FD
W6FSX4          RQYWL------AVKRRWFLIVI--IIGSVFGITSFVTF--NQK---PIYEAEGKLI--FD
A0A1B7WTD1      QQYWL------ILKRRWFVASV--VMASVISATAFMTY--TQK---PVYESQGKLV--FT
A0A1B7WX82      QQYWL------IFKRRWLVSSI--VFASVFGITAFVTY--TTK---PVYESEGKLV--FT
A0A0R0M9H9      QVYWL------ILKRRWLVILL--VMASVLGAAISYTY--SQK---PVYQAKGKLL--FE
A0A1S1ZVW2      QVYWL------ILKRRWLVILL--VMASVLGAAISYTY--SQK---PVYQAKGKLL--FE
A0A1Z4LRU5      GQYWL------ILKRRWLPALL--VTSSIFGLAAFVTF--RQK---PVYQAEGKLR--FD
A0A1Z4JVB4      QQYWL------ILKRRWLLTSF--VTGSVFGLAALLTF--LQK---PAYESPAKLI--FN
K9PIA4          QHYWT------VLKRRWLVTSI--VISTVFGLTALVTF--LKT---PVYESKAKLL--FN
A0A1Z4M597      QQYWT------VLKRRWPVTTV--VIGSVFGLTALVTF--LQK---PVYESQAKLL--FN
A0A1Z4MWT1      QQYWT------VLKRRWPVTTV--VIGSVFGLTALVTF--LQK---PVYESQAKLL--FN
A0A1Z4TX53      QQYWT------VLKRRWPVTTV--VIGSVFGLTALVTF--LQK---PVYESQAKLL--FN
A0A1Z4HVE1      QQYWT------VLKRRWPVTTV--VIGSVFGLTCLFTF--LQK---PVYESQAKLL--FN
A0A252ECZ1      HQYWP------ILKRRWPVTTV--VIGSVFGLTALVTF--LQK---PVYESQAKLL--FN
A0A1Z4G5Y1      QEYWP------ILKRRWPVTAV--VIGSVFGLTALVTF--VQK---PVYESQAKLL--FN
A0A252DNA2      QEYWP------ILKRRWPVTTV--VIGSVFGLTALVTF--LQK---PVYESQAKLL--FN
A0A252E1Q4      QEYWP------ILKRRWPVTTV--VIGSVFGLTALVTF--LQK---PVYESQAKLL--FN
A0A2A2TNQ5      QEYLL------VLKRRWLAAAI--VMGSVFGITAFVTY--SQK---PIYEASGKLL--L-
A0A3S1C4K5      QQYLR------ILKRRWLVTAG--VMGSVFGLTALVTF--SQK---PVYESQGKLL--I-
A0A1X4G3D5      QLYWM------ILRRRWLVVLL--VMASVLGGAISYTL--FQK---PVYQAKGKLL--FE
D4TNI2          QLYWM------ILRRRWLVVLL--VMASVLGGAISYTL--FQK---PVYQAKGKLL--FE
A0A1Z4H6Z8      QEYWP------ILKRRWPVTAV--VIGSVFGMTALVTF--LQK---PVYESQAKLL--FN
A0A1Z4NPM1      QQYWL------ILRRRWLVILL--VLGSVFGLAAFYTF--TLK---PVYEAGGKLM--L-
A0A3F3KPR9      QIYWL------ILKRRWLVILL--VIASVLGAAISYTY--SQK---PVYQAKGKLL--FE
D4TGN7          QIYWL------ILKRRWLVILL--VIASVLGAAISYTY--SQK---PVYQAKGKLL--FE
A0A1Z4UZW9      QQYWL------IFKGRWPMASI--VFAVVFGVTALVTY--STK---PVYESEGKLV--FT
A0A0K2M5H0      QQYWL------IFKRRWPVASV--VFAFVFGVTALVTY--STK---PVYESEGKLV--FT
A0A1B7VSH4      QQYWL------IFKRRWLVASI--VFASVFGATALVTY--LTK---PVYESEGKLV--FT
A0A1B7W126      QQYWL------IFKRRWLVASI--VFASVFGATALVTY--LTK---PVYESEGKLV--FT
A0A3D4C6Q6      QQYWL------IFKRRWLVASI--VFASVFGATALVTY--LTK---PVYESEGKLV--FT
K7W0A4          QQYWL------TFKRHWLVTSI--VFASVLGVTALLTY--SAK---PIYESEGKLV--FT
A0A1B7UTR1      QQYWL------TFKRHWLVTSI--VFASVLGVTALLTY--SAK---PVYESEGKLV--FT
A0A1B7UVJ4      QQYWL------TFKRHWLVTSI--VFASVLGVTALLTY--SAK---PVYESEGKLV--FT
A0A2T1CIL7      QKYWL------VLKRRWLPATM--IFTGVTGIFVLSAL--SKP---PTYMAEAQLL--I-
A0A1Z4RPC6      GNYLQ------KLKRRWIPALA--VFIVTVGTTAFLSG--FLE---KNYKSEGKIL--F-
A0A2T1CMZ0      EEYLL------KLKRRWLPALS--VFVVTVGTTLFLTS--FLE---KTYKSEGKIL--F-
L8M4F7          GEYLL------KLKRRWKIASA--LFLLTVGAAGLLST--KLS---TKYEAEGKLL--F-
L8LZE9          LSYLQ------KIQRRWKPALA--VFLLTAGSIGLASV--FLT---TKYQAGGKIL--F-
A0A140K2P2      SQYLI------KLRRRWKLALA--VFLLTAGITTALSL--LLQ---KTYQAQGKLL--F-
K9XWX4          SGYLI------KLRRRWKLALA--VFLLTAGVTTALSL--LLQ---KTYQAQGKLL--F-
A0A140KB14      YNYLQ------KLSRRWKPALA--VFLLTVGSMAALST--LLK---KSYQAEGKLL--F-
K9XX88          YNYLQ------KLRRRWKPALA--VFLLTVGSVAALST--LLK---KSYQAEGKLL--F-
A0A433V7A0      QKGWL------TIKRHWKPALG--IFGVVFIITGIGVL--MKS---PSYTAYGKLL--F-
A0A0C2LBE2      QKYWL------ILQRRWLPAVG--VCGVVVSLASLLAF--SSK---PTFKAEGSLL--I-
A0A433NN38      QKYWL------VLQRRWLPAVG--IFGTVLTLASVYAF--SLK---PYYQAQASLL--I-
A0A2N6K0T2      QKYLL------VLQRRWMTAVG--VFGVIVSLALLYAL--STK---PTYTAQASLL--I-
A0A2N6ML72      QKYLL------VLQRRWMTAVG--VFGVIVTLALLHAL--STK---PTYTAQASLL--I-
G6FQZ6          QKYLL------VLQRRWMTAVG--VFGVVFTLALLYAL--SIK---PTYTAQASLL--I-
A0A2N6MQX9      QKYLL------VLQRRWMTAVG--VFGVVFTLALLHAL--STK---PTYTAQASLL--I-
A0A2N6KXT6      QKYLL------VLQRRWMTAVG--VFGVVFTLALLYAL--STK---PTYTAQASLL--I-
A0A2N6KGB9      QKYLL------VLQRRWMTAVG--VFGVVFTLALLYAL--STK---PTYTAQASLL--I-
A0A2N6L3Y5      QKYLL------VLQRRWMTAVG--VFGVVFTLALLYAL--STK---PTYTAQASLL--I-
A0A0S3TIS7      QKYLL------VLQRRWMTAVG--VFGVVFTLALLYAL--STK---PTYTAQASLL--I-
A0A1U7GW28      QKYLL------VLQRRWMTAVG--VFGVVFTLALLYAL--STK---PTYTAQASLL--I-
A0A2N6LW63      QKYLL------VLQRRWMTAVG--VFGVVFTLALLYAL--STK---PTYTAQASLL--I-
A0A1Z4TQ63      QKYLL------VLQRRWMTAVG--VFGAVVTLALLYAF--SLK---PTYTAQASLL--I-
A0A0D6YFE2      QKYLL------VLQRRWMTAVG--ICGVVLSLALLYAF--SLK---PTYTAQASLL--I-
A0A328IH74      QKYLL------VLQRRWLTAVG--ICGVVLSLALLYAF--SLK---PTYTAQASLL--I-
A0A1Z4NDS1      QKYVQ------VLQRRWLPGLA--IFGTCVTLATIYAF--SLQ---PSYKAEGNLL--I-
K9F4D9          QKYWR------VLKRRWLIALT--VFGLTTTAAVGVGI--TQK---PEYQAESKLL--F-
U9VXM0          QKYWR------VLKRRWLIALT--IFGLTTTAAVGVGI--TQK---PEYEAEAKLL--F-
A0A2T1FTR8      AQYWL------VLKRRWMPAAL--VFALTTAVATVWTF--KQQ---EIFQAKGQVI--L-
K9UA41          AQYWL------VLKRRWMPAAL--VFALTTAVATVWTF--KQQ---EIFQAKGQVI--L-
A0A1Z4SMD6      QNYWL------VLKRRWLIAAG--VLLTFVGLSGVAIY--MQK---PEYEASGMLL--F-
A0A2H2Y096      QNYWL------VLKRRWLIAAG--VLLTFVGLSGVAIY--MQK---PEYEASGMLL--F-
K9S8M8          QKYWL------ILKRHWLPATG--AFLLAVCGAAAMAF--TAE---PIYEAQGKLL--L-
A0A1Z4NFV0      HRYWL------VLKRRWLVVVG--ILAASTALSGFVLS--TQR---PQFEAIGQLL--F-
B0CAX4          RNYFR------ILRRRWIPATA--VFGSVFVLTALATF--LQK---PVYEAEGKLL--L-
U5DPF5          QKYWS------ILKRRWLPASL--VTISTIGLTGIYSA--RQT---PIYEARARLL--L-
A0A350Y0P6      QKYWL------ILRRRWLPSTV--VFGFIFTLATTVAF--VKK---PSYSAYGKLL--L-
A0A352X940      QKYWL------ILKRRWLPATM--VFLLSIGVAVGVAY--TRQ---PIYEAGGKLL--L-
B8HTN4          GKYLT------ILKRRWLGGAI--AFGSILSLVIAYTL--LQK---PVYQAQGLLL--L-
A0A2A2TPF8      QNYWL------VLKRRWLIASG--IFLTSVALSGFVIS--LQR---ANYEAKGKLL--F-
A0A1Z4R0P8      QNYWL------VLKRRWPIALG--IFLTSVALSGFAIS--LQK---ANYEAEGKIL--F-
A0A0T7BUI3      QQYFL------VLQRRWKILLA--LIITSVGFSGFAIL--RQK---PQYQATGMLL--F-
A0A1Z4LP32      QQYWL------IIKRRWLFIVA--AMLGSIGLSWFVIL--QQK---PQYQANGLLL--F-
K9REP9          QQYWL------IVKRRWLFLVA--AMLGSIGLSWLLIL--RQK---PEYQATGLLL--F-
A0A1Z4SIJ3      QKYWL------VLKRRWLFVAV--TVAASVGVAGIFIV--RQH---PEYRANGMLL--F-
A0A2H2XPG4      QKYWL------VLKRRWLFVAV--TVAASVGVAGIFIV--RQH---PEYRANGMLL--F-
K9V3C7          KNYWL------VLKRRWLIAAG--IFLTSVAMSGFVIS--LQK---ATYEASGKLL--F-
A0A1Z4T6Y7      RNYWL------ALKRRWLVASG--IFITTVALSGFAIS--LQR---PTYQASGKLL--F-
A0A2H2Y561      RNYWL------ALKRRWLVASG--IFITTVALSGFAIS--LQR---PTYQASGKLL--F-
A0A1Q4S362      RSYWL------VLKRRWLVASG--ILFTSIALSGFAIS--LQR---PTYQASGKLL--F-
A0A3S1CIN8      RSYWL------VLKRRWLIASG--ILFTSIALSGFAIS--LQR---PTYQASGKLL--F-
A0A2A2TC28      QQYWL------VLKRRWLIAAT--VFCASVGLSGLVVL--RQK---PQYEASGMLL--F-
A0A0C1NCB0      QKYLL------VIQRRWHIVAG--VMLVSMVLSGLGIY--LQK---PKYQATGILL--I-
A0A2N6K7Q9      QQYLL------ILKRRWRLIAA--IILASIGLSGSALF--MQK---PEYQADGILL--F-
A0A2N6MXH6      QQYLL------ILKRRWRLITA--IILASIGLSGSALF--MQK---PEYQADGILL--F-
A0A2N6M5A8      QQYLL------ILKRRWRLITA--IILASIGLSGSALF--MQK---PEYQADGILL--F-
A0A2N6LL61      QQYLL------ILQRRWRLITT--IILASIGLSGSALF--MQK---PEYQADGILL--F-
A0A0S3TP66      QQYLL------ILKRRWRLITA--IILASIGLSGSALF--MQK---PEYQADGILL--F-
G6FP91          QQYLL------ILKRRWRLITT--IILASIGLSGSALF--MQK---PEYQADGILL--F-
A0A1U7GYR5      QQYLL------ILKRRWRLITA--IILASIGLSGSALF--MQK---PEYQADGILL--F-
A0A2N6KY52      QQYLL------ILKRRWRLITA--IILASIGLSGSALF--MQK---PEYQADGILL--F-
A0A2N6KMP5      QQYLL------ILKRRWQLITT--IIVASIGLSGSVLF--MQK---PEYQADGILL--F-
A0A2N6MA45      QQYLL------ILQRRWRLITT--IIVASIGLSGSALF--MQK---PEYQADGILL--F-
A0A1Z4TLC8      QQYIL------VLKRRWRLIAS--IIIASIGLSGLALF--MQK---PEYQADGILL--F-
A0A0M0SFT2      QQYIL------VLKRRWRLIAS--IVLAAIGLSGLALF--MQK---PEYQADGILL--F-
A0A0D6Y7R4      QQYIL------VLKRRWQLIAS--IILASIGLSGLALF--MQK---PEYQADGILL--F-
A0A328IGA1      QQYIL------VLKRRWQLIAS--IILASIGLSGLALF--MQK---PEYQADGILL--F-
A0A0C2LFH0      QKYWL------VLKRRWPIVVG--VLLASIGFSSFLIF--LQK---PEYQASGMLL--F-
A0A1Z4IYV4      QKYWL------VLKRRWPIVAG--VVLASVGLSSFAVF--LQK---PKYQASGMLL--F-
A0A1Z4Q0T6      QKYWL------VLKRRWPIVAG--VVLASIGLTTFAVF--LQK---PEYQATGMLL--F-
A0A0C2PT44      QKYWL------VLKRRWPIVAG--SVLTSIGLTTFAVF--LQK---PEYQATGMLL--F-
A0A1D2P6J4      QKYWL------VLKRRWPIVAG--VVLASVGLSSFAVF--LQK---PEYQATGMLL--F-
A0A3M9ZEU1      QKYWL------VLKRRWLPATG--VFGTVVALSTLAAV--MQK---PTYTATASLL--V-
A0A1Z4JK72      QNYWL------ILKRRWLTAAT--VLAATVGLVGLATS--MQR---PSFEANGRLL--V-
A0A0N7Z489      QSYWL------VLKRRWLVAAG--VFAATVGVAGLATS--LQR---PNYEANGRAL--V-
A0A0S3TXS2      QSYWL------VLKRRWLVAAG--VFAATVGLAGLATS--LQR---PNYEATGRVL--V-
A0A1Z4RN12      NKYWQ------VLKRRWLPATA--TFTGVVLLSLIAAL--SSQ---KVYEAEAQLL--I-
A0A2T1CMF9      SRYWQ------VVRRHWIPASA--TFAGVLALSLIAAL--ASK---NIYQAEARLL--I-
Q7NDC5          REYLR------ILNRHWPYAAG--TALAVVTVVTVWTF--ALP---PVWEAQGRLL--F-
U5QGK3          RDYLR------VLNRHRLYAGG--VFVLVVAGVAVWTF--TSP---SVWEAKGRLL--F-
A0A2W4UY24      QKYWL------VLKRHWLLALA--VCGLTTAAAAFLGS--TQA---LLYKAEGKLL--F-
A0A254WLE3      SKLWL------ILKRRWLPGAS--VFSAILGLTIIAVC--LQK---PVYEATGKLI--I-
A0A433W533      SKLWI------ILKRRWLPGTG--VFTAILGLAIIAVC--LQK---PVYEATGKLI--V-
A0A2P8QWJ3      SKLWI------ILKRRWLPGTG--VFTAILGLAIIAVC--LQK---PVYEATGKLI--V-
A0A2T1FKP8      SKLWI------ILKRRWLPGTG--VFTAILGLAIIAVC--LQK---PVYEATGKLI--V-
K9U6L7          SKLWI------ILKRRWLPGTG--VFTAILGLAIIAVC--LQK---PVYEATGKLI--V-
A0A2T1GMT4      SHYLF------AVKRHWIPAVS--IFAATVALSIAATS--LLK---PSYQAEGRLL--F-
K9UI51          SHYLF------AVKRHWIPAVS--IFAATVALSIAAAS--LLK---PSYQAEGRLL--F-
K9TYI2          SQYLL------SLKRRWLPAVS--IFATTVTLSVVAAA--FMK---PSYEGEGKLL--F-
A0A254W5G5      SQYLL------SLKRRWLPAVSIFIFVTTVTLSVVAAA--LMK---PSYEGEGQLL--F-
A0A2T1FXY4      SQYLL------SLKRRWLPAVS--IFATTVTLSVVAAT--LMR---PSYEGEGQLL--F-
A0A1Z4QL41      GRYLS------SVKRHWIPATC--IFATTVILSALAST--RLK---PSYESEGKLL--F-
A0A252D4T4      GRYLS------IVKRQWLPAVT--IFASTVALSAVATT--FLK---PTYEAEGKLL--F-
A0A252DJH5      GRYLS------IVKRQWLPAVT--IFASTVALSAVATT--FLK---PTYEAEGKLL--F-
A0A252EB80      GRYLS------IVKRQWIPAVT--IFASTVALSAVATT--FLK---PTYQAEGKLL--F-
A0A1Z4HPW5      GRYLS------IVKRQWIPAAS--IFASTVALSVVATT--LLK---PSYEAEGKLL--F-
A0A1Z4MSN1      SRYLS------MVKRQWIPAAS--IFASTVALSVVATT--LLK---PSYEAEGKLL--F-
A0A1Z4U1C2      SRYLS------MVKRQWIPAAS--IFASTVALSVVATT--LLK---PSYEAEGKLL--F-
A0A0D6KV51      -----------MVKRQWIPAAS--IFASTVALSVVATT--LLK---PSYEAEGKLL--F-
A0A1Z4MKF8      SRYLS------MVKRQWIPAAS--IFASTVALSVVATT--LLK---PSYEAEGKLL--F-
A0A2C6WC43      NRYLL------MLKRWWVPAAT--IFIATVMLSAVATR--FIK---PSYEAEGKLL--F-
A0A1Z4L5A1      NRYLL------MLKRWWIPAAT--IFLATVMLSAVATR--FMK---PSYEAEGKLL--F-
A0A367QD86      NRYLL------MLKRWWIPAAT--IFIATVMLSAVATR--FMK---PSYEAEGKLL--F-
A0A235IZ96      NRYLL------ILKRWWIPAVG--IFVGTVMLSAISTT--FMK---PSYEAEGKLL--F-
A0A2L2NGP0      NRYLL------ILKRWWIPAVG--IFVGTVMLSAISTT--FMK---PSYEAEGKLL--F-
A0A2K8SM78      -----------------------------------------MK---PSYEAEGKLL--F-
A0A2R5FPC0      SRYLL------ILKRWWLPGTA--IFAATVMLSAVATQ--FMK---PSYEAEGKLL--F-
K9QM62          HRYLL------MLKRRWILTVG--IFFATAGFGVFATT--LMK---PSYEAAGKLL--F-
A0A1Z4FWI3      GRYLS------VLKRQWIPATT--IFASTVAVSVMATT--FMK---PSYESEGKLL--F-
A0A1Z4JYE7      KIYLY------LLRRRWISVTS--IFLGTVSLSILATT--LLK---PAYESSGKLW--F-
A0A140KBA0      KKYWL------VLKRRIVPASI--TCLGVMTLSLVTAL--SLE---QVYQAEGQVM--I-
K9XSG1          QKYWL------VVKRRIVPASV--TCLGVITLSLVTAL--SLE---QIYEAEGQVM--I-
A0A0F5YE28      GKYLQ------TVKRYWLIVIS--VFLLCVGLSVYGTK--YLK---PTYAASGKLL--F-
U7QEH7          GKYFK------TVQRYWLVVIG--VFALCVGLSVYGTK--YLE---PTYAASGKLL--F-
A0A3S1ATK5      SRYLL------MIKRQWIPAAS--IFVATIALSALATT--RLQ---PSYEAEGKLL--F-
A0A2Z6CPH0      SHYLM------ILKRRWLCVTS--IVIGTIALSALAAT--LIK---PSYEAEGKLL--F-
A0A1Z4GT50      SRYLL------MLKRQWLPANS--IFAATVAMSALATT--YMK---PSYEAQGKLL--F-
A0A1Z4GIX0      NRYLL------VLRRRWILILS--ILAASVGLSVAATT--LLK---ASYEAEAKLL--F-
A0A2H6LC24      NRYLL------VLRRRWILILS--ILAASVGLSVAATT--LLK---ASYEAEAKLL--F-
B2J6N5          SRYLL------ILKRWWLPATV--IFTATVILSAIATQ--FMK---PSYEAEGKLL--F-
A0A367RMI4      NRYLL------ILKRWWLPAFS--VFVATVILSAISTQ--FLK---PDYEAEGKLL--F-
A0A235HUM0      NRYLL------ILKRWWVPAFS--IFVATVILSAISTK--FLK---PDYEAEGKLL--F-
A0A2L2NW47      SRYLL------ILKRWWLPAFS--IFVATVILSAISTQ--FLK---PDYEAEGKLL--F-
A0A1E2WUR1      NRYLL------ILKRWWLPAVS--IFVATVILSAVSTR--FMK---PDYEAEGKLL--F-
A0A235IKU3      NRYLL------ILKRWWIPAVG--IFVGTVMLSAISTT--FMR---PSYEAEGKLL--F-
F4XKF3          SQYKL------LLKRRWLPAVA--IFLFTVISAAWSTL--FLK---PSYEAEGKLL--F-
A0A1D9FX10      SQYLL------LLKRRWLPAVA--IFLFTVISAAWSTL--FLK---PSYEAEGKLL--F-
A0A1D8TNX9      SQYLL------LLKRRWLPAVA--IFLFTVISAAWSTL--FLK---PSYEAEGKLL--F-
A0A1U7MYU6      SQYLL------LLKRRWLPAVA--IFLFTVISAAWSTL--FLK---PSYEAEGKLL--F-
A0A3C0NJ41      QKLWL------ALKRRWLPGVA--VFAVVVGLTVPLALSKKQK---TDYEAKGKLL--F-
A0A352AG88      QKLGL------VIKRRWLIGAV--VFLGMVGLTIPMALLQSQQ---TSYEAKGKLL--F-
A0A350Y374      YKLWL------VIKRRWLVGGG--VFVLMVGLTIPVALTQMQK---GDYEAQGKLL--F-
A0A355DPX0      YKLWL------VIKRRWLVGGG--VFVLMVGLTIPVALAQMQK---GDYEAQGKLL--F-
A0A0D8ZUV2      HKLWL------ILKRRWLPAAG--VFSCVVGLSVVAAM--MPK---SSYQAEGKLL--L-
A0A433VDI0      QKYWS------ILKRRWLPAVI--VFSGVVGLSVVVVL--LQK---PVYQAEGKLM--L-
A0A3D1PG43      QNLWL------SIKRRWLPAAG--IFGCVLGCSALAAS--LQQ---PMYQAQGKIL--L-
A0A2P8QQ72      QNLQL------AIKRRWLAAAG--VFGFVLGLSTIVTL--LQA---PLYQAEGKLL--L-
K9TZQ7          QNLQL------AIKRRWLAAAG--VFGFVLGLSTIVTL--LQA---PLYQAEGKLL--L-
A0A2G7GPR0      KRVWL------ILKRRWLPAAG--VFGVVVAAAAALAS--MQR---PVYEAQGKLL--F-
K9XH68          KRVWL------ILKRRWLPAAG--VFGVVVAAATAFAS--MQR---PVYEAQGKLL--F-
A0A1U7HW70      KRVWL------ILKRRWLPAAG--VFGVVVAAATAFAS--MQR---PVYEAQGKLL--F-
A0A2S6VEJ8      KRVWL------ILKRRWLPAAG--VFGVVVAAATALAS--MQR---PVYEAQGKLL--F-
                                                                :           

K9SLA9          --IESTIESTTGSVAAPTTTASIPNPNQDNIASSEGLP-----PLPTDTAISTIPPGDRL
A0A168TT23      HETANILRIE---------------------------------DFEA-APRSWQGVEQFY
A0A0M1JWX9      PVTGEGANSLSSRL--------------------GALAGGLGMGIPG-----SSGSGVDY
A0A2T1M1V6      IKG-DKLNANLGTLG----------------------------NLSD-GGSDFTREVNPL
A0A2G7GCS2      QPT-TRLDTNLGTLG----------------------------QLQN-SALGFTRELNPL
K9XBH8          QST-NSINASLGTLG----------------------------QLQN-SGLGFSRELNPL
A0A1Z4LJ30      NVT-NDSDADLGKLG----------------------------SVRD-GGVVFSQQINPL
K9RI76          NVT-NQSDADLGKLG----------------------------NVRD-EGIVFSQQLNPL
A0A352AE27      DTT-SSLDANLGTLG----------------------------SLTN-DEPVFSNQLNPL
A0A3B8JH60      NTT-GDLDANLGTLG----------------------------SLRN-GGSGFSTEVNPL
A0A3C0N766      NTT-GDLDANLGTLG----------------------------SLRN-GGSGFSTEVNPL
K9W9J7          QKS-GNLDANLGTLG----------------------------SLRN-GDPGFSSEVNPL
A0A139WSU3      KTT-SNLDANLGTLG----------------------------SLRN-GDSAFSSEVNPL
A0A433VN22      KTT-SNLDASLGTLG----------------------------TFKN-GNLDFSPELNPL
Q7NF11          STN-KNAEISLGALG----------------------------EVRE-TGTSFSSEVNAL
A0A1Z4JCS8      SSNGGNLDANLGTLG----------------------------SYRN-SDPSFSPQVNPL
F4XTX2          ET--GKLQASLGTLG----------------------------SLTK-GDSELSAKSHPL
Q7NJN6          NAS-SNLSANLGPLG----------------------------NIQQ-QGLPFSNELNPT
U5QCC3          DTS-SNLSASLGPLG----------------------------NLQQ-QGLTFSTELSPT
A0A0S3TYD7      KQASTTSVLGLQ----------------------VDVG-----EIES-----LD-KSGPL
U5QL42          NR------------------------------------QQIPVVQTTES---ALPSAANL
K9QF04          SATSDSDS---------------------------NPLADSPRRSAV-----VPLQFRDF
A0A3C0N2P0      PVSSSEDKLGKL----------------------AQSLNEGGG---------SSSNTPDY
K9TLQ0          PIKGQDNL------------------------------EQLNQALTRNS---GKGEILDY
A0A076HBF2      DP-ISNEGGG-R----------------------SGMANVEGTMFEQLA---RNTTSNDI
A0A354B169      DP-ISSENSNGN----------------------SNATALSGTMFEQLA---RNTTSNDL
G4FMX5          DP-ISNDSGNNS----------------------ASAGGLNGSMFEELA---RNTTSNDL
Q0IDT5          DP-ISNEGGNNS----------------------AASSAASGTVFEQLA---RNTTQNDI
A0A2D6FCW3      DP-LNNESGN-R----------------------AAAAALDGGMFEELA---RNTTSNDI
A3ZA21          DP-ISNEGGNGR----------------------NAAFAASGTMFEQLA---RNTTQNDI
A0A140K3H3      NQKTQQSA----------------------------SVSPEQQSLAT-----GYYNLKDL
K9XUB8          NNKTQQSA----------------------------LVSPGQQSLNT-----GYSNLKDL
Q7NEU3          DRNSQPKV--------------------------LADEASPMSYFAS-----NSA---DI
A0A352XE00      PVSGGDRL---------------------------DELSQSLAQNTG-----SQGNAPDY
B4VS56          SVSGEDQL---------------------------EQISESLNQSAG-----VQTNSIDY
A0A352AAQ3      SVSGEDRV---------------------------EQLTEALSKTAN-----IQVEGPDY
A0A350Y472      SPSGEDQA---------------------------EQLTEALSKTGT-----VQVQGPDY
A0A355DVB4      SPSGEDQA---------------------------EQLTEALSKTGT-----VQVQGPDY
A0A2P8VVX1      PN-YQQEL-----------------------------NSSDLSSFAD-----QDPRDADY
A0A2P8WHY0      PN-YEDDV-----------------------------TARELDGLAN-----ASDQSIDY
A0A2T1CMT9      SN-YQAKD---L----------------------QDNQRDSEEQFAD-----ANVEL-DY
A0A1D8TX52      PN-YIDKT------------------------------RGIESQFTE-----STVDI-DY
A0A1U7N5X9      PN-YIDKT------------------------------RGIESQFTE-----STVDI-DY
A0A1D9G4T2      PN-YIDKT------------------------------RGIESQFTE-----STVDI-DY
F4XP71          PN-YIDKT------------------------------RGIESQFTE-----STVDI-DY
A0A2P8QVH5      SNLYQGQN---S----------------------NAQGGVEESDFTD-----SNLKV-DY
A0A2T1FT70      SNLYQGQN---S----------------------NAQGGVEESDFTD-----SNLKV-DY
A0A433W4W4      SNLYQGQN---S----------------------NAQGGVEESDFTD-----SNLKV-DY
K9U5W1          SNLYQGQN---S----------------------NAQGGVEESDFTD-----SNLKV-DY
A0A254WLA7      SNLYQGQN---S----------------------NAQGGVEESDFTD-----SNLKV-DY
A0A2W6ZAV2      DP-IDASS---T----------------------EGAADSSLRALAL-----QPQDRANT
A0A2G7GMH8      PN-YQGKT---D----------------------QGQGKTTESEFAD-----SNVEV-DI
K9W742          PN-YQSKR--------------------------QDGQEGAEKQIVD-----PNIQV-DS
K9SA61          SN-YQGRD--------------------------QNGDRASEGQFTD-----SNVKL-DY
A0A350Y7Z1      PY-VQQKQ---------------------------EGKPQTEEQFTD-----SNVEV-DY
A0A352X2A7      PL-VQEKQ---------------------------QRRSE-ENQFTE-----SNIEV-DY
K9XPB0          SN-YQTKDSTRG----------------------NDNNQYLEEEFAD-----SSIEI-DY
A0A0D8ZYV0      AN-YQGRK--------------------------D-IQPGADSEFTD-----ANVEI-DY
A0A3D1PBA3      PN-YQGKR--------------------------DTDAQRPSQQYAE-----SGVKIDDY
A0A254WJ87      PN-YQGKK--------------------------DGTTPRQGEQYAD-----SGVTIDDY
A0A2T1FP73      PN-YQGKK--------------------------DGTTPRQGEQYAD-----SGVTIDDY
A0A433VMS2      PN-YQGKK--------------------------DGTTPRQGEQYAD-----SGVTIDDY
K9TYA7          PN-YQGKK--------------------------DGTTPRQGEQYAD-----SGVTIDDY
A0A2P8QUE1      PN-YQGKK--------------------------DGTTPRQGEQYAD-----SGVTIDDY
A0A2T1DWE8      PN-YQSKK---------------------------DSGAGSENQFAD-----SNVEI-DY
A0A1U7I8L3      PN-YQGKQ---------------------------EGSKNAENDFAD-----SNVEI-DY
A0A2T1DJL8      SN-YRSRK---------------------------TDNPATPS-FAD-----SNVEI-DN
A0A1Z4J9W0      SN-YRERR---------------------------SPNDTRPS-FAD-----PNVET-DA
A0A0N7Z5K9      SN-YRERR---------------------------APGDNSPS-FAD-----PNVES-DT
A0A0S3TXC5      SN-YRERR---------------------------TPGDNSVS-FAD-----PNVET-DT
A0A2T1DNG3      PNYQGKNSGADP-------------------------------FTDA-T------VEVDY
A0A2P8W9H0      TLETQIISTLNP----------------------NALS-----NQTE-----FG-NSTID
A0A3S0Y9N9      --KKNATSSLTG-VG-------------------SQLG-----QLENSV------SGKPM
A0A433UNK7      --KKNSTSSLTG-VG-------------------NQLG-----QLESSV------SGRPL
B8HNB0          --GKEQSTPLGE-------------------------------EINS-TSSYSN-WSNPL
A0A1Z4LN32      --RTDRTSSLTG-AG-------------------EEIG-----HLES-----IKREANPL
A0A2I8A9F5      --QMNRTSSLTG-IG-------------------GKIG-----DLES-----I--GSNPL
A0A218Q6R8      --QLNRTSSLTG-VG-------------------GRIG-----DLES-----I--GANPL
A0A0C1XVC4      --QSNQTSSLTG-VG-------------------EKIG-----HLES-----IKREANPL
A0A218QGE0      --QSNQTSSLTG-VG-------------------EKIG-----HLES-----IKPEANPL
A0A3B8Y8H9      TPGDSNRGLPGGINS----------------------------SLGNFLGVSTN-SDNYF
A0A1Z3HMQ0      --QVDRSTSL-TGVG-------------------DEIG-----DLEA-VN--PV-NSDPL
A0A1E5QP61      --KQNTTSALVTDAG-------------------AKIG-----QLDT-LT---Q-FNNPL
A0A3M2GIL5      --KRNTTSALVTEAG-------------------AKLG-----ELDS-VY---Q-LNSPL
A0A433NM31      --RTGSTSTV-TGLG-------------------KELG-----QLDS-LVDSPE-SNYPV
A0A3M1PML8      --RSSGAAKL-TGVG-------------------EGLG-----ELEK-LT---L-QSNPV
A0A352X442      --QKDRSASL-TGLD-------------------EALS-----QFDK-LA---Q-KSDPI
A0A0T7BPZ0      --RTNRTSSL-TGLG-------------------GDIG-----RLES-LT---Q-TNNPV
A0A0M0SHU3      --KTNRTSSL-TGLG-------------------EDIG-----RIES-LV---R-ENSPV
A0A1D2PBN3      --KTNRTSSL-TGLG-------------------EALG-----RLES-LG---V-NNNPS
A0A0C2LVR7      --KTNRTSSL-TGLG-------------------EALG-----RLES-LG---V-NNNPS
A0A1Z4PQB9      --KTNRTSSL-TGLG-------------------EALG-----RLES-LG---V-NNNPS
A0A1Z4SFN6      --KTNRSTSL-TGLG-------------------ESIG-----RIES-LT---N-TNNPL
K9PGI8          --KTNRSASL-TGLG-------------------EGIG-----QVDS-LV---N-TNSPS
A0A2W1JVB9      --IKESQSGLTE----------------------LDLG-----GISP-----LSGDSSPL
A0A3M1SVZ4      --KVSSTPSVTG-VG-------------------SEVG-----LLDP-L---TK-ENSPL
K9SSQ0          N---------------------------------------------------APTDGNSL
A0A2W1JIN9      GTPSTSVSDFGS-------------------------------TIAQ-QP-----GNGAL
A0A318AJV1      PSLNPMSQDQGQ-------------------------------GVI---------GAETM
A0A254WHG9      GKQLSLAGETGR-------------------------------DLTQ-ESARLD--SNPV
A0A2P8QIL5      GKQLSLAGETGR-------------------------------DLTQ-ESARLD--SNPV
A0A2T1FLY5      GKQLSLAGETGR-------------------------------DLTQ-ESARLD--SNPV
A0A433W447      GKQLSLAGETGR-------------------------------DLTQ-ESARLD--SNPV
K9U1K8          GKQLSLAGETGR-------------------------------DLTQ-ESARLD--SNPV
A0A1U7N2U4      NKK-VSVSELGR-------------------------------NLSQ-VPANTPGEASPI
A0A1D9G1F2      NKK-VSVSELGD-------------------------------NLSQ-VPANTPGGADPI
F4XV38          NKK-VSVSELGD-------------------------------NLSQ-VPANTPGGADPI
K9UYB2          EKRGTSVSELGR-------------------------------NLTQ-V--SNSPGNSPL
A0A0C1XJI7      DRR-VSVSELGR-------------------------------DLTS-VSSGAPGGPSPL
A0A218QN17      DRR-VSVSELGR-------------------------------DLTQ-VSSGAPGGPSPL
K9RKN2          EKQ-ISVSELGR-------------------------------DLTQ-VANSTPGGPSPL
A0A2I8ADV2      AKG-VSVSELGR-------------------------------DLTQ-P-SVVGRSSNPL
A0A1W5CKM3      DKK-ASVSELGR-------------------------------DLTQ-I-NSTAIGRNPL
Q3MEW0          DKK-ASVSELGR-------------------------------DLTQ-I-NSTAIGRNPL
A0A1Z4KIC7      DKK-ASVSELGR-------------------------------DLTQ-I-TPTGVGRNPL
Q8YSM5          DKK-ASVSELGR-------------------------------DLTQ-I-TPTGVGRNPL
A0A1Q4S1H4      DKG-VSVSDFGR-------------------------------SITQ-LNAGTPGGASAL
A0A433VBU6      SKS-VSVSALGR-------------------------------DITQ-LDAGTPGGASPL
A0A1Q4RZJ6      DRR-TSVSELGR-------------------------------DLSQ-TSITSAG-NSPL
A0A1Z4SNV3      DKR-VSVSELGR-------------------------------DLSQ-TSVSGSG-NSAL
A0A2H2XJQ1      DKR-VSVSELGR-------------------------------DLSQ-TSVSGSG-NSAL
A0A3S5K358      DRR-TSVSELGR-------------------------------DLSQ-TSVTSPG-NSPL
A0A0T7BPJ4      DKR-VSVSDLGR-------------------------------DLTQ-VTSTTPGGPSPL
A0A0C1QS61      SKQ-TSVSELGR-------------------------------NLSQ-VSSNTPGGPSPL
A0A139X3R8      NKQ-TSISELGR-------------------------------DLSQ-VSSNTPGGPSPL
A0A1Z4I7C5      DKK-ASVSELGR-------------------------------DLTQ-INSSSVG-RNPL
A0A0C2MDK7      DKR-VSVSELGR-------------------------------DLTQ-VSANAPG-ISPL
A0A1Y0RCK1      DKR-VSVSELGR-------------------------------DLTQ-VSSNSPG-NSPL
A0A1Z4PWZ0      DKR-VSVSELGR-------------------------------DLTQ-VSSNAPG-ISPL
A0A0C2QLT0      DKR-VSVSELGR-------------------------------DLTQ-VSSNAPG-ISPL
A0A1Z4J2K1      DKR-VSVSELGR-------------------------------DLTQ-VSSSGPG-ISPL
A0A3S0ZSX0      DKR-VSVSELGR-------------------------------DLTQ-MPTNIPGGPSPL
A0A2N6K4T3      QKR-VSVSELGR-------------------------------DLTQ-LSSDTPGGSNPL
A0A370CKT2      QKR-VSVSELGR-------------------------------DLTQ-LNSGTPGGSNPL
A0A0S3TL97      QKR-VSVSELGR-------------------------------DLTQ-LNSGTPGGSNPL
A0A2N6M8A0      QKR-VSVSELGR-------------------------------DLTQ-LNSGTPGGSNPL
A0A2N6M9E1      QKR-VSVSELGR-------------------------------DLTQ-LNSGTPGGSNPL
A0A2N6KJI4      QRR-VSVSELGR-------------------------------DLTQ-LNSGTPGGSNPL
A0A2N6MZ77      QKR-VSVSELGR-------------------------------DLTQ-LNSGTPGGSNPL
A0A2N6KT20      QKR-VSVSELGR-------------------------------DLTQ-LNSGTPGGSNPL
G6FSN3          QKR-VSVSELGR-------------------------------DLTQ-LNSGTPGGSNPL
A0A0D6YL98      QKR-VSVSELGR-------------------------------DLTQ-LSPGTSGNSNPL
A0A328I8B9      QKR-VSVSELGR-------------------------------DLTQ-LSPGTSGNSNPL
A0A0M0SU69      QKR-VSVSELGR-------------------------------DLTQ-LSSATPGGSNPL
A0A1Z4TIZ8      QKR-VSVSELGR-------------------------------DLTQ-LSPGTPGGSNPL
A0A318BG22      --VQREAPRVLD----------------------VNSA-----ESDS-----RPSDSMFM
A0A2T1E9V8      --KQDKTSSLIG-LD-------------------SDAQ-----AMDS-Q------SNSSL
A0A0P1C0L3      --ISQISANVTS-LD----------------------------PLENES---RVSELQYL
A0A3M2GQQ6      --DDRSSVPVVP-------------------------------GLESPY---PG-PQKDL
K9SGJ5          --IDDATISVSN----------------------LPVND----GLDKYS------KEPSL
L8MYT6          --INNSTIPVSD----------------------IQVPNAPSSGLPA-S------PVINL
A0A352JGJ6      --INNSTIAISD----------------------IQVP-----GLPG-S------SLINL
A0A1J5GLS2      --INNSTIAVSD----------------------IQIP-----GLPG-T------SSINL
A0A2W4W6M5      --INNSTIAVSD----------------------IQVP-----GLPS-A------SLINL
A0A2W7AN33      --I-NSTISAPN----------------------IQPT-----GAST-S------SMVDL
A0A256BLV2      --V-NSTIAVSD----------------------IQLP-----GLST-S------SLVNL
A0A2W6ZXF3      --INNSTIAVSD----------------------IQVP-----GLPG-A------SSINL
A0A2Z5WX66      --INNSTIAVSD----------------------IQVP-----GLPG-T------SLINL
K9W1T3          --KKNNSTSLLL-----------------------NLD-----KIDG-S---AG-AGNQI
A0A0D6YBN8      --SRESNQVTDF----------------------QGVE-----RESG-F---A--DQEFY
A0A318BJ18      --AREASQVTNF----------------------QGVE-----RQSS-L---V--DQEFY
A0A1Q4RTR1      --KANLYSSLTG-I--------------------TGGQ-----ELEM-LGRGAN-AGNPL
A0A1Z4SQV2      --RANLYSSLTG-I--------------------TESQ-----NIDV---PGIN-STNPL
A0A2H2XGN1      --RANLYSSLTG-I--------------------TESQ-----NIDV---PGIN-STNPL
A0A433UXH8      --KANLYSSLTG-I--------------------TEGQ-----NIDV---PGIN-SNNPL
A0A1Z4RMB9      --KQTSAASYTG-IG-------------------EEAG-----TLKP-I---LN-DQTPL
D5A466          --KVDRTSSLAG-IG-------------------EGLG-----ELKA-L---LA-DQTPL
K1XF69          --KVDRTSSLAG-IG-------------------EGLG-----ELKA-L---LA-DQTPL
B5W297          --KVDRTSSLAG-IG-------------------EGLG-----ELKA-L---LA-DQTPL
H1W7M8          --KVDRTSSLAG-IG-------------------EGLG-----ELKA-L---LA-DQTPL
B4WP72          --KGGRTSSLTG-LN-------------------VDIG-----ELEA-L---DSLQKDPL
A0A318B4H2      --IQRSQAKVVN----------------------VGGL-----EMED-R---SR-DLQFY
B4WQE3          TLETQIISTISP----------------------DALS-----NQSE-S---VG-VGLLD
A0A2K3BR24      --QGESQALALPTLE-------------------------------------QQGNAGPL
K9YXY1          --QGESQALALPTLE-------------------------------------QQGNAGPL
A0A2P8W4F7      --EPVTNAPPVG-LE-------------------EVVG-----AQGN-R------GALDY
U5QJM6          --EDKSSQTQVL----------------------EDAA-----QQIQ-LGGGAD-FTTQI
A0A1U7HGH0      --RQDRSSSLIG-L--------------------QSAT-----QANP-T---TQ-NDTSL
K9XJD3          --RQDRSSSLIG-L--------------------QSAT-----QANP-T---TQ-NDTSL
K9SX01          --KSQRQSNTLT-GV-------------------NSVA-----QISD-T---VA--GDPR
A0A1E5QIR9      --KKNNVTTNVTVVG-------------------KEVP-----EIHS-P------PTNPL
A0A1Z4IBC7      --MTNRTFSLTG-LP-------------------QDIG-----KLEP-L---NV-NDNPL
A0A1W5CPC7      --KTNRTSSLTG-LP-------------------QDIG-----RLEP-L---NV-NDNPL
Q3MDC6          --KTNRTSSLTG-LP-------------------QDIG-----RLEP-L---NV-NDNPL
A0A1Z4KM73      --KTNRTSSLTG-LP-------------------QDIG-----RLEP-L---NV-NDNPL
Q8YNX7          --KTNRTSSLTG-LP-------------------QDIG-----RLEP-L---NV-NDNPL
A0A367R4K6      --KTNRTSSLTG-LP-------------------EDIG-----RLEA-L---NV-NDNPL
A0A1E2WSV8      --KTNRSSSLTG-LP-------------------QDIG-----RLEA-L---NV-NDNPL
A0A2R5FRT9      --KTNRSSSLTG-LS-------------------EDIG-----RLEA-L---NV-NDNPL
A0A2K8T1B6      --KTNRSSSLTG-LS-------------------QDIG-----RLEA-L---NV-NDNPL
A0A235I9I0      --KTNRSSSLTG-LP-------------------DDIG-----RLEA-L---NV-NDNPL
A0A2D0HQT8      --KTNRSSSLTG-LP-------------------DDIG-----RLEA-L---NV-NDNPL
A0A2L2NU95      --KTNRSSSLTG-LP-------------------DDIG-----RLEA-L---NV-NDNPL
A0A367S084      --KTNRSSSLTG-LP-------------------DDIG-----RLEA-L---NV-NDNPL
A0A0V7ZFJ4      ---SDRVSALTA-LN-------------------SQMG-----EVAA-I---TG-KGNPL
A0A0V7ZNJ9      --KQSNVSSLTG-LS-------------------GAVG-----ELSG-I---TN-LSNPL
A0A367RIS1      --KESGLSSLTG-VN-------------------EQLG-----QLSG-V---TN-LSNPL
A0A235IXQ2      --KQSGVSSLTG-VN-------------------EQLG-----QLSG-V---TN-VSNPL
A0A1W5CNX3      --KQSGVSSLTG-VS-------------------EQLG-----QLSG-V---TN-LSNPL
Q3MEB7          --KQSGVSSLTG-VS-------------------EQLG-----QLSG-V---TN-LSNPL
A0A1Z4KHN9      --KQSGVSSLTG-VS-------------------EQLG-----QLSG-V---TN-LSNPL
Q8YT70          --KQSGVSSLTG-VS-------------------EQLG-----QLSG-V---TN-LSNPL
A0A218Q4C1      --KQSSVSSLTG-VS-------------------ERVG-----ELSR-L---TN-LSNPL
A0A166IWU6      --KQNSVSSLTG-VS-------------------EGVG-----ELSG-L---TS-SSNPL
A0A2S0Q8C0      --KQNSVSSLTG-VS-------------------EGVG-----ELSG-L---TN-SSNPL
W6FSX4          --KQNSVSSLTG-VS-------------------EGVG-----ELSG-L---TS-SSNPL
A0A1B7WTD1      --KKDAASSLSS-LS-------------------DKMG-----ELGG-L---TN-LSNPV
A0A1B7WX82      --KKGVASSLTTNIS-------------------QQMG-----ELGG-L---TN-LSNPV
A0A0R0M9H9      --KKDGVSSLTS-LA-------------------TSVG-----ELGG-I---GN-NSNPI
A0A1S1ZVW2      --KKDGVSSLTS-LA-------------------TSVG-----ELGG-V---GN-NSNPI
A0A1Z4LRU5      --KNNNVSSLSG-LG-------------------GQIG-----ELSG-I---TN-LSNPL
A0A1Z4JVB4      --KQNGISSFSD-IA-------------------AKAG-----ELRG-L---TS-FSNPV
K9PIA4          --KQNGVSSLTG-FS-------------------SKMG-----ELGG-L---TN-LSNPV
A0A1Z4M597      --KQNGVSSLTG-LS-------------------SQVG-----ELSG-L---TN-LSNPV
A0A1Z4MWT1      --KQNGVSSLTG-LS-------------------SQVG-----ELSG-L---TN-LSNPV
A0A1Z4TX53      --KQNGVSSLTG-LS-------------------SQVG-----ELSG-L---TN-LSNPV
A0A1Z4HVE1      --KQNGVSSLTG-LS-------------------SQVG-----ELSG-L---TN-LSNPV
A0A252ECZ1      --KQSGVSSLSG-LS-------------------SQVG-----ELSG-L---TN-LSNPV
A0A1Z4G5Y1      --KQSGVSSLTG-LS-------------------SQVG-----ELSG-L---TN-LSNPV
A0A252DNA2      --KQSGVSSLTG-LS-------------------SQVG-----ELSG-L---TN-LSNPV
A0A252E1Q4      --KQSGVSSLTG-LS-------------------SQVG-----ELSG-L---TN-LSNPV
A0A2A2TNQ5      --KQNEASNLTG-LN-------------------QKLG-----ELSG-L---TN-TSNPL
A0A3S1C4K5      --KNNGASSLTG-LS-------------------EKVG-----ALSA-L---TN-TSSPL
A0A1X4G3D5      GDRVSSLTRLGG-LA-------------------ELAQ-----LTGA-T---GS-GGSGL
D4TNI2          GDRVSSLTRLGG-LA-------------------ELAQ-----LTGA-T---SS-GGSGL
A0A1Z4H6Z8      --KQSGASSLSG-LS-------------------SQVG-----ELSG-L---TN-LSNPV
A0A1Z4NPM1      --KQNSSSSLIG-LS-------------------DKLG-----ELSG-L---TN-TSNPL
A0A3F3KPR9      --KKDGVSSLTS-LA-------------------TSVG-----ELGG-L---GN-NSNPI
D4TGN7          --KKDGVSSLTS-LA-------------------TSVG-----ELGG-L---GN-NSNPI
A0A1Z4UZW9      --KKSGASSLTS-LS-------------------QQMG-----ELGA-L---TN-LSNPV
A0A0K2M5H0      --KKSGASSLSS-LS-------------------QQMG-----ELGA-L---TN-LSNPV
A0A1B7VSH4      --KKSGASSLSG-LS-------------------QQMG-----ELGA-L---TN-LSNPV
A0A1B7W126      --KKSGASSLSG-LS-------------------QQMG-----ELGA-L---TN-LSNPV
A0A3D4C6Q6      --KKSGASSLSG-LS-------------------QQMG-----ELGA-L---TN-LSNPV
K7W0A4          --KKSGASSLAG-LS-------------------QSLG-----ELGG-L---TN-LSNPV
A0A1B7UTR1      --KRSGASSLAD-IS-------------------QSMG-----ELGG-L---TN-LSNPV
A0A1B7UVJ4      --KRSGASSLAD-IS-------------------QSMG-----ELGG-L---TN-LSNPV
A0A2T1CIL7      --RIDKSSQLVG-LE-------------------EERG-----QIEV-I---GK-DSNPV
A0A1Z4RPC6      --KKNSVDSFLD-LQ-------------------SKPE-----QLNS-I---LP-DQTPL
A0A2T1CMZ0      --KKNTPNELLN-LS-------------------ENTN-----EFNS-L---LN-TQTPL
L8M4F7          --KSSSLASLTG-VA-------------------KNSS-----ALET-LNYSLG-QQSPL
L8LZE9          --EPQD--NLTD-LG-------------------NPSN-----DLQS-L---TV-GATPL
A0A140K2P2      --KQNSTASLTG-VG-------------------KNVG-----ELKP-L---LV-NQSPL
K9XWX4          --KQNSTASLTG-VG-------------------ENVG-----ELKP-L---LV-NQSPL
A0A140KB14      --KQNNTASLTK-VG-------------------QGVG-----ELKP-L---LN-DQSPL
K9XX88          --KQNNTASLTK-VG-------------------QGIG-----ELKP-L---LN-DQSPL
A0A433V7A0      --RVDTTPFLIG-IKTKD----------------ENVS-----PLVP-L---TF-EGNPL
A0A0C2LBE2      --KTNRTSSLTG-LG-------------------EAIG-----RLDT-L---TM-ESNPS
A0A433NN38      --KTNRTSSLTG-LG-------------------EDLG-----RLEA-L---VS-QSSPV
A0A2N6K0T2      --KTNRTSSLTG-LG-------------------EDLG-----RLES-L---VQ-DNSPV
A0A2N6ML72      --KTSRTSSLTG-LG-------------------EDLG-----RLES-L---VQ-DNSPV
G6FQZ6          --KTSRTSSLTG-LG-------------------EDLG-----RLES-L---VQ-NNSPV
A0A2N6MQX9      --KTSRTSSLTG-LG-------------------EDLG-----RLES-L---VQ-DNSPV
A0A2N6KXT6      --KTSRTSSLTG-LG-------------------EDLG-----RLES-L---VQ-NNSPV
A0A2N6KGB9      --KTSRTSSLTG-LG-------------------EDLG-----RLES-L---VQ-DNSPV
A0A2N6L3Y5      --KTSRTSSLTG-LG-------------------EDLG-----RLES-L---VQ-DNSPV
A0A0S3TIS7      --KTSRTSSLTG-LG-------------------EDLG-----RLES-L---VQ-DNSPV
A0A1U7GW28      --KTSRTSSLTG-LG-------------------EDLG-----RLES-L---VQ-DNSPV
A0A2N6LW63      --KTSRTSSLTG-LG-------------------EDLG-----RLES-L---VQ-DNSPV
A0A1Z4TQ63      --KTNRASSLTG-LG-------------------EDIG-----RLES-L---AE-NNTPL
A0A0D6YFE2      --KTNRTSSLTG-LG-------------------EDIG-----RLES-L---VR-ENSPV
A0A328IH74      --KTNRTSSLTG-LG-------------------EDIG-----RLES-L---VR-ENSPV
A0A1Z4NDS1      --KTNNTPSLTG-LG-------------------EAIG-----KLES-L---TR-DSNPS
K9F4D9          --ELSNQASALV-GLE------------------GGNR-----ELRA-L---TN-LDNPL
U9VXM0          --ELSNQTSSLV-GFE------------------GGTR-----ELRA-L---TN-LDNPL
A0A2T1FTR8      --KKTNKTSALL-SSATNAASG------------GAIG-----ELEG-L---TG--STPV
K9UA41          --KKTNKTSALL-SSATNAASG------------GAIG-----ELEG-L---TG--STPV
A0A1Z4SMD6      --QSNRTSSLTK-VG-------------------EKIG-----DLES-V---MR-EGNPL
A0A2H2Y096      --QSNRTSSLTK-VG-------------------EKIG-----DLES-V---MR-EGNPL
K9S8M8          --KKKNTTSALV-TDAS-----------------AKVG-----ELDT-L---SD-KDTPL
A0A1Z4NFV0      --QSNRTSAYTK-IG-------------------ENTG-----SLES-L---RH-ESNPL
B0CAX4          --KKQGGATIAD-LEI------------------GGLG-----GLEA-L---SS-KSSPV
U5DPF5          --QTADGAIPFA-GFSGGSST----------------------------------SNTLL
A0A350Y0P6      --QKRSATSALV-TEAG-----------------EKIG-----QLEA-L---NNFINTPL
A0A352X940      --QKKNKTSALV-TKAG-----------------EKIG-----ELDS-L---NAFINTPL
B8HTN4          --KDSENPLASM-GA-------------------TSVG-----NLVA-L---GG-KSSPI
A0A2A2TPF8      --QANRTNSLTG-VD-------------------GKFR-----DLES-I---RR-EANPL
A0A1Z4R0P8      --QANRTNSLTG-VD-------------------GKFR-----DLES-I---RR-EANPL
A0A0T7BUI3      --KSDRISSLTK-AG-------------------EKIG-----DLES-L---IR-ENNPL
A0A1Z4LP32      --KSDRISSLTK-AG-------------------EKIG-----DLES-L---MR-EGNPL
K9REP9          --KSDRISSLTK-AG-------------------EKIG-----DLES-L---MR-EGNPL
A0A1Z4SIJ3      --KSDRISSLTK-AG-------------------EKIG-----DLES-L---MR-QGNPL
A0A2H2XPG4      --KSDRISSLTK-AG-------------------EKIG-----DLES-L---MR-QGNPL
K9V3C7          --QTNRTSSLTG-VG-------------------EKIG-----SLES-F---RN-EANPL
A0A1Z4T6Y7      --QTNRASFLTG-VG-------------------EKIG-----DLET-V---RR-EANPL
A0A2H2Y561      --QTNRASFLTG-VG-------------------EKIG-----DLET-V---RR-EANPL
A0A1Q4S362      --QANRASLLTG-VG-------------------EKVG-----DLES-V---RR-EANPL
A0A3S1CIN8      --QANRASLLTG-VG-------------------EKVG-----DLES-V---RR-EANPL
A0A2A2TC28      --KSDRTSSLTK-VG-------------------EKIG-----DLES-L---MR-EGNPL
A0A0C1NCB0      --QSDRTSSLTK-AG-------------------EKIG-----HLES-L---MR-EGNPS
A0A2N6K7Q9      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A2N6MXH6      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A2N6M5A8      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A2N6LL61      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A0S3TP66      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
G6FP91          --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A1U7GYR5      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A2N6KY52      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A2N6KMP5      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A2N6MA45      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A1Z4TLC8      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A0M0SFT2      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A0D6Y7R4      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A328IGA1      --KSDRTSSLTK-VG-------------------EKIG-----DLEA-L---MR-EGNPL
A0A0C2LFH0      --KSDRTSSLTK-VG-------------------EKIG-----DLES-L---MR-EGNPL
A0A1Z4IYV4      --QSDRTSSLTK-VG-------------------EKIG-----DLES-L---MR-EGNPL
A0A1Z4Q0T6      --KSDRTSSLTK-VG-------------------EKIG-----DLES-L---MR-EGNPL
A0A0C2PT44      --KSDRTSSLTK-VG-------------------EKIG-----DLES-L---MR-EGNPL
A0A1D2P6J4      --KSDRTSSLTK-VG-------------------EKIG-----DLES-L---MR-EGNPL
A0A3M9ZEU1      --KADRSSSLVG-LTK------------------VETG-----ELQA-L---TT-ANSPV
A0A1Z4JK72      --QSNRTTSLTG-VGE-------------------KVG-----TLES-L---KR-EGNPL
A0A0N7Z489      --QSNRTTSLTG-VGE-------------------RVG-----TLEA-L---RR-EGNPL
A0A0S3TXS2      --QSNRTTSLTG-VGE-------------------RVG-----TLEA-L---RR-EGNPL
A0A1Z4RN12      --KPDRTSKLIG-ID-------------------TNPE-----EIKG-L---TQ-DKDPI
A0A2T1CMF9      --EPEQTSRRIG-IE-------------------DGNP-----EVKK-T---VL-EKDPI
Q7NDC5          --KQKDTAIDNP-T-AVGLR--------------GALG-----QMGS-----VA-YGNPL
U5QGK3          --KQKDTAVGSE-NPARSLR--------------GSLG-----QLDS-----VA-FGNPL
A0A2W4UY24      --ESSKPVTAIV-GLD------------------TGEG-----NLTP-L---TS-QSNPL
A0A254WLE3      --KKNDQTAALT-GLG------------------QGIG-----DLEG-L---NL-QSNPV
A0A433W533      --KKNDQTAALT-GLG------------------QGIG-----DLEG-L---NL-QSNPV
A0A2P8QWJ3      --KKNDQTAALT-GLG------------------QGIG-----DLEG-L---NL-QSNPV
A0A2T1FKP8      --KKNDQTAALT-GLG------------------QGIG-----DLEG-L---NL-QSNPV
K9U6L7          --KKNDQTAALT-GLG------------------QGIG-----DLEG-L---NL-QSNPV
A0A2T1GMT4      --KNSTFRVIGP-NLIPNSMEG------------SESG-----DLKS-L---VS-TQNPI
K9UI51          --KNSTFRVIGP-NLIPSNMEG------------SESG-----DLKS-L---VS-NQNPI
K9TYI2          --KTPSFNVVGS-NLLPSISEG------------QETG-----DLRA-L---VS-TQNPV
A0A254W5G5      --KIPSFNVVGS-NLLPSISEG------------QGTG-----DLRA-L---VS-TQNPI
A0A2T1FXY4      --KTPSFNVVGS-NLLPSISEG------------QETG-----DLRA-L---VS-TQNPI
A0A1Z4QL41      --KVPSFQILGT-NLLPNSSEG------------GGIG-----DLKP-L---VS-TQNPI
A0A252D4T4      --KTPSFNVVGT-NLLPSDSEG------------GTSG-----DLKP-L---VS-TQNPI
A0A252DJH5      --KTPSFNVVGT-NLLPSDSEG------------GTSG-----DLKP-L---VS-TQNPI
A0A252EB80      --KTPSFNVVGT-NLLPSDSEG------------GGSG-----DLKP-L---VS-TQNPI
A0A1Z4HPW5      --KTPSFNVVGT-ELLPTETQ--------------ARG-----DLRP-L---VS-TQNPI
A0A1Z4MSN1      --KTPSFNVVGS-ELLPSESQ--------------ARG-----DLRP-L---VS-TQNPI
A0A1Z4U1C2      --KTPSFNVVGS-ELLPSESQ--------------ARG-----DLRP-L---VS-TQNPI
A0A0D6KV51      --KTPTFNVVGS-ELLPSESQ--------------ARG-----DLRP-L---VS-TQNPI
A0A1Z4MKF8      --KTPTFNVVGS-ELLPSESQ--------------ARG-----DLRP-L---VS-TQNPI
A0A2C6WC43      --RIPSFKVVGS-NLLPTTTEG------------GSTG-----DLKS-L---IA-SQNPI
A0A1Z4L5A1      --RIPSFKVVGS-NLLPTTTEG------------GSTG-----DLKS-L---IA-SQNPI
A0A367QD86      --RIPSFKVVGS-NLLPTTTEG------------GSTG-----DLKS-L---IA-SQNPI
A0A235IZ96      --RVPSFKVAGS-NLSPGSSEG------------GDSG-----DLKA-L---VA-TQNPV
A0A2L2NGP0      --RVPSFKVAGS-NLSPGSSEG------------GDSG-----DLKA-L---VA-TQNPV
A0A2K8SM78      --RIPSFKVVGS-NLFPTNAEG------------GDPG-----DLKS-L---LA-TQNPI
A0A2R5FPC0      --RIPSFKVVGS-NLFPTNAEG------------GDPG-----DLKS-L---LA-TQNPI
K9QM62          --RIPAFNIVGS-NLLPNSSEG------------EFRG------LRA-L---VS-TQNPI
A0A1Z4FWI3      --KSPSFNVVGT-NLLPNGSEG------------QATG-----DLKS-L---VS-NQNPI
A0A1Z4JYE7      --RIPSFKTIGT-NLLPNNNEG------------DAAG-----DLKS-L---VS-TQNPI
A0A140KBA0      --KTNKSAKL--------TGLE------------NDIG-----KIEV-L---TN-ESDPL
K9XSG1          --KTNKSAKL--------TGLE------------NDIG-----KIEV-L---TN-ESDPL
A0A0F5YE28      --KVDRTSSL--------AGIG------------EGLG-----ELKA-L---LA-DQTPL
U7QEH7          --KVDRTSSL--------AGIG------------EGLG-----ELKA-L---LA-DQTPL
A0A3S1ATK5      --KLPSFQVLGN-NLLRSNSEG------------E--G-----DLKS-L---VS-TQNPI
A0A2Z6CPH0      --RMPSFKTVGT-NLLPNNNEG------------DQAG-----DLKS-L---VS-TQNPI
A0A1Z4GT50      --KTPSFKVIGS-NLLPNNSEG------------EEA------DLKP-L---VS-TQNPI
A0A1Z4GIX0      --RMPSFNVVGT-NLLPSNNEG------------EETG-----DLRS-L---VS-TQNPI
A0A2H6LC24      --RMPSFNVVGT-NLLPSNNEG------------EETG-----DLRS-L---VS-TQNPI
B2J6N5          --RIPSFKVVGS-NLLPTNTEG------------GDAG-----DLKS-L---LA-TQNPI
A0A367RMI4      --RVPSFKVAGN-NLYPDTSEG------------GDAG-----DLKP-L---VA-TQNPI
A0A235HUM0      --RVPSFKVAGN-NLSPGTSEG------------GDSG-----DLKP-L---VA-TQNPI
A0A2L2NW47      --RVPSFKVGGN-NLSPGTAEG------------GDSG-----DLKP-L---VA-TQNPI
A0A1E2WUR1      --RLPSFKVAGT-NLSPGSSEG------------GDSG-----DLKP-L---VA-TQNPI
A0A235IKU3      --RVPSFKVAGS-NLSPGSSEG------------GDSG-----DLKA-L---VA-TQNPV
F4XKF3          --KIDRTAFL--------TGLG------------EEID-----QLRP-L---VD-AQNPL
A0A1D9FX10      --KIDRTAFL--------TGLG------------EEID-----QLRP-L---VD-AQNPL
A0A1D8TNX9      --KIDRTAFL--------TGLG------------EEID-----QLRP-L---VD-AQNPL
A0A1U7MYU6      --KIDRTAFL--------TGLG------------EEIE-----QLRP-L---VD-AQNPL
A0A3C0NJ41      --KVNRTASL--------TGVGQVERLEGGQTAQQPVG-----GLGA-L---TQ-TGNPV
A0A352AG88      --KVSRTADL--------TGVG------------QQVG-----ELAP-L---TT-NSNPI
A0A350Y374      --KVNRTTSL--------TGLG------------KEVG-----NFAP-L---TT-DSNPI
A0A355DPX0      --KVNRTTSL--------TGLG------------KEVG-----NFAP-L---TT-DSNPI
A0A0D8ZUV2      --KRVNETSAAT-GLGS------------------QIG-----ELDT-L---AQ-QTNPL
A0A433VDI0      --KKVDWASAAT-GVGE------------------QIG-----ELDT-L---AQ-QSNPL
A0A3D1PG43      --KKIDNASSVT-ELSQ-----------------TDNS-----ELEP-L---SQ-LGNPS
A0A2P8QQ72      --KKPSETSSLN---PE-----------------KYEP-----RLEP-L---SA-ESNPV
K9TZQ7          --KKPSETSSLN---PE-----------------KYEP-----RLEP-L---SA-ESNPV
A0A2G7GPR0      --KRADRTTAIS-GLKD-----------------INVG-----ELEA-I---AT-KANPL
K9XH68          --RKADRTTAIS-GLKD-----------------INVG-----ELEA-L---AT-KANPL
A0A1U7HW70      --RKADRTTAIS-GLKD-----------------INVG-----ELEA-I---AT-KANPL
A0A2S6VEJ8      --RKADRTAAIS-GLKD-----------------INVG-----ELEA-L---AA-KANPL
                                                                            

K9SLA9          ANEAAVIKSNAIAKEVVGVLNQTATENEL-------------------------------
A0A168TT23      QTQYEILRGRQLAENVVEKLEVWDHPELS----------------GEISQRNLYRELRAL
A0A0M1JWX9      QSQIALLRSPKLMEPIIQQLKP------K----------------YPE------------
A0A2T1M1V6      YTQSAILMSDSVLGRVLTVDPE------K----------------S--------------
A0A2G7GCS2      QIQMTILTSDTVMERALAVDPE------K----------------S--------------
K9XBH8          QTQLSILTSDTVMQRVLSVDPE------K----------------S--------------
A0A1Z4LJ30      NILSSVAMSDRVIQEVWQNDPE------K----------------A--------------
K9RI76          NILSSIATSDHVVEEVWQNDPE------K----------------S--------------
A0A352AE27      KVQAYILTSDALMQRLWASDTE------N----------------S--------------
A0A3B8JH60      KVQASILTSDELLQKARAIDPE------K----------------N--------------
A0A3C0N766      KVQASILTSDELLQKARAIDPE------K----------------N--------------
K9W9J7          KVQASILTSDALLEQVLVSDPQ------K----------------T--------------
A0A139WSU3      NVQASILTSDTLLEKVLASDPE------R----------------G--------------
A0A433VN22      KVQTSILMSDALLEKVLDSDPE------K----------------N--------------
Q7NF11          KVQSAILTSSEVLSKAWQADPQ------R----------------E--------------
A0A1Z4JCS8      KIQEAILTSDAILEKAWAADPE------R----------------D--------------
F4XTX2          NMQASILKSDALMRRLLESDPE------K----------------T--------------
Q7NJN6          SIQSNILLSSDVLRPVWQKDPE------R----------------T--------------
U5QCC3          TIQSNILLSDSVLRRVWLKDPE------K----------------Q--------------
A0A0S3TYD7      TTQAELIKSLPIVQRTIEDLNL------Q----------------DDD------------
U5QL42          ETEIQILKSRSLIGRAIHRLAP------P----------------FNI------------
K9QF04          KTEIEVLASYKVISPLLPTIQS------R----------------YPD------------
A0A3C0N2P0      DTQIQVLWSPQVLSKIVKEIQT------R----------------YPD------------
K9TLQ0          ETQMEVLLSSPIINPIFTNIQQ------N----------------YPE------------
A0A076HBF2      PTLIEVLQSPVLLQPVADKFEL------T----------------TDA------------
A0A354B169      PTLIEVLRSPMLLNPIAQHFDL------T----------------YLN------------
G4FMX5          PTLIELLQSPLLLSPIAERFDL------S----------------ENG------------
Q0IDT5          PTLIEVLESPLLLAPIAKRFDV------S----------------ENE------------
A0A2D6FCW3      PTLIELLQSPLLLSPIAQRYDL------N----------------ANA------------
A3ZA21          PTLIEVLQSPLLLAPIAKRFDL------A----------------ENA------------
A0A140K3H3      STEVLVLRSYPLIAKAVKQVQQ------K----------------YGD------------
K9XUB8          STEILVLRSYPLIAKAVEKVQQ------E----------------YSD------------
Q7NEU3          NTQIEVLLRRPLIEKALRVLRP------K----------------FPE------------
A0A352XE00      ETQIQVLWSSQIMIPIVKKIQA------Q----------------YPE------------
B4VS56          ETQIQVLWSPQVMTPIVEQIQS------R----------------YPE------------
A0A352AAQ3      ETQIQVLWSPQVMAPIVKKIQA------R----------------YPT------------
A0A350Y472      ETQIQVLWSPQVMAPIVAQIQS------R----------------YPE------------
A0A355DVB4      ETQIQVLWSPQVMTPIVKQIQS------R----------------YPE------------
A0A2P8VVX1      ATQLALMRSGQFLQEAVDVLRT------D----------------YPE------------
A0A2P8WHY0      NTQLTLMRSEQFLREAVASLEA------E----------------YPD------------
A0A2T1CMT9      TTQIKVLTSHEILQRVVNQLKL------KDQRSEQASSSYGGVISDSE------------
A0A1D8TX52      ATQLQLMGSSELIQRAVDLLRD------D----------------YPD------------
A0A1U7N5X9      ATQLQLMRSSELMKRAVELLRD------D----------------YPN------------
A0A1D9G4T2      ATQLQLMRSSELIQRAVDLLRD------D----------------YPD------------
F4XP71          ATQLQLMRSSELIQRAVDLLRD------D----------------YPD------------
A0A2P8QVH5      TAQLSVMTSPKLVERAVELLRP------E----------------YPN------------
A0A2T1FT70      TAQLSVMTSPKLVERAVELLRP------E----------------YPN------------
A0A433W4W4      TAQLSVMTSPKLVERAVELLRP------E----------------YPN------------
K9U5W1          TAQLSVMTSPKLVERAVELLRP------E----------------YPN------------
A0A254WLA7      TAQLSVMTSPKIVERAVELLRP------E----------------YPN------------
A0A2W6ZAV2      PVLIEVLTSPLLLEPIAQRL---------------------------N------------
A0A2G7GMH8      ATQINLMSSSILLQRAVSLLQP------E----------------YPD------------
K9W742          ATQLNLMQGSQLLQKALDLLRP------D----------------YPD------------
K9SA61          STQLQLMKSSQLLQRAVDQLKP------T----------------YPD------------
A0A350Y7Z1      ATQLNLMRSSQLIQKAVDRLHP------K----------------YPE------------
A0A352X2A7      TTQINLMRSSQLIQRAVNLLQD------K----------------YPT------------
K9XPB0          PTQLKLMRSSYLLKKVVKKLGV------E----------------GSD------------
A0A0D8ZYV0      ATQINVMRSTLLLQRAVDLLKP------E----------------YPD------------
A0A3D1PBA3      ATQINVMRSSLLLQRAADILRP------E----------------YPT------------
A0A254WJ87      ATQINVMRSSLLIQRAVDILRS------E----------------YPT------------
A0A2T1FP73      ATQINVMRSSLLIQRAVDILRS------E----------------YPT------------
A0A433VMS2      ATQINVMRSSLLIQRAVDILRS------E----------------YPT------------
K9TYA7          ATQINVMRSSLLIQRAVDILRS------E----------------YPT------------
A0A2P8QUE1      ATQINVMRSSLLIQRAVDILRS------E----------------YPT------------
A0A2T1DWE8      STQLTQMRSSQLLQKAVVLLQA------E----------------YPK------------
A0A1U7I8L3      ATQLNLMRSSQLIQKAVDLLRP------Q----------------YPK------------
A0A2T1DJL8      ATQLNLMRSSQLLQRAVDQLKL------N----------------GSN------------
A0A1Z4J9W0      ATQVNLMRSGQLLQRAVDQLKP------R----------------YSD------------
A0A0N7Z5K9      ATQVNLMRSTQLLQRAVDELQP------R----------------YSD------------
A0A0S3TXC5      ATQVNLMRSTPLLQRAVDELKP------R----------------YSD------------
A0A2T1DNG3      ATQISLMQSSNLLKKAMTLLQTEYPELDP----------------D--------------
A0A2P8W9H0      ETRLRILTSPRVIEPILKELQK------S----------------Q--------------
A0A3S0Y9N9      GTEVAVLRSLPIAERTINALSL--------------------------------------
A0A433UNK7      GTEVAVLRSLPLAEQTINAIRL--------------------------------------
B8HNB0          INEIQVLQSSSLVTKAQQQLKP------P----------------HNK------------
A0A1Z4LN32      DTQAIILQSEPIIKDVVKSLEL------K----------------G--------------
A0A2I8A9F5      DTQALLVRSKPILEEVVNTLNL------K----------------D--------------
A0A218Q6R8      DTQALLVRSTPIIEDVINTLEL------K----------------D--------------
A0A0C1XVC4      DTQAIVMQSEPVILDVIKTLNL------K----------------D--------------
A0A218QGE0      DTQAIVMQSEPVMQDAIETLKL------K----------------D--------------
A0A3B8Y8H9      LTQIQILYSYKIIAPVLEKLNKVFPPETE----------------E--------------
A0A1Z3HMQ0      STQAAILSSLPVLQEAVNALDL------Q----------------D--------------
A0A1E5QP61      DTEAEVISSMPIVKETVEALNF------R----------------D--------------
A0A3M2GIL5      DTEAEIISSTPIIEQTIAELQL------K----------------G--------------
A0A433NM31      NTQAEIINSVAFAQRTINELDL------K----------------N--------------
A0A3M1PML8      DSQAQIIQSAPIVSEVIRSLDL------R----------------D--------------
A0A352X442      ATAAAIVKSRPIAEKTVAELNL------R----------------D--------------
A0A0T7BPZ0      ETQAKIVASVPVIQKTIRSLDL------K----------------D--------------
A0A0M0SHU3      DTQAKIVISVPVIQETITSLSL------K----------------N--------------
A0A1D2PBN3      DTQAKIVASVPVIQETITELDL------R----------------D--------------
A0A0C2LVR7      DTQAKIVASVPVIQETITELDL------R----------------D--------------
A0A1Z4PQB9      DTQAKIVVSVPVIQETITELDL------R----------------D--------------
A0A1Z4SFN6      ETQAKIVESVPVIQETIRTLNL------K----------------D--------------
K9PGI8          DTQAKIVVSVPVIQETIRVLKL------K----------------N--------------
A0A2W1JVB9      DTEIETILSVPVLQEALKQLKL------T----------------DDE------------
A0A3M1SVZ4      DTEAEIISSVPIVEQTIAALQL------K----------------NSE------------
K9SSQ0          STQAAILASRPLIETALPKIPA-----NL----------------STN------------
A0A2W1JIN9      ANQEEIVSSKRLLERAL----------QS----------------YRQ------------
A0A318AJV1      ETEAGLMASRGLAVAVVRKLHL---DRDP----------------EFA------------
A0A254WHG9      ATQAELALSQKVLRQAIYEAYT-----AN----------------NRN------------
A0A2P8QIL5      ATQAELALSQKVLRQAIYEAYT-----AN----------------NRN------------
A0A2T1FLY5      ATQAELALSQKVLRQAIYEAYT-----AN----------------NRN------------
A0A433W447      ATQAELALSQKVLRQAIYEAYT-----AN----------------NRN------------
K9U1K8          ATQAELALSQKVLRQAIYEAYT-----AN----------------NRN------------
A0A1U7N2U4      ATQAELVGSQRVLQGALYQIGI------------------------LG------------
A0A1D9G1F2      ATQAELVGSERLLQGALDEIAL------------------------LG------------
F4XV38          ATQAELVGSERLLQGALDEIAL------------------------LG------------
K9UYB2          ANQAEVVKSERVLQKALEIASA-----KT----------------SPE------------
A0A0C1XJI7      ANQAELVKSERVLERAIALASL-----KS----------------YNG------------
A0A218QN17      ANEAELVKSQRVLERAIALASL-----KS----------------YNG------------
K9RKN2          ADQAELVKSQRVLEKAIKIFSS-----QY----------------KIK------------
A0A2I8ADV2      ADQAELVKSQAVLDQAIKTLA-------------------------SK------------
A0A1W5CKM3      ADQAELLKSQTVLQLAISKLNP-----PI----------------KDS------------
Q3MEW0          ADQAELLKSQTVLQLAISKLNP-----PI----------------KDS------------
A0A1Z4KIC7      ADQAELLKSQTVLQLAISKLNP-----PI----------------KDS------------
Q8YSM5          ADQAELLKSQTVLQLAISKLNP-----PI----------------KDS------------
A0A1Q4S1H4      GDQAELIKSQQVLEKALTALKA-----NS----------------QTA------------
A0A433VBU6      ADQAELIKSQQVLEKALTALKA-----NP----------------QTA------------
A0A1Q4RZJ6      ANQAELIKSERILTQALAIAGN-----SD----------------GGQ------------
A0A1Z4SNV3      ANQAELIKSERILNQALAI--------AE----------------TSE------------
A0A2H2XJQ1      ANQAELIKSERILNQALAI--------AE----------------TSE------------
A0A3S5K358      ANQAELIKSERILTQALAIVGNSDVENSE----------------DGQ------------
A0A0T7BPJ4      ADQAELVKSEKVLEKAIAATYP-----PG-------------------------------
A0A0C1QS61      ADQAELVKSQRVLNRALQIFKS-----SY----------------K--------------
A0A139X3R8      ADQAELAKSQRVLNRALQIFQS-----SH----------------K--------------
A0A1Z4I7C5      ADQAEFLKSQPVLQLAISKLNR-----QQ----------------G-N------------
A0A0C2MDK7      ADQAELIKSQRVLERAIAIAFP-----QT----------------KGN------------
A0A1Y0RCK1      ADQAELIKSQRVLERAIAIAFP-----QI----------------KGN------------
A0A1Z4PWZ0      ADQAELVKSQRVLERAIAIAFP-----EI----------------KGN------------
A0A0C2QLT0      ADQAELIKSQRVLERAIAIAFP-----EI----------------KGN------------
A0A1Z4J2K1      ADQAELIKSQRVLEQAVAIAFP-----EI----------------KGN------------
A0A3S0ZSX0      ADQAELIKSQRVLRRAIARVIP-----QL----------------NSS------------
A0A2N6K4T3      ADQAELIKSQRVLQRALTEVTA-----ES----------------GFR------------
A0A370CKT2      ADQAELIKSQRVLQRALTEVTA-----ES----------------GFR------------
A0A0S3TL97      ADQAELIKSQRVLQRALTEVTA-----ES----------------GFR------------
A0A2N6M8A0      ADQAELIKSQRVLQRALTEVTA-----ES----------------GFR------------
A0A2N6M9E1      ADQAELIKSQRVLQRALTEVTA-----ES----------------GFR------------
A0A2N6KJI4      ADQAELIKSQRVLQRALTEVTA-----ES----------------GFR------------
A0A2N6MZ77      ADQAELIKSQRVLQRALTEVTA-----ES----------------GFR------------
A0A2N6KT20      ADQAELIKSQRVLQRALTEVTA-----ES----------------GFR------------
G6FSN3          ADQAELIKSQRVLQRALTEVTA-----ES----------------GFR------------
A0A0D6YL98      ADQAELIKSQRVLQKALAKVAA-----ES----------------GFS------------
A0A328I8B9      ADQAELIKSQRVLQKALAKVAA-----ES----------------GFS------------
A0A0M0SU69      ADQAELIKSQRILQKALTKVAA-----ES----------------GFS------------
A0A1Z4TIZ8      ADQAELIKSQRVLQKALAKVSA-----ES----------------GFS------------
A0A318BG22      ETQLAFIRSRAMAEGIVKRLHL------D----------------QNDAFVDDA------
A0A2T1E9V8      NTESRLILSENILRKILDIVNE------N----------------SSQ------------
A0A0P1C0L3      NTQYELLESRFMATRVADAASL------E----------------T-DPAFIEAFDL---
A0A3M2GQQ6      STEIQILRSHALVAKAIAALG---------------------------------------
K9SGJ5          DTEIAILKSRSLIEPAVAQLDN------I----------------DPT------------
L8MYT6          GTEIGILKSRPLIESAIAKMRQ------S----------------SDG------------
A0A352JGJ6      GTEIGILRSRPLIEVAVTKIKQ------S----------------SAS------------
A0A1J5GLS2      GTEIGILRSRPLIEVAVAKMKQ------S----------------PTA------------
A0A2W4W6M5      GTEIGILRSRPLIEVAVSKMRQ------S----------------PSA------------
A0A2W7AN33      GTEIAILKSRPLIETAVCKMQQ------S----------------PTA------------
A0A256BLV2      GTEVAILKSRPLIEIAVSKMQQ------S----------------PSA------------
A0A2W6ZXF3      GTEIGILRSRPLIEIAVAKMRQ------S----------------PTA------------
A0A2Z5WX66      GTEIGILRSRPLIEVAVAKLQQ------S----------------ASS------------
K9W1T3          NTQAELINSIPVAQETIATLNL------S----------------Q--------------
A0A0D6YBN8      QTQYGLLQSRVLAERVAVQLRL------V----------------DDPSFFERFGVDQDD
A0A318BJ18      ETQYGLLRSRALSERVATQLRL------V----------------DDPKFYEMYKFNSDD
A0A1Q4RTR1      ETQAEIIRSQPVIQKTIDILEL------K----------------N-K------------
A0A1Z4SQV2      ETQAEIIRSQPLVQKTIDTLEL------R----------------N-N------------
A0A2H2XGN1      ETQAEIIRSQPLVQKTIDTLEL------R----------------N-N------------
A0A433UXH8      ETQAELIRSQPLVQKTIDALEL------K----------------N-S------------
A0A1Z4RMB9      TTQIQVLRSEPVVQQVIDQLKL------T----------------D-N------------
D5A466          STQIELMHSNPLLETVIERLNL------T----------------N-E------------
K1XF69          STQIELMYSNPLLETVIERLNL------T----------------N-E------------
B5W297          STQIELMYSNPLLETVIERLNL------T----------------N-E------------
H1W7M8          STQIELMYSNPLLETVIERLNL------T----------------N-E------------
B4WP72          RTQAEIIQSLPTLEKAIATAEA------A----------------V--------------
A0A318B4H2      ETQYNLLKARSLAERVARVLGL------Q----------------NDDKFFAMYGGEEPS
B4WQE3          DTKLKILTSPRVLVSAVEELEK------T----------------YPD------------
A0A2K3BR24      TNQSQIMQSAPMLQEVIDRLGL------K----------------N-D------------
K9YXY1          TNQSQIMQSAPMLQEVVDRLGL------K----------------N-D------------
A0A2P8W4F7      DSQIRVLRGPAVIEPILADIQR------R----------------YPN------------
U5QJM6          NTQLQVLLSRPLVNKAVVRLSK------K----------------Y-P------------
A0A1U7HGH0      ATEAKVIRSIPILQQALEQINE------A----------------S-Q------------
K9XJD3          ATEAKVIRSVPILQQALEQINE------A----------------S-Q------------
K9SX01          YTQLQVIRSTPVVAQTIKALAL------P----------------L--------------
A0A1E5QIR9      DTEVAIVRSVATSEGVMQALDL------R----------------D-E------------
A0A1Z4IBC7      ETQVRIIGSNPVLERTINTLNL------K----------------E-A------------
A0A1W5CPC7      ETQVRIIGSNPVLEQTIKALNL------K----------------D-K------------
Q3MDC6          ETQVRIIGSNPVLEQTIKALNL------K----------------D-K------------
A0A1Z4KM73      ETQVRIIGSNPVLQQTIKALNL------K----------------D-Q------------
Q8YNX7          ETQVRIIGSNPVLQQTIKALNL------K----------------D-Q------------
A0A367R4K6      ETQVKIVGSNPVLEQTIKELNL------T----------------D-N------------
A0A1E2WSV8      ETQVRVIGSNPVIEKTINSLKL------K----------------D-S------------
A0A2R5FRT9      ETQVRVIGSNPVIEKTINSLNL------K----------------D-S------------
A0A2K8T1B6      ETQVRVIGSNPVIEETINSLNL------K----------------D-S------------
A0A235I9I0      ETQVRVIGSNPVIEKTINSLNL------K----------------D-G------------
A0A2D0HQT8      ETQVRVIGSNPVIEKTINSLNL------K----------------D-S------------
A0A2L2NU95      ETQVRVIGSNPVIEKTINSLNL------K----------------D-S------------
A0A367S084      ETQVRVIGSNPVIEKTINSLNL------K----------------D-S------------
A0A0V7ZFJ4      ATEAQIIRSRPIIQKTISKLNL------R----------------D-S------------
A0A0V7ZNJ9      ETEAKVIRSNPIIQKTIDKFNL------R----------------D-D------------
A0A367RIS1      ETEAEIIRSNPLTQKTIAELHL------K----------------D-K------------
A0A235IXQ2      ETEAEIIRSYPLTKKTIAELQL------K----------------D-K------------
A0A1W5CNX3      ETEAEIIRSNPIIQKTIAESQL------K----------------D-E------------
Q3MEB7          ETEAEIIRSNPIIQKTIAESQL------K----------------D-E------------
A0A1Z4KHN9      ETEAEIIRSNPIIQKTIAESQL------K----------------D-E------------
Q8YT70          ETEAEIIRSNPIIQKTIAESQL------K----------------D-E------------
A0A218Q4C1      DTQAEIIRSHPLIQQTIDNLQL------K----------------N-Q------------
A0A166IWU6      ETQAEIIRSHPLIQKTIVDLQL------K----------------D-Q------------
A0A2S0Q8C0      ETQAEIIRSHPLIQKTIVDLQL------K----------------D-Q------------
W6FSX4          ETQAEIIRSHPLIEKTIVDLQL------K----------------D-Q------------
A0A1B7WTD1      DTEAEVIRSNPIISKTINDLKL------K----------------G-K------------
A0A1B7WX82      DTESEIIRSYPIIIKTITTLKL------T----------------D-D------------
A0A0R0M9H9      DTEAEVIRSHPLITKTINQLGI------K----------------N-T------------
A0A1S1ZVW2      DTEAEVIRSHPLITKTINQLGT------K----------------N-T------------
A0A1Z4LRU5      DTEAEVIQSHPLIKETITKLNL------I----------------N-E------------
A0A1Z4JVB4      DTEAEVIRSYPIIQKTITTLKL------K----------------D-K------------
K9PIA4          DTEAEVIRSYPIINKTITTLNL------K----------------D-E------------
A0A1Z4M597      DTEAEVIRSNPIVLKTITSLDL------K----------------D-K------------
A0A1Z4MWT1      DTEAEVIRSNPIVLKTITSLNL------K----------------D-K------------
A0A1Z4TX53      DTEAEVIRSNPIVLKTITSLNL------K----------------D-K------------
A0A1Z4HVE1      DTEAEVIRSNPIVLKTITSLNL------K----------------D-K------------
A0A252ECZ1      DTEAEVIRSNPIVQKTITSLNL------K----------------D-K------------
A0A1Z4G5Y1      DTEAEVIRSNPIVQKTIASLNL------K----------------D-K------------
A0A252DNA2      DTEAEVIRSNSIVQKTITSLKL------K----------------D-K------------
A0A252E1Q4      DTEAEVIRSNSIVQKTITSLKL------K----------------D-K------------
A0A2A2TNQ5      ETEAEIIRSNPLVKKIVNELEM------Q----------------D-K------------
A0A3S1C4K5      DTEAEVIRSNPLVKKTISELEL------K----------------D-K------------
A0A1X4G3D5      ENEAEVIRSRPMLEQLVETLEL------Q----------------D-D------------
D4TNI2          ENEAEVIRSRPMLEQLVETLEL------Q----------------D-D------------
A0A1Z4H6Z8      DTEAEVIRSNPIIQKTITSLNL------K----------------D-K------------
A0A1Z4NPM1      DTEAEVIRSTPSVQKTIEKFQL------R----------------T-P------------
A0A3F3KPR9      DTEAEVIRSHPLITKTINQLGI------K----------------N-T------------
D4TGN7          DTEAEVIRSHPLITKTINQLGI------K----------------N-T------------
A0A1Z4UZW9      DTESEIIRSYPIVNKTITTLKL------T----------------D-D------------
A0A0K2M5H0      DTESEIIRSYPIVIKTITTLKL------T----------------D-N------------
A0A1B7VSH4      DTESEIIRSYPIVIKTITTLNL------T----------------D-D------------
A0A1B7W126      DTESEIIRSYPIVIKTITTLNL------T----------------D-D------------
A0A3D4C6Q6      DTESEIIRSYPIVIKTITTLNL------T----------------D-D------------
K7W0A4          DTESEIIRSYPIVIKTITTLNL------T----------------N-D------------
A0A1B7UTR1      DTESEIIRSYPIVIKTITTLNL------T----------------N-D------------
A0A1B7UVJ4      DTESEIIRSYPIVIKTITTLNL------T----------------N-D------------
A0A2T1CIL7      VTEAEILRSRPILEKAIKQLNL------K----------------N-D------------
A0A1Z4RPC6      STEKLRITSEPVLQQTIDQLKL------V----------------D-A------------
A0A2T1CMZ0      STEKLRMISEPVLQQTIDQLKL------E----------------N-S------------
L8M4F7          HNQREQIFTSAVLQQTVENLDL------K----------------N-E------------
L8LZE9          VSQKEILTSSPILQKTIDQLSL------T----------------D-A------------
A0A140K2P2      STQIEVITSDPVLQQTIDQLKL------V----------------D-D------------
K9XWX4          STQIEVITSTPVIQQTIDKLKL------Q----------------D-D------------
A0A140KB14      KTEIERMKAEPILVQTIEKLKL------K----------------D-E------------
K9XX88          KTEIERMKTEPILVQTIEKLKL------K----------------D-E------------
A0A433V7A0      STEAEILLSEPLIRETISALNL------K----------------D-E------------
A0A0C2LBE2      ETQAKIVASVPVIQETIAELDL------K----------------D-D------------
A0A433NN38      DTQVKIVTSVPVLQETIKALDL------R----------------D-S------------
A0A2N6K0T2      DTQAKIVTSVPVIQETITSLSL------K----------------N-D------------
A0A2N6ML72      DTQAKIVTSVPVLQETITSLSL------K----------------N-D------------
G6FQZ6          DTQAKIVTSVPVLQATITSLSL------K----------------N-D------------
A0A2N6MQX9      DTQAKIVTSVPVLQETITSLSL------K----------------D-D------------
A0A2N6KXT6      DTQAKIVTSVPVLQETITSLSL------K----------------N-D------------
A0A2N6KGB9      DTQAKIVTSVPVLQETITSLSL------K----------------N-D------------
A0A2N6L3Y5      DTQAKIVTSVPVLQATITSLSL------K----------------N-D------------
A0A0S3TIS7      DTQAKIVTSVPVLQATITSLSL------K----------------N-D------------
A0A1U7GW28      DTQAKIVTSVPVLQATITSLSL------K----------------N-D------------
A0A2N6LW63      DTQAKIVTSVPVLQATITSLSL------K----------------N-D------------
A0A1Z4TQ63      DTQAKIVTSVPVIQETITSLSL------K----------------N-D------------
A0A0D6YFE2      DTQAKIVISVPVIQETITSLSL------K----------------N-N------------
A0A328IH74      DTQAKIVISVPVIQETITSLSL------K----------------N-N------------
A0A1Z4NDS1      DTQVKIITSNQVIQETIQRLGL------K----------------D-S------------
K9F4D9          DTQIEVFRSIPLVQKVIETLKL------Q----------------D-D------------
U9VXM0          DTQIEVFGSIPLVQQVIEQLKL------Q----------------N-D------------
A0A2T1FTR8      NTQAEILKSLTTIKGAL--IEL------R----------------D--------------
K9UA41          NTQAEILKSLTTIKGAL--VEL------R----------------D--------------
A0A1Z4SMD6      ETQAVILNSEPIIQKVINTLKL------K----------------D-K------------
A0A2H2Y096      ETQAVILNSEPIIQKVINTLKL------K----------------D-K------------
K9S8M8          DTEAEVIRSTPIAEEVITSMGL------R----------------S-S------------
A0A1Z4NFV0      STQAVVLQSRPILEQVIAKLNL------R----------------D-R------------
B0CAX4          QTEAEIIRSEPILRQTITALKL------V----------------D-D------------
U5DPF5          ANEAAIIRSLPIGQQVIERLDI------R----------------N-A------------
A0A350Y0P6      DTEAQIITAQPILEKTIAKLNL------K----------------T-A------------
A0A352X940      DTEAQVITSLPLIQKTIERLNL------K----------------T-E------------
B8HTN4          DTEAQIIRSTPIIQELITTLQL------K----------------D-P------------
A0A2A2TPF8      STQAVILQSRPILQAVVEKLNL------R----------------D-K------------
A0A1Z4R0P8      STQAVILQSRPILQAVIERLNL------R----------------D-D------------
A0A0T7BUI3      NTQAVIVNSQPVIKEVIKTLNL------K----------------D-N------------
A0A1Z4LP32      ETQAVVIQSEPILQEVIDTLNL------K----------------D-D------------
K9REP9          ETQAVIVQSEPILQKVIDTLNL------K----------------D-D------------
A0A1Z4SIJ3      ETQAVIVDSEPVLEEVIRTLDL------K----------------D-K------------
A0A2H2XPG4      ETQAVIVDSEPVLEEVIRTLDL------K----------------D-K------------
K9V3C7          STQAAILESRPIVQEVIQALDL------K----------------D-N------------
A0A1Z4T6Y7      STQAEILQSRPILEAVIKKLDL------R----------------D-K------------
A0A2H2Y561      STQAEILQSRPILEAVIKKLDL------R----------------D-K------------
A0A1Q4S362      STQAEILQSRPILEEVIKKLDL------R----------------D-K------------
A0A3S1CIN8      STQAEILQSRPIIEEVIKKLDL------R----------------D-K------------
A0A2A2TC28      QTQAVIVNSQPILQEVINNLNL------K----------------D-K------------
A0A0C1NCB0      DTQAVVVTSAPILQQVIDKLAL------K----------------N-N------------
A0A2N6K7Q9      ETQAVIVNSHPMLQEVITSLQL------K----------------D-E------------
A0A2N6MXH6      ETQAVIVNSHPMLQEVITALQL------K----------------D-D------------
A0A2N6M5A8      ETQAVIVNSHPMLQEVITALQL------K----------------D-D------------
A0A2N6LL61      ETQAVIVNSHPMLQEVITALQL------K----------------D-D------------
A0A0S3TP66      ETQAVIVNSHPMLQEVITALQL------K----------------D-D------------
G6FP91          ETQAVIVNSHPMLQEVITALQL------K----------------D-D------------
A0A1U7GYR5      ETQAVIVNSHPMLQEVITALQL------K----------------D-D------------
A0A2N6KY52      ETQAVIVNSHPMLQEVITALQL------K----------------D-D------------
A0A2N6KMP5      ETQAVIVNSHPMLQEVITALQL------K----------------D-D------------
A0A2N6MA45      ETQAVIVNSHPMLQEVITALQL------K----------------D-D------------
A0A1Z4TLC8      ETQAVIVNSHPMLQEVITALDL------K----------------N-E------------
A0A0M0SFT2      ETQAVIVNSHPMLQEVITALDL------K----------------D-E------------
A0A0D6Y7R4      ETQAVIVNSHPMLQEVITALDL------K----------------D-E------------
A0A328IGA1      ETQAVIVNSHPMLQEVITALDL------K----------------D-E------------
A0A0C2LFH0      ETQAVILKSEPILKEVIDTLGL------K----------------D-K------------
A0A1Z4IYV4      ETQSVILTSQPILEEVIKTLEL------K----------------D-K------------
A0A1Z4Q0T6      ETQAVILQSQPILEEVINTLRL------K----------------D-K------------
A0A0C2PT44      ETQAVILKSEPILEEVIKTLEL------K----------------D-K------------
A0A1D2P6J4      ETQAVILKSEPILEEVINTLGL------K----------------D-K------------
A0A3M9ZEU1      ETQAEIVRSAAIARATIEALDL------R----------------D-D------------
A0A1Z4JK72      DTQAVVVTSYPILQRVIDTLQL------K----------------N-S------------
A0A0N7Z489      DTQAAVVTSYPILQRVIDTLQL------K----------------N-A------------
A0A0S3TXS2      DTQAAVVTSYPILQRVIDTLQL------K----------------N-S------------
A0A1Z4RN12      ETEAKILQSRPIVERLIKELEL------K----------------N-D------------
A0A2T1CMF9      ETEAEILGSRTIVEKVIQELDL------K----------------S-E------------
Q7NDC5          DTQAEILQSRPVAAGVIRDLQL------G----------------DPR------------
U5QGK3          DTQAEIIQSRPLVEKVIRTLQL------K----------------DPQ------------
A0A2W4UY24      DTQVEIFLSKPIAEKVINQLKI------E----------------D-S------------
A0A254WLE3      NTEIEVVRSIPLLQKTIAALNL------K----------------D-D------------
A0A433W533      NTEIEVVRSIPLLQKTIAALNL------K----------------D-D------------
A0A2P8QWJ3      NTEIEVVRSIPLLQKTIAALNL------K----------------D-D------------
A0A2T1FKP8      NTEIEVVRSIPLLQKTIAALNL------K----------------D-D------------
K9U6L7          NTEIEVVRSIPLLQKTIAALNL------K----------------D-D------------
A0A2T1GMT4      TTQMEVIASRPLLQKTADRLKL------K----------------N-D------------
K9UI51          TTQMEVIASRPLLQRTADRLKL------K----------------N-D------------
K9TYI2          SSQIEVISSPTLLQQAIDELQL------K----------------N-N------------
A0A254W5G5      SSQMEVISSPTLLQRTIDELQL------K----------------N-D------------
A0A2T1FXY4      SSQMEVISSPALLQRTIDELQL------K----------------N-D------------
A0A1Z4QL41      STQIEVISSPPVLQKTIDKLKL------K----------------N-Q------------
A0A252D4T4      STQIEVISSPILLQRTIDELQL------K----------------N-A------------
A0A252DJH5      STQIEVISSPILLQRTIDELQL------K----------------N-A------------
A0A252EB80      STQIEVISSPILLQRTIDELQL------K----------------N-A------------
A0A1Z4HPW5      TTQIEVITSPLLLQKTIDELQL------K----------------N-N------------
A0A1Z4MSN1      TTQIEVITSPLLLQKTIDELQL------K----------------N-K------------
A0A1Z4U1C2      TTQIEVITSPLLLQKTIDELQL------K----------------N-K------------
A0A0D6KV51      TTQIEVITSPLLLQKTIDELQL------K----------------N-K------------
A0A1Z4MKF8      TTQIEVITSPLLLQKTIDELQL------K----------------N-K------------
A0A2C6WC43      NTQIEVISSPALLQKTIDKLQL------K----------------D-Q------------
A0A1Z4L5A1      NTQIEVISSPALLQKTIDKLQL------K----------------D-K------------
A0A367QD86      NTQIEVISSPPLLQKTIDKLQL------K----------------D-K------------
A0A235IZ96      STQIEVITSPSLLQRAIDKLKL------K----------------D-K------------
A0A2L2NGP0      STQIEVITSPSLLQRAIDKLKL------K----------------D-K------------
A0A2K8SM78      NTQIEVISSPNLLQRTIDKLQL------K----------------D-E------------
A0A2R5FPC0      NTQIEVISSPNLLQRTIDKLGL------K----------------D-E------------
K9QM62          STEVEVITSYPLLQRTIDALKL------K----------------N-N------------
A0A1Z4FWI3      SSQIEVISSPTLLQRTIDELQL------K----------------N-D------------
A0A1Z4JYE7      STQVEVISSPPLLEKVINKLEL------T----------------N-E------------
A0A140KBA0      TTEVEVVSSRPIIDRVIKELDL------R----------------N-K------------
K9XSG1          TTEVEVVSSRPIIDRVIKELDL------R----------------N-K------------
A0A0F5YE28      STQIEIISSNRLLNQVIEQLNL------V----------------D-D------------
U7QEH7          STQIEIIYSNRLLNQVINQLNL------V----------------D-S------------
A0A3S1ATK5      STEIEVISSRPLLQQTIDKLGL------K----------------N-K------------
A0A2Z6CPH0      STQIEVISSPLLLEQIIDKIQL------K----------------D-E------------
A0A1Z4GT50      STQIEVITSPPLLQRTIDQLHL------K----------------N-N------------
A0A1Z4GIX0      NTQIEVISSPPLLQRTIDKLQL------K----------------N-D------------
A0A2H6LC24      NTQIEVISSPPLLQRTIDKLQL------K----------------N-D------------
B2J6N5          NTQIEVISSPTLLQRTIDKLQL------K----------------D-Q------------
A0A367RMI4      SSQIEVISSPALLQRTIDKLQL------K----------------D-N------------
A0A235HUM0      SSQIEVISSPALLQRTIDKLQL------K----------------D-K------------
A0A2L2NW47      SSQIEVISSPALLQRTIDKLQL------K----------------D-N------------
A0A1E2WUR1      SSQIEVITSPKLLQRTIDKLQL------K----------------D-N------------
A0A235IKU3      STQIEVITSPNLLQRAIDKLKL------K----------------D-K------------
F4XKF3          STEVEVIYSHPLLQQIIDQLNL------T----------------D-N------------
A0A1D9FX10      STEVEVIYSHPLLQQIIDQLNL------T----------------D-N------------
A0A1D8TNX9      STEVEVIYSHPLLQQIIDQLNL------T----------------D-N------------
A0A1U7MYU6      STEVEVIYSHPLLQQIIDQLNL------T----------------D-N------------
A0A3C0NJ41      STEMEILHSIPLAQKTIAAFNL------K----------------D-N------------
A0A352AG88      TTEIEILRSVPLAKETIAALNL------K----------------S-E------------
A0A350Y374      STEIEILSSLPLLDKTLNTLNL------K----------------D-D------------
A0A355DPX0      STEIEILSSVPLLDKTLNTLNL------K----------------D-D------------
A0A0D8ZUV2      KTEAAVLSSIPLAQQTITALNL------K----------------D-N------------
A0A433VDI0      KTETEVLRSIPLVQRTIAELNL------K----------------D-E------------
A0A3D1PG43      QTEIEIMSSRPLAKETIAALNL------K----------------D-K------------
A0A2P8QQ72      STESEIVSSIPLAQKTIAALTL------K----------------D-E------------
K9TZQ7          STESEIVSSIPLAQKTIAALTL------K----------------D-E------------
A0A2G7GPR0      NTEIEIIRSVPFVEKTISALNL------R----------------N-S------------
K9XH68          NTEIEIIRSVPFLEKTITALNL------R----------------N-D------------
A0A1U7HW70      NTEIEIIRSVPFLEKTIASLNL------R----------------N-D------------
A0A2S6VEJ8      NTEIEIIRSVPFLEKTITALNL------R----------------N-D------------
                                                                            

K9SLA9          ----------EAEQ-------------------SIESF----LANLQVTNLP----D---
A0A168TT23      PGRLVQLIRSDPPSAQPAAV-------------QSPEA----ARAAAIRSAG----GRLR
A0A0M1JWX9      ----------V----------------------EYKTLVTGEKPPLIIEQKK---EA---
A0A2T1M1V6      ----------E-FS-------------------NLEDY----KKLFTIEPQT----Q---
A0A2G7GCS2      ----------L-YP-------------------RLSDY----KLAFSATPQE----Q---
K9XBH8          ----------S-YL-------------------RLSDY----KSLFTVSPQE----Q---
A0A1Z4LJ30      ----------D-FS-------------------RLNNF----KKLFEVSPEK----E---
K9RI76          ----------E-YS-------------------RLSQF----KKLFEVTPEK----E---
A0A352AE27      ----------Q-FG--------------------LRSY----KKLFEISPQE----Q---
A0A3B8JH60      ----------K-AP-------------------KPSQY----KKLFKVSPQE----Q---
A0A3C0N766      ----------K-AP-------------------KPSQY----KKLFKVSPQE----Q---
K9W9J7          ----------K-FS-------------------RLAKY----KRLFQVKPQE----Q---
A0A139WSU3      ----------K-FN-------------------SISRY----RQLFKVTPQE----Q---
A0A433VN22      ----------K-FK-------------------NLEQY----KALFQVSPQE----Q---
Q7NF11          ----------K-YP-------------------QLGSY----EKLFKAVPQS----Q---
A0A1Z4JCS8      ----------A-AN-------------------KPRNY----GQFFEVTSLE----Q---
F4XTX2          ----------D-FQ-------------------RLVQY----KQLFAVSPHQ----E---
Q7NJN6          ----------EKFT-------------------RLDTY----GKLFKGKPGD----Q---
U5QCC3          ----------EKFP-------------------RLEDY----TKLFKSKIED----Q---
A0A0S3TYD7      ------------NA----PL-------------KVEDF----LKRLKVTPVN----R---
U5QL42          ----------L----------------------NSTTA----ADNISISQIG----D---
K9QF04          ----------I----------------------DYRQL----VKQLKIKHKE----N---
A0A3C0N2P0      ----------I----------------------DANTL----RSQLQISRLG----E---
K9TLQ0          ----------L----------------------KFEEL----IKNLSVRRLK----S---
A0A076HBF2      ----------L-------------------------------RSRVDISTGG----AKRK
A0A354B169      ----------L-------------------------------SSRLKISIGG----EKSQ
G4FMX5          ----------L-------------------------------ASRITITTGG----EKRT
Q0IDT5          ----------L-------------------------------AERINITTGG----AKRK
A0A2D6FCW3      ----------L-------------------------------AKRITITTGG----EKRK
A3ZA21          ----------L-------------------------------ASRIEISTGG----AKRK
A0A140K3H3      ----------L----------------------TVTDV----MENLSITQAA----V---
K9XUB8          ----------L----------------------TVGNV----IGNLSIIQAN----V---
Q7NEU3          ----------LLDQ-------------------DAEDI----TKRLEIIREE----R---
A0A352XE00      ----------I----------------------DYNLL----RTKLTISRLQ----Q---
B4VS56          ----------I----------------------DYNTL----RSQLAINQLQ----E---
A0A352AAQ3      ----------V----------------------DYDTL----RTKLIISRLQ----Q---
A0A350Y472      ----------V----------------------DYSAL----RTKLTISRLQ----E---
A0A355DVB4      ----------V----------------------DYSAL----RTKLTISRLQ----E---
A0A2P8VVX1      ----------I----------------------TVDEL----RAGFTLARLS------EG
A0A2P8WHY0      ----------L----------------------DVDQV----VNTFSLQRVG----GEER
A0A2T1CMT9      ----------A----------------------TTAAIIAALRESIGVYQVL----DEST
A0A1D8TX52      ----------I----------------------TIRDI----RGSLRLAQVL----Q---
A0A1U7N5X9      ----------I----------------------TVGDI----RGSLRLAQVL----Q---
A0A1D9G4T2      ----------I----------------------TVGDI----RGSLRLAQVL----Q---
F4XP71          ----------I----------------------TVGDI----RGSLRLAQVL----Q---
A0A2P8QVH5      ----------I----------------------TVEEINGK-PAKVKQSPLK----VTQV
A0A2T1FT70      ----------I----------------------TVEEINGK-PAKVKQSPLK----VTQV
A0A433W4W4      ----------I----------------------TVEEINGK-PAKVKQSPLK----VTQV
K9U5W1          ----------I----------------------TVEEINGK-PAKVKQSPLK----VTQV
A0A254WLA7      ----------I----------------------TVEEINGK-PAKVKQSPLK----VTQV
A0A2W6ZAV2      ----------V----------------------SPDKI----ASGLKIVSGG----D---
A0A2G7GMH8      ----------I----------------------DIKSL----RKSLTLSPVQ----G---
K9W742          ----------L----------------------TLKEL----RKSLSVFQVE----G--S
K9SA61          ----------I----------------------TVGHL----KEALIVTQVE----D---
A0A350Y7Z1      ----------I----------------------QVTDI----KESFSLTGVQ----E---
A0A352X2A7      ----------I----------------------KVEEI----REFLTITRII----E---
K9XPB0          ----------A----------------------EIAEIVEQLKSSLSVYQVI----D---
A0A0D8ZYV0      ----------M----------------------TVKEL----KQTLVLTPLV----E---
A0A3D1PBA3      ----------I----------------------TAKEI----KANLKLRQVL----E---
A0A254WJ87      ----------L----------------------TVAEV----KKNLVLKQVV----E---
A0A2T1FP73      ----------L----------------------TVAEV----KKNLVLKQVV----E---
A0A433VMS2      ----------L----------------------TVAEV----KKNLVLKQVV----E---
K9TYA7          ----------L----------------------TVAEV----KKNLVLKQVV----E---
A0A2P8QUE1      ----------L----------------------TVAEV----KKNLVLKQVV----E---
A0A2T1DWE8      ----------L----------------------EAAEL----QKALVLTQVE----E---
A0A1U7I8L3      ----------I----------------------KVKDI----KEALVVNQLQ----E---
A0A2T1DJL8      ----------L----------------------DVGDL----QKGLTVSQVI----EQRG
A0A1Z4J9W0      ----------I----------------------DVDRL----RKRLNIAQVQ----ELRG
A0A0N7Z5K9      ----------I----------------------DVDRL----RNRLNIAQVQ----ELRG
A0A0S3TXC5      ----------I----------------------DVDRL----TRRLNIVQVQ----ELRG
A0A2T1DNG3      ----------NPG--------------------SVGGF----RGALTIVQVGTKKVD---
A0A2P8W9H0      ----------P-------SV-------------SYGQL----ITNLKIVPNQ----D---
A0A3S0Y9N9      ------------------NL-------------NPLVF----LKELQVKNIE----Q---
A0A433UNK7      ------------------NI-------------NPLVF----LKDLEVKNIE----N---
B8HNB0          ----------T----------------------SVGSI----AGGLSITQVG----D---
A0A1Z4LN32      ----------NNGK----PL-------------DPNSI------SIGTGSIV----G---
A0A2I8A9F5      ----------KKGE----RL-------------KIESV------DIQVEAIP----G---
A0A218Q6R8      ----------QENN----LL-------------RPESI------NINIERIM----G---
A0A0C1XVC4      ----------KKGN----PL-------------SPDAI------SIKTEAVV----G---
A0A218QGE0      ----------KKGN----PL-------------SPDAI------SIKTEAVV----G---
A0A3B8Y8H9      ---------------------------------EKVEYQAFIENQLSINRPK----D---
A0A1Z3HMQ0      ----------AKGN----SI-------------PPDVL----RRGLTIAPLE----G---
A0A1E5QP61      ----------DQGK----FI-------------PPGDF----LSQLNVKKIE----G---
A0A3M2GIL5      ----------PEGN----LI-------------PPGGL----LSGLGVKGIK----G---
A0A433NM31      ----------EQGE----PL-------------KIKEF----QQRLEVKNIK----G---
A0A3M1PML8      ----------EKGE----PV-------------LVKDF----LSKLKANSIP----A---
A0A352X442      ----------ETGN----PI-------------KPEVV----LQGLQVKPVA----G---
A0A0T7BPZ0      ----------NQGK----PL-------------TIEDL----TKNIKVEVVK----G---
A0A0M0SHU3      ----------DEGE----PL-------------TVEEL----LEDLKVESVK----G---
A0A1D2PBN3      ----------NKGK----PL-------------TIQEL----SKKLKIKGDK----G---
A0A0C2LVR7      ----------KRGK----PL-------------TIQEL----SKKLKIKGDK----G---
A0A1Z4PQB9      ----------DKGK----PL-------------TIQEL----SKELKIKGDK----G---
A0A1Z4SFN6      ----------DEGQ----LL-------------TIPNF----TAKLKTKNYK----G---
K9PGI8          ----------ERGK----FI-------------QTQDL----SHKLKVESSK----G---
A0A2W1JVB9      ------------GE----PL-------------KIFDF----EEQLSIKKAR----A---
A0A3M1SVZ4      ------------GK----LV-------------EYSDV----LKNLKLSKVQ----S---
K9SSQ0          ----------LSKQ----DL-------------IT-------QISDHLTITP----D---
A0A2W1JIN9      ----------QWDDPVDIPL-------------SVGEL----KQSLQTGIVP----G---
A0A318AJV1      ----------SPSRLTHRPA-------------TPDQIVTRVTKSVGVSRDQ----L---
A0A254WHG9      ----------SNAE----PP-------------TVEEL----RKQLKVKTVP----A---
A0A2P8QIL5      ----------SNAE----PP-------------TVEEL----RKQLKVKTVP----A---
A0A2T1FLY5      ----------SNAE----PP-------------TVEEL----RKQLKVKTVP----A---
A0A433W447      ----------SNAE----PP-------------TVEEL----RKQLKVKTVP----A---
K9U1K8          ----------SNAE----PP-------------TVEEL----RKQLKVKTVP----A---
A0A1U7N2U4      ----------SSPE----GL-------------TINTL----RRDLKVKIVP----A---
A0A1D9G1F2      ----------SSQE----GL-------------TIDTL----REDLKVKIVP----A---
F4XV38          ----------SSQE----GL-------------TIDTL----REDLKVKIVP----A---
K9UYB2          ----------TLNS-----I-------------TTKQL----RRGLRVKVVP----A---
A0A0C1XJI7      ----------SPGS----QI-------------TSGEL----NQGLDVKIVP----A---
A0A218QN17      ----------SPPS----QI-------------TSGDL----SKGLGVKIVP----A---
K9RKN2          ----------NDQNFGKDGL-------------TSEYL----RKNLSVKIVP----A---
A0A2I8ADV2      ----------HPQI----QL-------------TPTDI----SSALKVSILP----A---
A0A1W5CKM3      ----------STQK----PL-------------TASDI----RSNLKVIIVP----A---
Q3MEW0          ----------STQK----PL-------------TASDI----RSNLKVIIVP----A---
A0A1Z4KIC7      ----------STQK----PL-------------TPSDI----RSNLKVIIVP----A---
Q8YSM5          ----------STQK----PL-------------TPSDI----RSNLKVIIVP----A---
A0A1Q4S1H4      ----------SQAE----KT-------------TLKKL----SRDLKVKIIP----A---
A0A433VBU6      ----------SSSE----KL-------------SFKQL----SRDLKVKIIP----A---
A0A1Q4RZJ6      ----------NGST----KL-------------TVDEF----SQGIRVKTIP----A---
A0A1Z4SNV3      ----------AGRS----TI-------------TTAEL----SRGIRIKTIP----A---
A0A2H2XJQ1      ----------AGRS----TI-------------TTAEL----SRGIRIKTIP----A---
A0A3S5K358      ----------NGST----KL-------------TVDEL----SQGIRVKTIP----A---
A0A0T7BPJ4      -----------VKD----SI-------------TPEKL----RKKLKVKIVP----A---
A0A0C1QS61      -----------STT----QV-------------KIQDL----NKGLGVKIVP----A---
A0A139X3R8      -----------TNT----QV-------------KTPDL----SKGLGVKIVP----A---
A0A1Z4I7C5      ----------STQK----KL-------------SPSDI----KSNLKVVIVP----A---
A0A0C2MDK7      ----------LSLS----PV-------------STAEL----SHNLKVKIVP----A---
A0A1Y0RCK1      ----------LSQS----PV-------------STAEL----SHNLKVKIVP----A---
A0A1Z4PWZ0      ----------LSLS----PV-------------TTGEL----SHNLKVTIVP----A---
A0A0C2QLT0      ----------LQRS----PV-------------TTTEL----SRNLKVKIVP----A---
A0A1Z4J2K1      ----------LQRS----PV-------------STAEL----SHNLKVKIVP----A---
A0A3S0ZSX0      ----------SLST----PL-------------TPEKV----RQGLKVKIVP----A---
A0A2N6K4T3      ----------SPEN----EL-------------TVDQL----TQGLKVKIVP----A---
A0A370CKT2      ----------SPEN----EL-------------TVDQL----SQGLKIKIVP----A---
A0A0S3TL97      ----------SPEN----EL-------------TVDQL----SQGLKIKIVP----A---
A0A2N6M8A0      ----------SPEN----EL-------------TVDQL----SQGLKIKIVP----A---
A0A2N6M9E1      ----------SPEN----EL-------------TVDQL----SQGLKVKIVP----A---
A0A2N6KJI4      ----------SPEN----EL-------------TVDQL----SQGLKIKIVP----A---
A0A2N6MZ77      ----------SPEN----EL-------------TVDQL----SQGLKIKIVP----A---
A0A2N6KT20      ----------SPEN----EL-------------TVDQL----SQGLKIKIVP----A---
G6FSN3          ----------SPEN----EL-------------TVDQL----SQGLKIKIVP----A---
A0A0D6YL98      ----------SPEN----EL-------------TVGQL----SRNLKVKIVP----A---
A0A328I8B9      ----------SLEN----EL-------------TVGQL----SRNLKVKIVP----A---
A0A0M0SU69      ----------LPEN----EL-------------TVGQL----SQNLKVKIVP----A---
A0A1Z4TIZ8      ----------PPGN----EL-------------TVEQL----SQNLKVKIVP----A---
A0A318BG22      ----------ATGG----GDGKAPAVRQRRIDAATAVV----MRNIEAAPLV----G---
A0A2T1E9V8      ------------KT----PL-------------SVGDL----QAGLEVINIE----G---
A0A0P1C0L3      ----------DEET----PVTRRD---------VEQVL----LDNIKVTPIS----Q---
A0A3M2GQQ6      ----------DTDN----PI-------------GVKQV----ASNLSIHKAG----E---
K9SGJ5          ----------MT-Q----DQ-------------MVSYV----LENLYIRQEK----G---
L8MYT6          ----------SS-K----PI-------------DASSV----INGLDIRPEK----D---
A0A352JGJ6      ----------SKIK----DI-------------DAVTI----MSGLEIRPEK----D---
A0A1J5GLS2      ----------SAYR----EI-------------DAGTI----MGGLEIRPEK----D---
A0A2W4W6M5      ----------NTYK----EI-------------DAGTI----MGGLEIRPEK----D---
A0A2W7AN33      ----------IPYK----DI-------------DTLAI----MDGLDIQPEK----N---
A0A256BLV2      ----------LSFK----DL-------------DPLTI----MNGLDIRPEK----D---
A0A2W6ZXF3      ----------SSYK----EI-------------DAGTI----MNGLEIRPER----D---
A0A2Z5WX66      ----------NASK----DI-------------DAVTI----MNGLEIRPEK----D---
K9W1T3          ---------------------------------KPESF----LKPLKVTNIR----S---
A0A0D6YBN8      PAFDEINGRYAAGG----RLARQRI--------AGETL----LDNMSIAPSR----L---
A0A318BJ18      PAFQLVNGRYTSTG----RAERVRI--------AGEIL----RDNLTIGSTR----L---
A0A1Q4RTR1      ----------K-GQ----PL-------------AFEEF----SKNLKVSGVK----G---
A0A1Z4SQV2      ----------N-GQ----PL-------------TVEEF----SQKLKVAGVK----G---
A0A2H2XGN1      ----------N-GQ----PL-------------TVEEF----SQKLKVAGVK----G---
A0A433UXH8      ----------K-GQ----PL-------------TIEEF----SQKLKVTGVK----G---
A0A1Z4RMB9      ----------E-DK----PL-------------KPEDF----RKKLVTEVVG----G---
D5A466          ----------D-GD----PI-------------YPEDI----RRNLDIRIIG----G---
K1XF69          ----------D-GE----PV-------------APEDI----RRNLDMRIIG----G---
B5W297          ----------D-GE----PV-------------APEDI----RRNLDMRIIG----G---
H1W7M8          ----------D-GE----PV-------------APEDI----RRNLDMRIIG----G---
B4WP72          ----------I-EE----AL-------------TPTSL----KEGLEVKAIP----G---
A0A318B4H2      AAAPRTRSAQEQGK----RLDQ-----------AASIL----LDNITVEPIG----A---
B4WQE3          ----------I----------------------SYDSL----KNNLTITPND----N---
A0A2K3BR24      ----------E-GE----PL-------------TPGGM----RKNLNVTRLS----D---
K9YXY1          ----------E-GE----PL-------------TPGGV----RKNLNVTRLS----D---
A0A2P8W4F7      ----------I----------------------TYNAL----LSRLSIVQEG----E---
U5QJM6          ----------K-LK----DD-------------DIDDV----IKRLEIEQVT----R---
A0A1U7HGH0      ----------N--T----TL-------------SLESL----RQGLDIVAVE----G---
K9XJD3          ----------N--T----AL-------------SLESL----RQGLDIVDVE----G---
K9SX01          ---------------------------------DNDVF----LKPLSLDVIK----Y---
A0A1E5QIR9      ----------E-GQ----PL-------------KRKDF----LRRLSISTLK----D---
A0A1Z4IBC7      ----------N-GK----KL-------------SIRIF----AQQLKIEGIK----G---
A0A1W5CPC7      ----------N-GK----PL-------------SIRIF----AKQLKIEGIK----G---
Q3MDC6          ----------N-GK----PL-------------SIRIF----AKQLKIEGIK----G---
A0A1Z4KM73      ----------N-GK----PL-------------SIRIF----AKQLKIEGIK----G---
Q8YNX7          ----------N-GK----PL-------------SIRIF----AKQLKIEGIK----G---
A0A367R4K6      ----------H-GK----LL-------------SIRDL----AQQLKVEGIK----G---
A0A1E2WSV8      ----------Q-GK----PL-------------SIPDL----AKQLKIEGIK----G---
A0A2R5FRT9      ----------K-GK----LL-------------SIPDL----AKQLKIEGIK----G---
A0A2K8T1B6      ----------K-GK----RL-------------SIPDL----AKKLKIEGIK----G---
A0A235I9I0      ----------Q-GK----LL-------------SIPDL----AKQLKIEGIK----G---
A0A2D0HQT8      ----------Q-GK----LL-------------SIPDL----AKQLKIEGIK----G---
A0A2L2NU95      ----------Q-GK----LL-------------SIPDL----AKQLKIEGIK----G---
A0A367S084      ----------Q-GK----LL-------------SIPNL----AKQLKIEGIK----G---
A0A0V7ZFJ4      ----------K-GK----LL-------------KPSVL----ISKLRVNAVG----D---
A0A0V7ZNJ9      ----------D-NE----PI-------------SIEDF----LKQLKVKSAK----G---
A0A367RIS1      ----------L-GQ----PL-------------EIDTF----LSNLKIKSIR----G---
A0A235IXQ2      ----------L-GQ----PL-------------EIDDF----LHNLKIKSVR----G---
A0A1W5CNX3      ----------Q-GQ----PL-------------EIDDF----LRSLKIKSVR----G---
Q3MEB7          ----------Q-GQ----PL-------------EIDDF----LRSLKIKSVR----G---
A0A1Z4KHN9      ----------Q-GQ----PL-------------EIDDF----LRNLKIKSVR----G---
Q8YT70          ----------Q-GQ----PL-------------EIDDF----LRNLKIKSVR----G---
A0A218Q4C1      ----------E-GE----PL-------------GVGSF----LGKLKVTTIR----G---
A0A166IWU6      ----------E-GE----PL-------------RIDNF----LGSLKVNAVR----G---
A0A2S0Q8C0      ----------E-GE----PL-------------KIDHV----LGSLKVQAIR----G---
W6FSX4          ----------E-GE----PL-------------KIDHV----LGSLKVQAIR----G---
A0A1B7WTD1      ----------K-GA----PM-------------TTDAF----LKTLKLKTIR----G---
A0A1B7WX82      ----------K-GG----QI-------------SLENF----LKKLKLKSIR----G---
A0A0R0M9H9      ----------K-GE----PI-------------EIDRF----LKQLKLQTIR----G---
A0A1S1ZVW2      ----------K-GE----PI-------------EIDVF----LKQLKLQIIR----G---
A0A1Z4LRU5      ----------E-GE----TL-------------SHEAF----LKLLQVKSIR----G---
A0A1Z4JVB4      ----------K-GQ----PL-------------SIEDF----LKNLKLKTIR----G---
K9PIA4          ----------T-GE----YL-------------PIETF----LKILQLKTIR----G---
A0A1Z4M597      ----------S-GK----PL-------------TIEKF----LKLLKLKTIR----G---
A0A1Z4MWT1      ----------S-GK----PL-------------SIEKF----LKLLKLKTIR----G---
A0A1Z4TX53      ----------S-GK----PL-------------SIEKF----LKLLKLKTIR----G---
A0A1Z4HVE1      ----------S-GK----PL-------------TIEKF----LKLLKLKTIR----G---
A0A252ECZ1      ----------S-GK----LV-------------SIERF----LKVLKLKTIR----G---
A0A1Z4G5Y1      ----------S-GK----PL-------------SIEKF----LKKLKLKTIR----G---
A0A252DNA2      ----------S-GK----PL-------------SIEKF----LKLLKLKTIR----G---
A0A252E1Q4      ----------S-GK----PL-------------SIEKF----LKLLKLKTIR----G---
A0A2A2TNQ5      ----------K-GK----PL-------------EIDDF----LKNLKVKSVK----G---
A0A3S1C4K5      ----------K-GK----PL-------------KVEPF----LKLLKVKSVK----G---
A0A1X4G3D5      ----------E-GK----PL-------------DPDVI----LGNLKLQTVR----G---
D4TNI2          ----------E-GK----PL-------------DPDVI----LGNLKLQTVR----G---
A0A1Z4H6Z8      ----------S-GK----PL-------------TIEKF----LKLLKLKTIR----G---
A0A1Z4NPM1      ----------K-GK----PL-------------SVEDF----LKNLKVKSVR----G---
A0A3F3KPR9      ----------K-GE----PI-------------EIDRF----LKQLKLQTIR----S---
D4TGN7          ----------K-GE----PI-------------EIDRF----LKQLKLQTIR----G---
A0A1Z4UZW9      ----------Q-GK----QL-------------SLEVF----LKKLKLKTIR----G---
A0A0K2M5H0      ----------Q-GK----QL-------------SLEVF----LKKLKLKTVR----G---
A0A1B7VSH4      ----------Q-GK----QL-------------SLEVF----LKKLKLKTVR----G---
A0A1B7W126      ----------Q-GK----QL-------------SLEVF----LKKLKLKTVR----G---
A0A3D4C6Q6      ----------Q-GK----QL-------------SLEVF----LKKLKLKTVR----G---
K7W0A4          ----------Q-GK----QI-------------SLENF----LKKLKLKTIR----G---
A0A1B7UTR1      ----------Q-GK----QI-------------SLENF----LTKLKLKTIR----G---
A0A1B7UVJ4      ----------Q-GK----QI-------------SLENF----LTKLKLKTIR----G---
A0A2T1CIL7      ----------Q-GN----FL-------------KYQEI----LANLEVKPIV----G---
A0A1Z4RPC6      ----------A-GK----PL-------------KTEDF----KKKLTVEIVG----G---
A0A2T1CMZ0      ----------L-GE----PL-------------KVKEF----KEKLAIEIVG----G---
L8M4F7          ----------N-GE----FI-------------DPNGL----RPQLKVKLLP----G---
L8LZE9          ----------E-GE----PL-------------TPEKM----TKKLKADLVG----A---
A0A140K2P2      ----------Q-GK----PI-------------KPKDF----EKKLSIELVG----G---
K9XWX4          ----------Q-GK----PI-------------KPKDF----EKKLNIELVG----G---
A0A140KB14      ----------E-GK----AL-------------KPEVL----NNKLKIEIIG----G---
K9XX88          ----------E-GK----AL-------------KPEAL----NKKLKIEIVS----G---
A0A433V7A0      ----------Q-DN----AR-------------LETNL----KKQFQVKNIA----G---
A0A0C2LBE2      ----------K-GK----AI-------------TIEEL----TNTLKISSLK----G---
A0A433NN38      ----------L-GN----PL-------------RIEDL----AAALSVVSVK----G---
A0A2N6K0T2      ----------D-GE----PL-------------RVEDV----QKNLKVEGVK----G---
A0A2N6ML72      ----------E-GE----PL-------------KVEDL----QKKLKVEGVK----G---
G6FQZ6          ----------E-GE----PL-------------KVEDL----QKKLKVEGVK----G---
A0A2N6MQX9      ----------E-GE----PL-------------KVEDL----QKKLKVEGVK----G---
A0A2N6KXT6      ----------E-GE----PL-------------KVEDL----QKKLKVEGVK----G---
A0A2N6KGB9      ----------E-GE----PL-------------KVEDL----QKKLKVEGVK----G---
A0A2N6L3Y5      ----------E-GE----PL-------------KVEDL----QKKLKVEGVK----G---
A0A0S3TIS7      ----------E-GE----PL-------------KVEDL----QKKLKVEGVK----G---
A0A1U7GW28      ----------E-GE----PL-------------KVEDL----QKKLKVEGVK----G---
A0A2N6LW63      ----------E-GE----PL-------------KVEDL----QKKLKVEGVK----G---
A0A1Z4TQ63      ----------E-GE----PL-------------KIEDL----LKNLKVEGLK----G---
A0A0D6YFE2      ----------E-GE----PL-------------TVEEL----LENLKVEGVK----G---
A0A328IH74      ----------E-GE----PL-------------TVEEL----LENLKVEGVK----G---
A0A1Z4NDS1      ----------E-GN----PL-------------QIKAF----RSKLKVDSAK----G---
K9F4D9          ----------E-GE----LL-------------QPEDL----LKGLTVTGVP----G---
U9VXM0          ----------E-GE----LL-------------QPDEL----LRDLTITGIP----G---
A0A2T1FTR8      ------------GK----YANRPERKRLDKFINKNESF----VQQLKVSSIK----N---
K9UA41          ------------GK----YANRPERKRLDKFINKNESF----VQQLKVSSIK----N---
A0A1Z4SMD6      ----------K-GK----LL-------------NPELV------KVKVETIT----G---
A0A2H2Y096      ----------K-GK----LL-------------NPELV------KVKVETIT----G---
K9S8M8          ----------S-GK----PM-------------KPESF----LRGLEVKTIR----G---
A0A1Z4NFV0      ----------N-GK----LL-------------DPDLL------KIKVEPVM----G---
B0CAX4          ----------E-DQ----PL-------------ETKDF----IEALTVFNVR----D---
U5DPF5          ----------D-GT----PM-------------APQNI----VGNLKVYEVP----N---
A0A350Y0P6      ----------E-GT----PV-------------QPSSI----GAGLKVEGIK----G---
A0A352X940      ----------N-GS----PI-------------KPENL----LGRLTVKGLK----G---
B8HTN4          ----------Q-GQ----LL-------------KPEAF----LESLSVNNIR----G---
A0A2A2TPF8      ----------T-GK----LI-------------EPESL------IIKVEPIA----G---
A0A1Z4R0P8      ----------T-GK----LV-------------DPKSL------IIKVEPVA----G---
A0A0T7BUI3      ----------Q-GK----FR-------------NPETL------LIKVEPIV----G---
A0A1Z4LP32      ----------D-GK----PL-------------EPESL------PMEVEALV----G---
K9REP9          ----------D-GK----PL-------------EPEAL------DLEIEPLV----G---
A0A1Z4SIJ3      ----------K-GH----PL-------------DPDQL------KIKIEAIP----G---
A0A2H2XPG4      ----------K-GH----PL-------------DPDQL------KIKIEAIP----G---
K9V3C7          ----------K-GR----SL-------------VPEAF------KIKVEAVP----G---
A0A1Z4T6Y7      ----------N-GN----LV-------------KPESL------NIKVEPII----G---
A0A2H2Y561      ----------N-GN----LV-------------KPESL------NIKVEPII----G---
A0A1Q4S362      ----------N-GE----LL-------------EPESI------NIKIEPIP----G---
A0A3S1CIN8      ----------N-GE----LL-------------KPESI------NIKIDPIP----G---
A0A2A2TC28      ----------D-GK----PV-------------DVELF------KVLVEPVV----G---
A0A0C1NCB0      ----------D-GT----PL-------------QPEDL------EIKVDPVV----G---
A0A2N6K7Q9      ----------Q-GK----LI-------------APELL------KVNVKPIV----G---
A0A2N6MXH6      ----------Q-GK----LI-------------EPELL------KVNVKPIV----G---
A0A2N6M5A8      ----------Q-GK----LI-------------DPELL------KVNVKPIV----G---
A0A2N6LL61      ----------Q-GK----LI-------------DPELL------KVNVKPIV----G---
A0A0S3TP66      ----------Q-GK----LI-------------DPELL------KVNVKPIV----G---
G6FP91          ----------Q-GK----LI-------------DPELL------KVNVKPIV----G---
A0A1U7GYR5      ----------Q-GK----LI-------------DPELL------KVNVKPIV----G---
A0A2N6KY52      ----------Q-GK----LI-------------DPELL------KVNVKPIV----G---
A0A2N6KMP5      ----------Q-GK----LI-------------DPELL------KVNVKPIV----G---
A0A2N6MA45      ----------Q-GK----LI-------------DPELL------KVNVKPIV----G---
A0A1Z4TLC8      ----------Q-GK----LI-------------DPELL------KINVKPIV----G---
A0A0M0SFT2      ----------Q-GK----LI-------------DPELL------KINVKPIV----G---
A0A0D6Y7R4      ----------Q-GK----II-------------DPELL------KINVKPIV----G---
A0A328IGA1      ----------Q-GK----II-------------DPELL------KINVKPIV----G---
A0A0C2LFH0      ----------K-GN----AL-------------DPESL------KIKVEPIV----G---
A0A1Z4IYV4      ----------K-GN----TL-------------DPESL------KIKVEPIV----G---
A0A1Z4Q0T6      ----------K-GN----TL-------------EPESL------KIKVEPIV----G---
A0A0C2PT44      ----------K-GE----TL-------------DSESL------KIKVEPIV----G---
A0A1D2P6J4      ----------K-GA----TL-------------EPESL------KIKVEPIV----G---
A0A3M9ZEU1      ----------N-GK----RL-------------QPQDI----SKQLKVKNIP----S---
A0A1Z4JK72      ----------K-GR----PM-------------DPEEL----SKQLKVEAVP----T---
A0A0N7Z489      ----------Q-GR----PL-------------EPDEL----SRQIKVEPVP----T---
A0A0S3TXS2      ----------Q-GR----PM-------------EPEEL----SRQVKVEAVP----T---
A0A1Z4RN12      ----------D-GE----PL-------------TYKSV----STALSVEPII----G---
A0A2T1CMF9      ----------K-GE----PL-------------TYKTV----KKALKVEPVI----G---
Q7NDC5          ----------RPGE----LL-------------ATTDF----LRALKVEALR----R---
U5QGK3          ----------RRGQ----LL-------------RPEKF----LKALKVETLR----R---
A0A2W4UY24      ----------E-GA----PL-------------EANAL----LQDMSVRAIP----G---
A0A254WLE3      ----------RKNE----PL-------------KPEDL----IDKLKLKNIG----G---
A0A433W533      ----------RTSE----PL-------------KPADI----IGKLKLKNIG----G---
A0A2P8QWJ3      ----------RTSE----PL-------------KPADI----IGKLKLKNIG----G---
A0A2T1FKP8      ----------RTSE----PL-------------KPADI----IGKLKLKNIG----G---
K9U6L7          ----------RTSE----PL-------------KPADI----IGKLKLKNIG----G---
A0A2T1GMT4      ----------R-GK----LI-------------AASDL----HSGLTTKIVG----G---
K9UI51          ----------R-GK----LL-------------TASDI----HTGLTTKIIG----G---
K9TYI2          ----------R-GE----PQ-------------EIEAF----KKAVKLKIVG----G---
A0A254W5G5      ----------R-GE----PQ-------------EVEAF----KKAVKLKIVG----G---
A0A2T1FXY4      ----------R-GE----LQ-------------EVEAF----KKAVKLKIVG----G---
A0A1Z4QL41      ----------K-GE----PL-------------EVEDL----VKDLTLKIIG----G---
A0A252D4T4      ----------I-GE----PL-------------TVEAL----KKAINLKIIG----G---
A0A252DJH5      ----------I-GE----PL-------------TVEAL----KKAINLKIIG----G---
A0A252EB80      ----------I-GE----PL-------------TVESL----KKAINLKIIG----G---
A0A1Z4HPW5      ----------Q-GQ----LL-------------TPEAL----KKALNLKIIG----G---
A0A1Z4MSN1      ----------E-GK----PL-------------TTEAL----KKALSIKIIG----G---
A0A1Z4U1C2      ----------E-GK----PL-------------TTEAL----KKALSIKIIG----G---
A0A0D6KV51      ----------E-GK----PL-------------TPEVL----KKALNIKIIG----G---
A0A1Z4MKF8      ----------E-GK----PL-------------TPEVL----KKALNIKIIG----G---
A0A2C6WC43      ----------E-GQ----PL-------------TVKAL----QKSLILKIIG----G---
A0A1Z4L5A1      ----------E-GQ----PL-------------TVKAL----QKSLVLKIIG----G---
A0A367QD86      ----------E-GQ----PL-------------TVKAL----QKSLVLKIIG----G---
A0A235IZ96      ----------E-DK----PL-------------EVQAL----QKSLTLKIVG----G---
A0A2L2NGP0      ----------E-DK----PL-------------EVKAL----QKSLTLKIVG----G---
A0A2K8SM78      ----------E-GK----PL-------------EVEKL----RNSLTLKIVN----G---
A0A2R5FPC0      ----------E-GK----PI-------------EVEKL----RKAVILKIIN----G---
K9QM62          ----------Q-GK----PL-------------TVKAL----AKNLDLKIVG----G---
A0A1Z4FWI3      ----------K-GE----PL-------------TVEAL----KQRLTLKIVG----G---
A0A1Z4JYE7      ----------K-GE----PL-------------TVEEL----QEKLTLKIIG----G---
A0A140KBA0      ----------Q-DE----LY-------------RYKDL----INKLEIKPVT----G---
K9XSG1          ----------Q-DE----LY-------------RYKDL----INNLEIKALT----G---
A0A0F5YE28      ----------E-GK----LI-------------DPESI----RKSLEVKIIG----G---
U7QEH7          ----------E-GK----LR-------------EAESI----RKSLEVKIIG----G---
A0A3S1ATK5      ----------K-GE----VL-------------EVEDL----QKSLTLKIVG----G---
A0A2Z6CPH0      ----------N-GE----SL-------------KVEEL----QKKLKLKIIG----G---
A0A1Z4GT50      ----------N-GE----VL-------------AVEEL----AEALELKIVG----G---
A0A1Z4GIX0      ----------K-GE----PL-------------KVEEL----QKNLTLKIVG----G---
A0A2H6LC24      ----------K-GE----PL-------------KVEEL----QKNLTLKIVG----G---
B2J6N5          ----------E-GK----PL-------------EVEKL----RKSLTLKIVS----A---
A0A367RMI4      ----------D-GE----PL-------------EVKKL----LKLLNLKVIG----G---
A0A235HUM0      ----------E-GE----PL-------------EVKAL----QKALNLKIVG----G---
A0A2L2NW47      ----------E-GE----PL-------------EVKEL----LKVLNLKIVG----G---
A0A1E2WUR1      ----------E-GI----PL-------------EVQAL----KKALNLKIIG----G---
A0A235IKU3      ----------E-DK----PL-------------EVQAL----QKSLTLKIVG----G---
F4XKF3          ----------E-GL----PL-------------QPEAL----KRKLTVKIVG----G---
A0A1D9FX10      ----------E-GL----PL-------------EPEAL----KKKLTVKIVG----G---
A0A1D8TNX9      ----------E-GL----PL-------------EPEAL----KRRLTIKIVG----G---
A0A1U7MYU6      ----------E-GL----PL-------------EPEAL----KRRLTIKIVG----G---
A0A3C0NJ41      ----------K-GK----SL-------------TPEDF----QKKLKAKIVG----G---
A0A352AG88      ----------D-GT----PL-------------SPEAL----HEKLTIENLA----E---
A0A350Y374      ----------Q-GE----PI-------------SPESL----QKKLKIKTIG----A---
A0A355DPX0      ----------Q-GE----PI-------------SPESL----QKKLKIKTIG----A---
A0A0D8ZUV2      ----------D-GE----VL-------------LPEGF----LKKQNIKQLA----A---
A0A433VDI0      ----------A-GV----PL-------------EPEDF----IKELKVKQLS----A---
A0A3D1PG43      ----------K-GA----TV-------------QPTEL----LGKLKLKNVP----A---
A0A2P8QQ72      ----------E-GK----PL-------------KPTAL----ISQLTLKNIP----A---
K9TZQ7          ----------E-GK----PL-------------KPTAL----ISQLTLKNIP----A---
A0A2G7GPR0      ----------G-GS----LM-------------KPQTL----ATRINAKNVP----L---
K9XH68          ----------G-GS----LI-------------KPQAL----AGKMSAKNIP----L---
A0A1U7HW70      ----------S-GS----LI-------------KPQAL----AGKMSARNIP----L---
A0A2S6VEJ8      ----------N-GS----LL-------------KPQVL----ASRVNARNIP----L---
                                                                            

K9SLA9          ----------SEILEISYHDPDPKRAASIVNTVSKIYIASDLETKSLEAKSLLQFVERQ-
A0A168TT23      ARISVSPRENSRLVYVSVNSFDPAFAAQLANAVVEEYVRSTMQRRYDAGQEAREFLEGQ-
A0A0M1JWX9      ----------TKIIEVRYQDEDPEKIDFILKKLAENYLRYSFEDRQTNTRKGIQFIEEQ-
A0A2T1M1V6      ----------TTVIDLEVEATSPELAYQRVKTLMNSYQKRLNELRQQDVKSQDQFAENA-
A0A2G7GCS2      ----------STIINLQVKASSPEIAQKRLSNLINVYQLRLNELRHQDTNVRKQFSQTD-
K9XBH8          ----------TTIIALEVKASSPEIAQQRLNNLINIYQLRLNELRYQDTSVREEFSRGD-
A0A1Z4LJ30      ----------STVISVSVEGSSPELAQQRANGLIKAFRDRLQELRKDEAQQRSQFMQDE-
K9RI76          ----------STVISLEVQGSSPELAKNRAAALIAAFSNRLQELRLDEAKQRSQFMQGE-
A0A352AE27      ----------STTISLTVKGSSPELAHQRAIALIEAYQQRLNELRQTDGVARAQFSQKQ-
A0A3B8JH60      ----------STIISLAVNGSTPEVARQRAIALLKVYQARLNELRQADGMSRKQFSQKE-
A0A3C0N766      ----------STIISLAVNGSTPEVARQRAIALLKVYQARLNELRQADGMSRKQFSQKE-
K9W9J7          ----------STIISLAVSGSTPELAKGRANNLLQVYQQRLNQLRQADSASRKQFSQKE-
A0A139WSU3      ----------STIMLLTVSGSSPKLANQRAIAITEAYQNRLNELRQANSRTRQKFSQIE-
A0A433VN22      ----------STVLSLTVSGSQPDLATLRTQNLIKAYQARLDELREGNSKERQKFNVKE-
Q7NF11          ----------TTILAVEAKGNAPEVAEARADLVVRSYVARLEELRNAYAASRDTLSQKE-
A0A1Z4JCS8      ----------TSVMLLSVTGSSPDIAKQRAEAILNAYRQRLSELRQANNNTRDGFSQKQ-
F4XTX2          ----------STTIWLNATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKA-
Q7NJN6          ----------STIVQLEAKGSSPELAQQRAEWVLQSYQTRLNALRLDDARRRDEFSRVE-
U5QCC3          ----------STIVQVQVKGSSPEIAKNRANALLQSYQRRLNELRLDDARRRDQFSHEE-
A0A0S3TYD7      ----------SDILRVEYRSNDPMEAAEVVNHLMQLYVQDNLTANRAEAKSAREFIQSQ-
U5QL42          ----------AGVLRVAYRDTNPERAKAVLTALGATYVEYSLESKRGQADNAIKFIEAK-
K9QF04          ----------TAIVEVSYQDTDPEKIEFVLDKLAEGYTAYYLEKLQTSSKQALKLVEAL-
A0A3C0N2P0      ----------TKILEVRYQDSNPEKIQFVLERVAQGYVNYSAKEQQDSVTQGLGFVNEQ-
K9TLQ0          ----------TKILDIRYQDTDPQKIQIILKELATGYIHYSEMEQQTTLRQGLEFVETQ-
A0A076HBF2      EA--------EGVLNVRLTGRNPIEDERLLNALSNTYLQAALQQRQQRLADGLAFLNKQ-
A0A354B169      EA--------EGVLNVSLTGHDPVQDELVLKAISAAYLHAALEQRQKRLADGLTFLNKN-
G4FMX5          EA--------EGILRVSLVGRDKDEDQQLLTALSDTYLKVALQERQQRLADGLNFLNKQ-
Q0IDT5          EA--------EGVLKVSLTGRNPKEDGQLLEAISAAYLQTALQQRQKRLTDGIAFLDLQ-
A0A2D6FCW3      EA--------EGILNVSVTGRDPVEDKQLLDDLSSTYLQAALQQRQQRLSDGLNFLNKQ-
A3ZA21          EA--------DGVLNVSLTGRDPEQDEVLLQAISTAYLQAALQQRQQRLADGIDFLNKQ-
A0A140K3H3      -NEMP-----TDVLVVSYTDTNPERAKAVLDALGSTYVEYSLNRQRSQAGNAINFIDEQ-
K9XUB8          -NEIP-----TDVLVVSYIDSNPERAKAVLEALGSTYVEYSLNRQRSQAANAINFIDQQ-
Q7NEU3          ----------TQVAVVSFEDTDPQVVKAILDELSRTYIDYSLEIQKSKLDGAIAFIENE-
A0A352XE00      ----------TKILEIRYQDSDPEKIKFILDQVANGYINYSRQEQQTTTQQGIQFVKDQ-
B4VS56          ----------TKILEVRYQDSDPEKIQFILEQIATGYVNYSLSEQQTSTRQGIQFVEEQ-
A0A352AAQ3      ----------TKILEVRYQDSDPEKIRFILEQVADGYVKYSETEQRTAVTQGLAFVNKQ-
A0A350Y472      ----------TKILEVRYQDSDPNKIQFILEQVANGYVQYSEAEQRTAVTQGLAFVNKQ-
A0A355DVB4      ----------TKILEVRYQDSDPDKIQFILEQVANGYVKYSEAEQRTAVTQGLAFVNKQ-
A0A2P8VVX1      RTG-------TRIFQASYTANDPTQPQRVLAALQDIYLNYNQEQQAQRLSRGLDNVNNR-
A0A2P8WHY0      DKA-------TRVFQATYVDSDPIKTQRLLEALKEAYLEFNEAQQARRLERGLEHTNNR-
A0A2T1CMT9      DSNKDSA---TKIIQVSYVGSSPVETKKVLTAIQEVYLKYNLEQQEKRLRDALTFINQQ-
A0A1D8TX52      -GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-
A0A1U7N5X9      -GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-
A0A1D9G4T2      -GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-
F4XP71          -GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-
A0A2P8QVH5      ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQ-
A0A2T1FT70      ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQ-
A0A433W4W4      ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQ-
K9U5W1          ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQ-
A0A254WLA7      ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQ-
A0A2W6ZAV2      ---------ASGVMDVSLLWDDRREGQQILEAISAEYLAFSMRQRQERLAQGLEFLDTQ-
A0A2G7GMH8      -QDGTGKKVRTKIVEVLYTDNDPQRTQNVLNAMQQVYQDYNLEQQKLRLAKGLTFINEQ-
K9W742          QDDSK-----TKIFAANYTANDPVKTQKVLQAVQRVYLNYNREQQRLRLAKGLAFIDEQ-
K9SA61          -DKTK-----TKIFEAIYTGDDPEKTQAVLQAVQKVYQDYNREQQELRLSRGLAFINDQ-
A0A350Y7Z1      -EDTDIKDTQTKIVKVVYTSNDPIQTQDVLAAIQTVYQDYNLQQQQVRLTEGLAFINDQ-
A0A352X2A7      -DETE-----TKIVKIDYISKDPIQTQEVLKAIQKIYQNYNLEQQKQRLVDGLSFIDNQ-
K9XPB0          -ESEDNKGTETKIIEVAYVSQDYNDSKKILEAIEQVYIEYNVEQQEKRLRDGLAFIAKQ-
A0A0D8ZYV0      -ENSNTK--YTKIVEANYVSNDPVKTQKVLQTIYQVYQSYNREQQEQRLKKGLKFINEQ-
A0A3D1PBA3      -EKVN-----TKIVEATYTANDPVKAEKVLEAVYKVYQIYNREQQQQRLQKGLKFINEQ-
A0A254WJ87      -EKAN-----TKIVEATYTANDPIKAQKVLKAIHTVYQIYNREQQEQRLKKGLKFINEQ-
A0A2T1FP73      -EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-
A0A433VMS2      -EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-
K9TYA7          -EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-
A0A2P8QUE1      -EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-
A0A2T1DWE8      -DKVK-----TKIFQAVYTSDDPEKTQKVLMAVQQVYKDYNREQQKLRLTRGLAFVDEQ-
A0A1U7I8L3      -DKVN-----TKIFEVTYIDNDPIKTQTVLETIKRVYQDYNREQQQLRLTKGLSFIDAQ-
A0A2T1DJL8      NDKIN-----TSIFEMVYTGHDRQQTQAVLQAIQQVYQQYNLEQQKARLTKGLGFINEQ-
A0A1Z4J9W0      NERVT-----TNLVEVTYIDHDRIKTREVLKALEKVYQDYNLEQQRNRLTKGLSFIDRQ-
A0A0N7Z5K9      SERVN-----TSIVEMSYIDYDRVKTREVLKSLQRVYQDYNLEQQRNRLAKGLSFIDRQ-
A0A0S3TXC5      NERVN-----TNIVEMSYIDHDRVKTREVLKALQRVYQDYNLEQQRNRLAKGLSFIDRQ-
A0A2T1DNG3      ----------TKIFSITYTSNDPIKTQKVLQAVQKVYQDYNLQQQQDRLTRGLAFVDKQ-
A0A2P8W9H0      ----------GEILTVTYSSEDPEQVTDVLEVVMAGYLRYSLEDRQNDIFRGLDFLDEQ-
A0A3S0Y9N9      ----------TDILEISYADTNPRMAASIVNTLMKIYIENDIDINRAQTRSARSFIAQQ-
A0A433UNK7      ----------TDILEVYYTSTDPRTAASVVNTLMKVYIENDINANRAQTRSARDFIAQQ-
B8HNB0          ----------SDVLKVTYTGTDPKTVQAILDALNKTYIDYSLEKRRSQVSSGVRFIEEQ-
A0A1Z4LN32      ----------TDILRVSYTSGKPELAIKVVDKVMEAYIKKNIYTNRSEAIAARSFIEKQ-
A0A2I8A9F5      ----------TDGLKVGYVSEDPYLAKAIVNQVMKSYIANNILTNRSEVMAAGDFIAKQ-
A0A218Q6R8      ----------TDGLQVSYVSEEPQLAKEVVNQVMKSYIANNILANRSEAIAAATFIQQQ-
A0A0C1XVC4      ----------TDVLKVSYTSDNPESAKAIVDQVMKSYIANNILSNRTQAISAGGFIEKE-
A0A218QGE0      ----------TDVLKVSYTSDNPESAKAIVDQVMKSYIANNILSNRTQAISAGAFIEKE-
A0A3B8Y8H9      ----------TNIIIVSYQDIDPRKVTFILNELAKVYLDYSLNDPRMKKTQGLQFVEDQ-
A0A1Z3HMQ0      ----------TDVLRVAYQSPNGELSAAVVNQVMTSYIERNITMNRSEATAARQFVQEQ-
A0A1E5QP61      ----------TDVLMIAFKSQYPKEAADAVNKLMDVYINNNILVNRREATAAREFIMQQ-
A0A3M2GIL5      ----------TDVLLITYQAGNPEEAATVVNKVMEVYIENNILVNRSEAAAAREFINKE-
A0A433NM31      ----------TDTLLISYKSTVPEQAQAVVNKLMDSYLRNNMMATRTEAIAARNFIESQ-
A0A3M1PML8      ----------TDLLRVTYASEDPEETAAVINRLVDIYTKNNVLVNRAEAAAARDFIAKE-
A0A352X442      ----------TDVMTLTYQSKKPDVAAAVVNKVMEVYIADDIQANRAKAAAAREFITEQ-
A0A0T7BPZ0      ----------SEVMQISFTHENAQLAANVVNQVMDNYITENIRANRAEAESARKFIISQ-
A0A0M0SHU3      ----------TDVLEISYTNENPQLAAKVINKVVDTYIKQNIQANREEATSAGRFILQQ-
A0A1D2PBN3      ----------TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIEANREEAVSARKFIQRQ-
A0A0C2LVR7      ----------TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIRANREEAVSARKFIQKQ-
A0A1Z4PQB9      ----------TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIGANREEAVSVRKFIQKQ-
A0A1Z4SFN6      ----------TEVLDIYYKDEDPYLAAKVVNQMMEVYIKNNIEANRAEAVSARKFIMKE-
K9PGI8          ----------TDILQISYTDKDPTLAAKVVNKVMDAYIRNNIEANRAEAVSARKFISQQ-
A0A2W1JVB9      ----------GDVIELAYESEDPEEAALVINTLMKVYLADNLRINRLEASSARQYIDQE-
A0A3M1SVZ4      ----------SDILTISYQDENPKKAATFVNSLIEVYLEDDILRKRAELTATREFIEAK-
K9SSQ0          ----------AKVLNISYSDRNPKTAATIL----QGLLETYKAYGANKANQATQLIQAQ-
A0A2W1JIN9      ----------TDIFQLQYTSSDPELASRMLNSIAQTVVQENTETIQAEAKSAREFLEGQ-
A0A318AJV1      ----------SYIISLGFKSRDAAKSSRIANAFADTYLDMRVHGEASSSVQQAAFFRQR-
A0A254WHG9      ----------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-
A0A2P8QIL5      ----------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-
A0A2T1FLY5      ----------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-
A0A433W447      ----------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-
K9U1K8          ----------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-
A0A1U7N2U4      ----------TNILELSYQSQNPELATTVLNAVANAMVSESAQGIRSEARAVREFLEKE-
A0A1D9G1F2      ----------TNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-
F4XV38          ----------TNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-
K9UYB2          ----------TNIIDLSYQSEDSQLAANLVNSVAMAMIRDHVQAISSEATKIREFLETKE
A0A0C1XJI7      ----------TNILELSYKSKDPELAAQLLNAVSQAMIEENTKTISSEATKVREFLETSE
A0A218QN17      ----------TNILELSYKSKDPELAAQLLNAVSQAMIEENTKTISSEATKVREFLENNE
K9RKN2          ----------TNILQISYENQDPLLAARLLNAVSSAMVEYDIKAISSEATKVKDFLENKQ
A0A2I8ADV2      ----------TNILQLNYFHQDPQFAADVLNAVSQAMVEENIQAISSEATKVRKFLEKE-
A0A1W5CKM3      ----------TNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVREFLAEK-
Q3MEW0          ----------TNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVREFLAEK-
A0A1Z4KIC7      ----------TNILDLRYQSPEPNQAAQVLNAVSQAMVEENIKTISSEATKVREFLAEK-
Q8YSM5          ----------TNILDLRYQSPEPNQAAQVLNAVSQAMVEENIKTISSEATKVREFLAEK-
A0A1Q4S1H4      ----------TNILELSYKASDPVFAARLLNAVSNAMVEENIKTISSEATKVRQFLEKNE
A0A433VBU6      ----------TNILELRYKAADPVFATRLVNAVTDAMVEENIKTMSSEATKVREFLEKKE
A0A1Q4RZJ6      ----------TNILEISYQSKNPDLAATYANAVAMATIRDNIKSISSEATKVRQFLQQQ-
A0A1Z4SNV3      ----------TSILEISYQSKNPELAATYVNAVAMATIRDNTKSISTEATKVRQFLQQQ-
A0A2H2XJQ1      ----------TSILEISYQSKNPELAATYVNAVAMATIRDNTKSISTEATKVRQFLQQQ-
A0A3S5K358      ----------TNILEISYQSKNPDLAAAYANAVAMATIRDNIKSISSEATKVRQFLQQQ-
A0A0T7BPJ4      ----------TNILEFKYEARDAQLAAKLLNVIAQTMVEENTRTISSQATKVREFLEKKE
A0A0C1QS61      ----------TNILQLSYQSKNPKLAAQLLNSVARAMEEESANTIRQEAANVRKFLEME-
A0A139X3R8      ----------TNILQLSYQSKDPILAAQLLNAVSRAMEEESANTIRQEAANVRKFLATE-
A0A1Z4I7C5      ----------TNILELRYQSPNPEQTAQVLNAVSQAMVEENIKTINSEATKVREFLSQK-
A0A0C2MDK7      ----------TNILELSYQSRDPQLAAKVLNAVSQAMVEDNVKSIGLEATKVKQFLEQKQ
A0A1Y0RCK1      ----------TNILELNYQSKNPQLAAQLLNAISQAMVEDNTKSINSEATKVKEFLEEKQ
A0A1Z4PWZ0      ----------TNILELSYQSEYPKLAARLLNAVAQAMVEDNIKAISSEATKVKAFLEKKQ
A0A0C2QLT0      ----------TNILELSYQSKDPRLAAKLLNAISQAMVEDNTKAISSEATKVKKFLEEKQ
A0A1Z4J2K1      ----------TNILELSYQSKDPQLAAKLLNAISQAMVEDNTKAISSEATKVKKFLEEKQ
A0A3S0ZSX0      ----------TNILEVSYEHKDPALASKLVNAVSQAMVEDNTQIIRQEAANVRKFLQQQ-
A0A2N6K4T3      ----------TNILEVSYLNKDPILATKVVNAVSKAMVEDNTQVIRQEAANVRKFLETK-
A0A370CKT2      ----------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-
A0A0S3TL97      ----------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-
A0A2N6M8A0      ----------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-
A0A2N6M9E1      ----------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-
A0A2N6KJI4      ----------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-
A0A2N6MZ77      ----------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-
A0A2N6KT20      ----------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-
G6FSN3          ----------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-
A0A0D6YL98      ----------TNILEVSYLNKDPTLATKVVNAVSQAMVEDNTQVIRQEAANVRKFLEKK-
A0A328I8B9      ----------TNILEVSYLNKDPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKK-
A0A0M0SU69      ----------TNILEVSYLNKDPTLATRVVNAVSQAMVEDNTQVIRQEAANVRKFLEKK-
A0A1Z4TIZ8      ----------TNILEVSYLNKNPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKK-
A0A318BG22      ----------SSVIELRYTSNDARLSAAIANAAVDQFIESTTQRQYAASSYARSFVGNR-
A0A2T1E9V8      ----------TDILQVTYKSNNPEIASLVVNQLMNVYVNRNLLGNRAAAISAGNFITSQ-
A0A0P1C0L3      ----------SSLVDIEFSSPSPEISSKISNLWADEFIRANYEKRFGANIDAREFLNKQ-
A0A3M2GQQ6      ----------ADVLIVSYTDTDPARAKAILDVLGKTYVDYSLERQVSQASNAIEFIEEQ-
K9SGJ5          ----------ASVLWLIYRDPDPQRAKDVLDSLASAYSQYSLKDRRSRSSTAIQFIEDK-
L8MYT6          ----------ALILRLTYTDSDPKRAREVLGALSQTYVEYSLKDRRTKSSNAIKFIQDK-
A0A352JGJ6      ----------ALILRLNYIDSDPKRAREVLNALAQTYVEYSLKDRRTKSSTAIKFIQDK-
A0A1J5GLS2      ----------ALILRLIYTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQEK-
A0A2W4W6M5      ----------ALILRLTYTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQDK-
A0A2W7AN33      ----------AMVLRLIYTDSNPKRAQEVLNALSQTYVEYSLNNRRTNSSTAIKFIQDK-
A0A256BLV2      ----------TMVLRLTYTDSDPKRAREVLTALTQTYVEYSLKDRRTKSSTAIKFIQDK-
A0A2W6ZXF3      ----------ALILRLIFTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQEK-
A0A2Z5WX66      ----------ALILRLTYTDSNPKRAREVLTALSETYVEYSLKDRRTKSSTAIKFIQGK-
K9W1T3          ----------TDILQVSYTDTDPAKAAKIINTVMSIYIKSDVNAQRSEAKAAREFVEKQ-
A0A0D6YBN8      ----------SRLVGVNFTSPDPDFSMRVANAWAENFIQTNLERKVQATSYGRNLLERE-
A0A318BJ18      ----------SRLVDITFSSPDPDFSARIANAWAENFIQTNLERKIQATSYGRNLLQRQ-
A0A1Q4RTR1      ----------TDILQISYRSPDKKMAAAVVDSVIKNYLENDIRANRTEVVSAREFISKQ-
A0A1Z4SQV2      ----------TDVLEVSYRSPDAKQAANIVNTLIKNYLENDIRTNRTEAVAAREFISKQ-
A0A2H2XGN1      ----------TDVLEVSYRSPDAKQAANIVNTLIKNYLENDIRTNRTEAVAAREFISKQ-
A0A433UXH8      ----------TEVLQISYRSSNPKLAANVVNTLIKNYLENDIRTNRTEVVAAREFISKE-
A0A1Z4RMB9      ----------TDVVDVKYRHPNPKTASEVVNALMDVYVKEQIRGNQSQPAAAKDFITKE-
D5A466          ----------TDIVLLTYQSKNPQEVADVINTIMEVYIEANVSGIRQEASGAKEFIQEQ-
K1XF69          ----------TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-
B5W297          ----------TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-
H1W7M8          ----------TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-
B4WP72          ----------TDILEISYQSPDDQTAPVIVNALMEAYIENNVETNREEAIAARRFIAGQ-
A0A318B4H2      ----------SALVDITFKSPSAELSSKVANSWAAEYIQSNLDRRFATTADARGFLEQR-
B4WQE3          ----------GKTLTVQYRSDDPYKVTTVLEVVLQTYLNYSLEDRQNDIYRGVDFVNDQ-
A0A2K3BR24      ----------TEILEIAYEHPEPEKAATIVNELMNVYRENNVLNNRSEATAAREFIEEQ-
K9YXY1          ----------TEILEIAYEHPDPEKAATIVNELMNVYRENNVLNNRSEATAAREFIEEQ-
A0A2P8W4F7      ----------SKVLRVTYNGADPAVVSFVLNQVVEGFVDYSVQDRQGDLRRGLTFLDEQ-
U5QJM6          ----------TQVVSVAFKDTDRQLVQDMLKELAKIYIDYSQDVQKSQVSGAITFINAE-
A0A1U7HGH0      ----------TEILQVVYRGEEPEQAALIVNQLMNVYVSKNLLNNRAAAISAGNFITAQ-
K9XJD3          ----------TEILQVVYRGEDPAQAALVVNQLMNIYVNKNLLNNRAAAISAGNFITAQ-
K9SX01          ----------TDVIQVSYLSSSPQDAAKIVNGLMKSYIDNDLLTNREDTASARKFIDEQ-
A0A1E5QIR9      ----------TDVLQISFKSNDPQEAVDVVNRLMQFYQENDIQTNRAQAAAVRRFIEEQ-
A0A1Z4IBC7      ----------TDVVQISYKSNNAEQAAKVVNTVIKSYIDLNIQANQDEAVTAKQVILRE-
A0A1W5CPC7      ----------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-
Q3MDC6          ----------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-
A0A1Z4KM73      ----------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-
Q8YNX7          ----------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-
A0A367R4K6      ----------TDVVQLSYQSNNPELAAKIINQVIDNYIDLNIKANQNEAFAAKQVLVAE-
A0A1E2WSV8      ----------TDVVQLSYKGGDPELAAKIVNEVIDSYIDLNIKANQNEALTAKQVLVTE-
A0A2R5FRT9      ----------TDVVQISYKGGNPELAAKIVNEVIDSYIELNIKANQNEALIAKEVLVTE-
A0A2K8T1B6      ----------TDVVQLSYKGSDPELAAKIVNEVIDSYIDLNIKANQNEALTAKEVLVTE-
A0A235I9I0      ----------TDVVQLSYKGGDPKLAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-
A0A2D0HQT8      ----------TDVVQLSYKGGDPKLAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-
A0A2L2NU95      ----------TDVVQLSYKGGDPELAAKIINEVIDSYIDLNIKANQNEARTAKQVLVTE-
A0A367S084      ----------TDVVQLSYKGGDPELAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-
A0A0V7ZFJ4      ----------TDILNLSYESNDPQKAAAIVNSLMKDYQENNISTNTAEARSAREFLNKQ-
A0A0V7ZNJ9      ----------TDVLEISYKGTDPQQAAAIVNSLMQDYIDNNIRVNTAEARAAREFLNNQ-
A0A367RIS1      ----------TDILQLSYRSANPQQATAIINKLMSAYLENNVRINRSQARAAREFLNKQ-
A0A235IXQ2      ----------TDILQLSYRSTNPQEATAIINRLMSAYLANNVRINRSEARAAREFLNKQ-
A0A1W5CNX3      ----------TDILQLTYRSANPEEATAIINRLMNTYLENNVRNNRSEATAAREFLSKQ-
Q3MEB7          ----------TDILQLTYRSANPEEATAIINRLMNTYLENNVRNNRSEATAAREFLSKQ-
A0A1Z4KHN9      ----------TDILQLSYRSADPKEATAIVNKLMSAYLENNVRNNRSEATAAREFLSKQ-
Q8YT70          ----------TDILQLSYRSADPKEATAIVNKLMSAYLENNVRNNRSEATAAREFLSKQ-
A0A218Q4C1      ----------TDVLQLSYNSIDPQEAQSTVNQLMAAYLNNNVLNNRSQAAAAREFLTEQ-
A0A166IWU6      ----------TDVLQLSYRSVDPELAKAIVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-
A0A2S0Q8C0      ----------TDLLQLSYRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-
W6FSX4          ----------TDLLQLSYRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-
A0A1B7WTD1      ----------TDVMELSYKSTDKQEAANVVNSLMKHYLASNINTNRAEAIAAREFLSQE-
A0A1B7WX82      ----------TDVLQVSYSSTNPQEAANVVNSLMKYYLESNILNNRTEARSAREFLAKQ-
A0A0R0M9H9      ----------TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-
A0A1S1ZVW2      ----------TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSQATAARKFLSQE-
A0A1Z4LRU5      ----------TDVLQLSYKSTDPKEAANVVNSLMGDYMENNVETNTAEVRAAREFLQKE-
A0A1Z4JVB4      ----------TDVMQISYRSKNPQESADVVNFLMKSYIESNISNNRTEARSLREFLSKQ-
K9PIA4          ----------TDVMQLSYRSPNPKEAADVINTLMKYYLESNVRTNRSTAKSAREFLNKE-
A0A1Z4M597      ----------TDVMQLSYRSTNPQEAASVINSLMNYYLENNVRTNRAEARSAREFLNRQ-
A0A1Z4MWT1      ----------TDVMQLSYRSTNPQEAASVINSLMSYYLENNVRTNRAEARSAREFLNRQ-
A0A1Z4TX53      ----------TDVMQLSYRSTNPQEAASVINSLMSYYLENNVRTNRAEARSAREFLNRQ-
A0A1Z4HVE1      ----------TDVMQLSYRSTNPQEAASVINSLMNYYLESNVRTNRAEARSAREFLNRQ-
A0A252ECZ1      ----------TDVMQLSYRSTNPQEAASVINSLMNYYLESNVRTNSAEARSAREFLNRQ-
A0A1Z4G5Y1      ----------TDVMQLSYNSTNPEEAATVLNSLMNYYLESNVRTNRAEARSAREFLNRQ-
A0A252DNA2      ----------TDVMQLSYRSTNPQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-
A0A252E1Q4      ----------TDVMQLSYRSTNPQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-
A0A2A2TNQ5      ----------TDVMELTYRGTNPLETAKVINTLMNNYLENNIRSNRTEVTAARDFLRKQ-
A0A3S1C4K5      ----------TDVLEMTYRDTDPKVAADVINTLVKYYIENNIRVNRLDATSAREFLSKQ-
A0A1X4G3D5      ----------TNVMEFTYDSKIPDEAAKIVNGLMNEYLLSNIVINNSASSKARQVLAKK-
D4TNI2          ----------TNVMEFTYDSKIPDEAAKVVNGLMNEYLLSNIVINNSASAKARQVLAKK-
A0A1Z4H6Z8      ----------TDVMQLSYRSTNAQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-
A0A1Z4NPM1      ----------TDVMELSYRSTDPQEAANVINFLMKSYLEGNILNNRAEATAAKEFLSKQ-
A0A3F3KPR9      ----------TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-
D4TGN7          ----------TDVMELSYSSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-
A0A1Z4UZW9      ----------TDVMQLSYRSTNPQEAAKVVNSIMKYYLESNVRTNRTEARSAREFLSKQ-
A0A0K2M5H0      ----------TDVMQLSYRSTNPQEAADVVNSLMKYYLESNVRTNRTEARSAREFLSKE-
A0A1B7VSH4      ----------TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-
A0A1B7W126      ----------TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-
A0A3D4C6Q6      ----------TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-
K7W0A4          ----------TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-
A0A1B7UTR1      ----------TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-
A0A1B7UVJ4      ----------TDVLQVSYSSTNPQEAANVVNSLMKYYLESNILNNRTEARSARQFLAKQ-
A0A2T1CIL7      ----------TDVLQVFYQDSDPKRAASIVNEVIDLYVQEDTLSNRAAPASAREFIKAQ-
A0A1Z4RPC6      ----------TDVIQIAYKDPDPVIASKVINTLMDVYIKEQVNSNKKATASADSFVTST-
A0A2T1CMZ0      ----------SDVISIEYKDPDPIIASKVVNTLMGVYIKEHVRSNKSATVSADSFISST-
L8M4F7          ----------TDLIQILYKDPNPKFAADIVNSLMNVYVEAQIRGNQSDPAVAKKFINQQ-
L8LZE9          ----------SDVIEITYEDKDPQIASNVVNTLMNIFLENKIANNQKDTESADFFVESQ-
A0A140K2P2      ----------SDVIEITYAHPNPKVAADVVNTLMNTYINEQIRTNQSEPASAREFINKQ-
K9XWX4          ----------SDVVEITYAHPNPKVAADVVNTLMNTYINEQIRANQSEPASAREFINKQ-
A0A140KB14      ----------TDVISVRYQDQDPYTAADVINTLMKLYLDEQVKSTQAETANADSFISNQ-
K9XX88          ----------TDVISLRYQDQDPYTAADVINTLMKLYLDEQVKSTQAETANADGFISNQ-
A0A433V7A0      ----------ADVMQISYTSKDPQESASVVNQLMSIYIKNNISANRLQAVAARKFISSQ-
A0A0C2LBE2      ----------TEILQVSYIDKDPKLAAKVVNKVMQAYIKNNIEANRQEAVSARKFIQKQ-
A0A433NN38      ----------TDLLEIYYADSDPIMAAKVVNKLVEIYIKQNIQTNRAEAVSARKFMWEQ-
A0A2N6K0T2      ----------TDVLEVSYTHEDPQLAAKVINKVVDTYIKQNIQVNREEAISAGKFMLQQ-
A0A2N6ML72      ----------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-
G6FQZ6          ----------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-
A0A2N6MQX9      ----------TDVLEVSYTHEDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-
A0A2N6KXT6      ----------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-
A0A2N6KGB9      ----------TDVLEVSYTHEDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-
A0A2N6L3Y5      ----------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-
A0A0S3TIS7      ----------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-
A0A1U7GW28      ----------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-
A0A2N6LW63      ----------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-
A0A1Z4TQ63      ----------TDVLEISYTDENPQLAAKIINRVVDTYIKQNIQANREEATSAGRFILQQ-
A0A0D6YFE2      ----------TDVLEISYTDENPELAAKVINKIVDTYIQQNIQANREEATSAGRFILQQ-
A0A328IH74      ----------TDVLEISYTDENPELAAKVINKIVDTYIQQNIQANREEATSAGRFILQQ-
A0A1Z4NDS1      ----------TDIIQVSYQDNDPELAAKVVNKLMEVYVQNNIRENRAEASAAGTFLDDQ-
K9F4D9          ----------TDVLKVTYTSEEPEIAATVVNTLADIYIENDIQTNRAAALAAQEFITAQ-
U9VXM0          ----------TDVLKVTYTSDDPELAANVVNTLTDIYIENDIQTNRAAAVAAQEFISAQ-
A0A2T1FTR8      ----------TDLLEVTFQDPSRELSRDVVEKIMEIYIRDDRTNQRREAEAARKFVAQE-
K9UA41          ----------TDLLEVTFQDPSRELARDVVEKIMEIYIRDDRTNQRREAEAARKFVAQE-
A0A1Z4SMD6      ----------TDVLKISYSSKDPEVASSVVNQVMKTYVEKNIESNRSQVFAAGSFIKKQ-
A0A2H2Y096      ----------TDVLKISYSSKDPEVASSVVNQVMKTYVEKNIESNRSQVFAAGSFIKKQ-
K9S8M8          ----------TDVLLITYTSDDPQEAANVVNVLMEIYIKENIRANRAEATAARKFITEL-
A0A1Z4NFV0      ----------TDVLKVSHISDNPNLAAAVVNQVMESYVESNIQSNRAEAQSAGKFIEQQ-
B0CAX4          ----------TDVLKVTYKSIDPKESADVVNRLMDDYLKNNIETNRAEAASARVFIEKQ-
U5DPF5          ----------THILELTYQSTDPEEAARVVDSFMEVYRDNDVRINRSEAAAAREFIEEQ-
A0A350Y0P6      ----------TDVMEVSFTSDNPKKAAAVVNQLMNVYVENNILTNRAEAVAAGEFIAKQ-
A0A352X940      ----------TDVMTVSVKSQKPKEAAAIVNKLMEVYLENNIQTNRSEAVAARKFIERQ-
B8HTN4          ----------TDLLQVSYRSTDPKQAVAIVDLLIKIYKRNNILANRLETTNSREFIERK-
A0A2A2TPF8      ----------TDVLDVVYISENGKEAAAIVNQLMRSYVENNIRNNRSEALAARKFIEAQ-
A0A1Z4R0P8      ----------TDVLNVSFISDKPKEAAAIVNQLMRSYVDNNIKNNRSEALAARKFIEAQ-
A0A0T7BUI3      ----------TDVLKVSHASDNPKLAAKIVNQVMATYAENNVESNRTQVTAAGEFIKKQ-
A0A1Z4LP32      ----------TDVINVSYTSEKPRLAAAIVNQVMRTYVKNNIESNRAQVVAAGQFLKQQ-
K9REP9          ----------TDVINVSYTSDKPRLAASIVNQVMESYVDNNIESNRAQVVAAGEFLKKQ-
A0A1Z4SIJ3      ----------TDVLKVSYVSINPELAKKVVNQVMQTYVDKNIESNRTQVYAAGEFIKKQ-
A0A2H2XPG4      ----------TDVLKVSYVSINPELAKKVVNQVMQTYVDKNIESNRTQVYAAGEFIKKQ-
K9V3C7          ----------TDILNVSFTWDNPEIASAVVNKLMDVYVANNLANSRSEAVSAGKFIELQ-
A0A1Z4T6Y7      ----------ADVLNVSHISSDSRLAADVINYVMRSYVENNIQTNRLEAVSARKFIENQ-
A0A2H2Y561      ----------ADVLNVSHISSDSRLAADVINYVMRSYVENNIQTNRLEAVSARKFIENQ-
A0A1Q4S362      ----------TDVLNVAHISGESKKAADVVNQIMRSYVNSNIQNNRQETIAARKFIEGQ-
A0A3S1CIN8      ----------TDVLKVAHISGESKKAADVVNQIMRSYVNSNIQNNRQETIAARKFIEGQ-
A0A2A2TC28      ----------TDVIKVSYQSNNPEMTAEVVNQVMNTYIKNNIQSNRTQVFAAGDFIRKR-
A0A0C1NCB0      ----------TDVLKVSYTAKAPNLAANVVNLVMQAYVNNNIQSNQEQVLAAGEFIKKQ-
A0A2N6K7Q9      ----------TDVLRVSYASNDPELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
A0A2N6MXH6      ----------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
A0A2N6M5A8      ----------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
A0A2N6LL61      ----------TDVLRVSYASNDPKLAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
A0A0S3TP66      ----------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
G6FP91          ----------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
A0A1U7GYR5      ----------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
A0A2N6KY52      ----------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
A0A2N6KMP5      ----------TDVLRVSYTSNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
A0A2N6MA45      ----------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
A0A1Z4TLC8      ----------TDVLKVSYASNDPELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
A0A0M0SFT2      ----------TDVLKVSYTSNDPELAAAIVNQLMKSYVQNNIQNNRAQVSAAGEFIKEQ-
A0A0D6Y7R4      ----------TDVLKVSYTSNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAGDFIKEQ-
A0A328IGA1      ----------TDVLKVSYASNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-
A0A0C2LFH0      ----------TDVLKVSYTSENPELTASVVNQVMKSYVAKNIQYNRTQVVAAGEFIKKQ-
A0A1Z4IYV4      ----------TDVLQVSYTSENPELAASVVNQLMKSYVANNIQSNRSQVFAAGEFIKKQ-
A0A1Z4Q0T6      ----------TDVLKVSYISENPELAASVVNQLMKSYVANNIQSNRVQVFAAGEFIKKQ-
A0A0C2PT44      ----------TDVLKVSYTSENPELAASVVNQLMKSYVANNIQSNRAQVFAAGEYIKKQ-
A0A1D2P6J4      ----------TDVLKVSYTSENAELAASVVNQLMKSYVANNIQSNRAQVFAAGEFIKKQ-
A0A3M9ZEU1      ----------TDVLHLAYTDSDPERAAKVVNQVINVYIENNVAANRAEAAAAREFISRE-
A0A1Z4JK72      ----------TDILNLKYSDNDAEMAANVVNQIMKAYIDNNLKTNQEEANKAGRFIESQ-
A0A0N7Z489      ----------TDILDVKYADDDPEMAANVVNQVLKAYIDNNLKTNQEEANKAGRFIDNQ-
A0A0S3TXS2      ----------TDILELKYADDDPEMAANVINQIVKAYIDSNLKTNQEEANKAGRFIDSQ-
A0A1Z4RN12      ----------TDLLKITFTDQDPEVALAFVNRAIELYSEDYASYNRSETASARDFIAKQ-
A0A2T1CMF9      ----------TDLLQISYENSDPDVAVSFVNRAVELYSDGYALFNSEAALKDGDFIKQQ-
Q7NDC5          ----------TDLLVIKYRDRDPAVATRVVNTLARHYIDLNMQQNRAEAASTRGFVEAQ-
U5QGK3          ----------TDLLVIRYREFNPELAAKVVNTLAQAYIVENVQQNRAEASSTRTFVESQ-
A0A2W4UY24      ----------TDVLAVSYESTSPALAQAVVNAMMAAFIQANVQANRTAAIAAQSFVASQ-
A0A254WLE3      ----------TDVMQVTYKSVIPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-
A0A433W533      ----------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-
A0A2P8QWJ3      ----------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-
A0A2T1FKP8      ----------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-
K9U6L7          ----------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-
A0A2T1GMT4      ----------ADILQVSFKGRNPKDAANIVNTLMNVYLENDIQASQLEAETARQFIEQQ-
K9UI51          ----------SDILQIGFKGRNSKDAANIVNTLMNVYLENDIQASRLEAENARQFIEQQ-
K9TYI2          ----------TDVLQITYKHHDPEKAAAVVNKIMELYLENDILTSRSEAEATRLFMAKQ-
A0A254W5G5      ----------SDVLRITYKHHDPEKAAAVVNKIMELYLENDIHTNRSEAEATRLFMAKQ-
A0A2T1FXY4      ----------TDVLRITYKHHDPEKAAAVVNKIMELYLENDILTSRSEAEATRLFMAKQ-
A0A1Z4QL41      ----------TDVLKITYKSNKPEEAAEVVNTIMNFYIENDISTNRAEAEETRQFLDKQ-
A0A252D4T4      ----------TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-
A0A252DJH5      ----------TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-
A0A252EB80      ----------TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-
A0A1Z4HPW5      ----------ADVLQISYKSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-
A0A1Z4MSN1      ----------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-
A0A1Z4U1C2      ----------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-
A0A0D6KV51      ----------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-
A0A1Z4MKF8      ----------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-
A0A2C6WC43      ----------TDVLRVTYASLNAEEAAAVVNTVMNVYLENDILTNRSEAASTRQFIARQ-
A0A1Z4L5A1      ----------TDVLRITYSSLDPEEAASVVNTVMNVYVESDILTSRSEAASTRQFIARQ-
A0A367QD86      ----------TDVLRITYSSLNPEEAAAVVNTVMNVYVENDILTNRSEAASTRQFIARQ-
A0A235IZ96      ----------TDVLKITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-
A0A2L2NGP0      ----------TDVLRITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-
A0A2K8SM78      ----------TDVLRISYTSRDPEQSAAVVNTIMSLYLENDILTNRSEAAATRQFMAKQ-
A0A2R5FPC0      ----------TDVLRISYASRDPEQAAAVVNTIMNLYLENDILTNRSEAAATRQFMAKQ-
K9QM62          ----------TDVLQITYKSRNPEEAAAVVNSVMNVYLENDILTNRTEVEATRRFMARQ-
A0A1Z4FWI3      ----------TDVLLVSYKSPDPETAAAVVNTVMNIYLENDSNTNRAEAEATRRFMAKQ-
A0A1Z4JYE7      ----------TDVLEITYQSNDPKQAAAVVNALMNVYVDNDISTNREEAEATRKFMERQ-
A0A140KBA0      ----------GNVIKISYEDSDAERAALVVNKIIELYQEKDTENNRSEAIAARQFISEE-
K9XSG1          ----------SNVIKIAYEDSDPERAALVVNKIIELYQEKDTENNRSEAIAAREFISQE-
A0A0F5YE28      ----------TDIVSLSYESPDPLEAANIVNTLMEVYIQTNVNMNQDEAREAREFISQQ-
U7QEH7          ----------TDIVSLSYESKDPKEAADIINTLMEVYMQTNVDMNQEDAIEAREFISQQ-
A0A3S1ATK5      ----------TDVLKLTYKSRDPKEAAVVVNTVMNFYLENDIETNRAEAETTYKFMARQ-
A0A2Z6CPH0      ----------TDVLRVSYQSNNPEEAAAVVNTLMNLYLENDILTSRAEAEATRKFMAKQ-
A0A1Z4GT50      ----------TDVLQLNYKSRNPEEAAAVVNTIMKMYVENDITTSRAEAEDTREFMSKQ-
A0A1Z4GIX0      ----------TDVLRIAYKSTNPEEASAVVNTIIDAYLENDILTSRSEAEATRKFMAKQ-
A0A2H6LC24      ----------TDVLRIAYKSTNPEEAAAVVNTIIDAYLENDILTSRSEAEATRKFMAKQ-
B2J6N5          ----------TDVLRISYTSPDPEQSAAVVNTIMSLYLDNDILTNRSEAAATRQFIAKQ-
A0A367RMI4      ----------TDVLRISYKSHNPEEAAAVVNTIMRFYLENDILTNRSEAGAARQFMAKQ-
A0A235HUM0      ----------TDVLRISYSSHDPEEAAAVVNTVMRFYLENDVLTNRSEAGATRQFMAKQ-
A0A2L2NW47      ----------TDVLRIAYRSHDPEEAAAVVNTIMRFYLENDILTNRSEAGATRQFMAKQ-
A0A1E2WUR1      ----------TDVLLISYSSSDPEEAAAVVNTIMNFYLENDILTNRSEAAAARQFMAKQ-
A0A235IKU3      ----------TDVLKITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-
F4XKF3          ----------TDVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-
A0A1D9FX10      ----------TDVVRLSYKGKNSEKGAAVINKLMRLYIENQILSKKSEAAKAREFITNQ-
A0A1D8TNX9      ----------TDVVRLSYKGNNSDKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-
A0A1U7MYU6      ----------TDVVRLSYKGNNSDKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-
A0A3C0NJ41      ----------TDVVELSYKGANPQQIAAVVNKLMSLYIEDNLRTNRAELVAAQDFIAKQ-
A0A352AG88      ----------TDVLELAYESSNPQEAAAVVNYLMNLYIKNNVKANRAEVVAAVKFLNEQ-
A0A350Y374      ----------TDVIEIIYKNKDAKTAAAVVNQLMKLYIENNLRNNRTELVTAQEFITKQ-
A0A355DPX0      ----------TDVIEITYKNKDAKTAAAVVNELMKLYIENNLRNNRTELVTAQEFITKQ-
A0A0D8ZUV2      ----------TDVLEVTYKSNDPQEAAAVVNKLMSLYIENNVLSNRTAAVEASKFIANQ-
A0A433VDI0      ----------TDILQLAYKSTNPEEATAVVNKLMNLYIENNILTNRDQAVEAVEFIAKQ-
A0A3D1PG43      ----------TDVVQVAYESKNPEEAAAVVNKLMSLYVQNNIQSNRAQTTAVGEFIAKQ-
A0A2P8QQ72      ----------TDVLQVAYESKDPQEAAAVVNKLMSAYVDYNIQSNRAEASAAEDFIVKQ-
K9TZQ7          ----------TDVLQVAYESKDPQEAAAVVNKLMSAYVDYNIQSNRAEASAAEDFIVKQ-
A0A2G7GPR0      ----------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-
K9XH68          ----------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-
A0A1U7HW70      ----------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-
A0A2S6VEJ8      ----------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-
                                                                            

K9SLA9          LPTSKSALESAEIKLRQFKENYRLVDLEI----------EKVTTVKAIKEIEAQMLGLQA
A0A168TT23      LADMRIALERADQNLIDFAQANGVADLEE----------RVDMSQSSVRTLNDRLSAARG
A0A0M1JWX9      LPQLRQRVDTLQGQLQKFRQDYNLIDPKI----------QGEQLAGQITKIDDQLLEAQT
A0A2T1M1V6      LKKAQNNLILAQNKLTQFQQSTGLFESET----------QTQELMQSINKLRATQTEISS
A0A2G7GCS2      LEDAQAQLAKAQAELANFQQSTGLTEVTE----------QTRSLINQQRELRTTYTNVLS
K9XBH8          IEKARQQLEQAQAALASFQEATGISEAVE----------QTRSLIAQLRDLKTNYTTILA
A0A1Z4LJ30      VKQAYQKLFKTQKNLSEFKQKTNLVSSEE----------QTKEIVSTINALETEQAQTIA
K9RI76          VKLANTKLLKAQKALSEFKQKTNLVSSEE----------QTQQIVSAINTLNTQQAQAIA
A0A352AE27      LEQAQQRLNQAQMELAQFQKSSGLVNSEE----------QTRGLVQSISELTTAQAQAQA
A0A3B8JH60      LEQAKERLAQAQMALAQFKQSSGLVNSEA----------QTEGIVTTINNLSTAQAQAQA
A0A3C0N766      LEQAKERLAQAQMALAQFKQSSGLVNSEA----------QTEGIVTTINNLSTAQAQAQA
K9W9J7          LNQAKARLDQAQRAVAQWKQSTGLVNSEA----------QTQGIVTTINNLTSVQAQALA
A0A139WSU3      LEQAKLKLAQAQSKLTIFKQSSGLINNED----------QAKGIVDSISTLTTVRAQVLA
A0A433VN22      LEQAKAKLSNAQTKIARFKQATGIVNNDA----------QTQGIVTTINALVGSRAQALS
Q7NF11          LDRARRELTRAEAALARFKRSTGLVNTDQ----------QTGGLVGVISSLTTSQAQAVA
A0A1Z4JCS8      LEQAQRRLTEAQTALAQFKQSTGLVNNEE----------QTKGLVGTINTLEAAQAQVQA
F4XTX2          LDRAKQKLDQSQEALAKFQESSGLVNSEA----------QTEGLVRAITDLSISQAQAQA
Q7NJN6          TAKAQNNLQTAQVELYGYQRRTGLVNADD----------QTRGIVETLNSLRSTQTLTLA
U5QCC3          LERAKRTLQQTQSELASYQQTTGLVNVDE----------QTRGLVETLNTLRSSATLAQA
A0A0S3TYD7      LPEVERNVRQVEGEIRAFKENNQIVALDQ----------EQRNSVEITSDFNKRIEDTRA
U5QL42          LPRAKKVLNQTAIAIREFRKRYDIPDPDG----------YATSVAEVQQSLQQRIQDLQI
K9QF04          SPQQRQRVDQLQVQLQRFRRQNNLVDPEK----------QSQVLTERLSNIIQQRQETQA
A0A3C0N2P0      TKNLQKRVNELQKSIQSLRENYKIVDPES----------QGQQLSNRASEIVKQRQDTES
K9TLQ0          LPRLQQRVDTLQEYLEKFRQHYNLIDPGQ----------SGQILSQQIGSLVNERQETES
A0A076HBF2      APSLQTRLDQLQGELADFRTRYSLLEPTA----------EGGALKKRETAMAAQVLGLEA
A0A354B169      APTLQQKTSQLQSDLAKFRERHNLIEPTE----------EGGAIKGRLAQLESQLLGLEA
G4FMX5          APALEAKTEQIQSEVAAFRIKHSLLEPTA----------EGGALRQQEAGLSSQVLALQA
Q0IDT5          APALQAKADAIQGELAEFRRRHSLLEPAI----------EGTALKQREATLATQIFGFEA
A0A2D6FCW3      APALEAKTEEIQSEVSDFRQRHSLLEPTT----------EGGALKQREAAIAAQVLDLEA
A3ZA21          APALQQKTEAIQNELAAFRRQHSLLEPTA----------EGGALKDRETAVATEILGLEA
A0A140K3H3      LPKAQAELNEVAKAIRNFRQTYNIVDPDE----------YALRVIQFRDGLEQQEKQAEI
K9XUB8          LPKAQAELDDVAKKIRNFRQSYHIVDPNE----------YASRVIQFRDGLEQQEKQAEI
Q7NEU3          LPPVRKEVERAEEQLRTFRRQYSILDPQV----------QGTELAATLNTLNRDYEQSKA
A0A352XE00      LPKLQERVNQLQAQLQEFRQAYNLIDPDS----------QAQLLTQRATSIVQQRQDAQS
B4VS56          LPKLQGRVDSLQQKLQRFRQQYNLVNPDS----------QGQLLTSRVSTIVQERQNTQT
A0A352AAQ3      AKELQGIVNDLQQKVQDLRQNYKIVDPET----------QGQLLTNRVSEIVKQRQETES
A0A350Y472      TQKLQELVNDLQQQIQNLRQTYQIVDPET----------QGQLLTNRVSDIVKQRQETQS
A0A355DVB4      TQKLQELVNDLQQQIQNLRQTYQIVDPET----------QGQLLTNRVSDIVKQRQETQS
A0A2P8VVX1      LANTQQNLRDSQSALEQFRINQNLIDPNS----------QAISVVESLNQVQTQQQQLMV
A0A2P8WHY0      LDNTQKNLQQAQAALEKFRQSQNLIDPTL----------QSQAVVTSLNEVQSEQRQLMS
A0A2T1CMT9      IPQARKELTQTETNLTKLTKENNLVSPEA----------EATSVKENIRQIAQEREALKA
A0A1D8TX52      LPKARKDLEQAEQQLEQFRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRA
A0A1U7N5X9      LPKARKDLEQAEQQLEQFRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRA
A0A1D9G4T2      LPTARNNLEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRA
F4XP71          LPTARNNLEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRA
A0A2P8QVH5      LPKIRKDVSQAEANLENFRKQNKLLDPEV----------QAKNLLDALAAVESERRTIRA
A0A2T1FT70      LPKIRKDVSQAEANLENFRKQNKLLDPEV----------QAKNLLDALAAVESERRTIRA
A0A433W4W4      LPKIRKDVSQAEANLENFRKQNKLLDPEV----------QAKNLLDALAAVESERRTIRA
K9U5W1          LPKIRKDVSQAEANLENFRKQNKLLDPEV----------QAKNLLDALAAVESERRTIRA
A0A254WLA7      LPKIRKDVSQAEANLENFRKQNKLLDPEV----------QAKNLLDALAAVESERRTIRA
A0A2W6ZAV2      APVLQQGVVELQQQLSSFRRQNSFLDPSS----------QGEAIQTQRQALNVRLDDLRQ
A0A2G7GMH8      LPVIKDRVNQAENALELFRESNNLIDPEL----------QAKALTDALNNVKQEQRTNRN
K9W742          LPKARLSVTQSEAALEKFRKTQNLIEPDA----------QTTALTTALNAIQDERRRNQA
K9SA61          LPKVQAEVREAEAALEAFRKNQNLIDPEA----------QSQTILEALSRTRQEQQTNQA
A0A350Y7Z1      LPTARDNVIQAEKALEQFRETQNLIDPVQ----------QATTITDALSTVEQEQQAIRA
A0A352X2A7      LVTAANNVNKAERSLEEFRENQNLIDPLQ----------EASNVGETLTKIEQERQAVRA
K9XPB0          IPAAQQEVAAIEAKLTQLRSENNLVSPQG----------ESESIKAVLNNIQQERATLKA
A0A0D8ZYV0      IPGVRNQVAQSEAQLEKFRTNQNLIDPEQ----------QAAAINNSLNAVVQQRQVLRA
A0A3D1PBA3      IPVVSKTVDQAENKLEQFRKNYNLIDPEQ----------QATAVSQSLNAIAQERQVIRA
A0A254WJ87      IPAVTKTVDQAENKLEEFRKNNNLIDPEQ----------QAATVNQSLNAIAQEREVIRA
A0A2T1FP73      IPAVTKTVDQAENKLEEFRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRA
A0A433VMS2      IPAVTKTVDQAENKLEDFRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRA
K9TYA7          IPAVTKTVDQAENKLEEFRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRA
A0A2P8QUE1      IPAVTKTVDQAENKLEEFRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRA
A0A2T1DWE8      LPLVEKQVDRAEDAMERFRKSQNLVDPEV----------QSRALIDALSNLQKEQQTNQA
A0A1U7I8L3      LPSLRESTVRTEAALEKFRKSQNLIQPEL----------QAKALIESLKDIQYELRTARA
A0A2T1DJL8      IPQVEARVNQAEAALERFRKNQDLIDPEL----------QSKSMVDSLAAVQKDQRANRT
A0A1Z4J9W0      IPEVQAKVNQAESNLERFRSTSNLVDPEV----------QAKSLVDSLKELQQNQQENRG
A0A0N7Z5K9      IPQVQEKVNKAEADLERFRKSSNLVDPED----------QSRALIESLRELQKDQQSNRG
A0A0S3TXC5      IPQVQAKVDKAEADLEQFRKSSNLVDPED----------QSRALVESLRELQKDQQSNRG
A0A2T1DNG3      LPQVEGKVKDAEAALEQFRRDQSLIEPSA----------EAAAQTEMLNRLQADKQATLV
A0A2P8W9H0      LPEVRERVSSLEAELEDLRQRSNLIDPLK----------QGEQLSTQTAKFTAEQFDLRL
A0A3S0Y9N9      LPLSKAALQAAEKKLQDFKQQYKVLDLKS----------EATSSVTILTDLEKQVAETIS
A0A433UNK7      LPLRKAALQTSERRLQFFKQQNRVLDLKA----------EASASVAILTDLDKQVAATRS
B8HNB0          LPAAQAKLAQSAQAVRNFRKQYGLVTPDA----------YAEAVVSTRMELEKQGKDAEI
A0A1Z4LN32      LPSAKRGLSKVTEELRDFKQKNKVIELKE----------ETTKAVQIIHEIDKELTEARS
A0A2I8A9F5      LPGAKTELEEAQKALLQFKTQNKIVNLEE----------ESSGLVKNAITIDSEINNARA
A0A218Q6R8      LPQAKKELEEITEALRQFKTQNQIVDLQE----------EKNATVTIVLALDEELNNARA
A0A0C1XVC4      LPRAKAQLEKAAEALREFKLKNQILELAE----------ETRASVKNISDVENELAKARS
A0A218QGE0      LPRAKAQLEKAAEALRKFKLKNQILELAE----------ETKASVKNISDVEIELAKARS
A0A3B8Y8H9      LPKLDQEVSSLQKELERFRKKHNFIDPQS----------QSRILSSNLTNIIQKKQENQS
A0A1Z3HMQ0      LPKAEAEVEQAAEALRQFKDQNQIIALES----------EANAAVSMINNLETQIGQAQA
A0A1E5QP61      LPDTEETVRQAEAALRAFKEENSVVSLQD----------EATSAVISISNLDSEVIKAQA
A0A3M2GIL5      LPEIEARLSRAEAELRNFKERNNIVELEE----------EARSAVFVMGEIETEKSKKEA
A0A433NM31      LPKSKISVQKAEAQLREFKERNNILDLEN----------EAKAAVTLVTDLENQIAQAQI
A0A3M1PML8      LPKTEAAVKAADSDLRRFKEANGVVLLES----------EAQEAVNIISKLEDQVTQARA
A0A352X442      LPRLKQNVSIADAELRNFKEQNKIVDLVN----------EAKSSVETVADLDTQIAQTQA
A0A0T7BPZ0      LPISESSVRAAESAFRQFQERNKIIILQE----------QESNAVKMISSLEDEIAQAEI
A0A0M0SHU3      LPKTEEAVQKAELALRRFKEKNKVIVLQE----------EATAAVNTISKLEDEIAEAQA
A0A1D2PBN3      LPATETSVKRAEAELRRFKEENKVIALQE----------EATAAVNEISKLEEQISQAQA
A0A0C2LVR7      LPATEISVKRAEAQLRRFKEENKVIALQE----------EATAAVNEISKLEEQISQAEA
A0A1Z4PQB9      LPATERSVKRAEAELRRFKEENKVIALQE----------EATAAVNEISKLEEQISQAQA
A0A1Z4SFN6      LPATELSVRAAESTLRKFKEENKIINLES----------EAGLAVERISNLEQQLAQAQA
K9PGI8          LPATEISVRGAELALRKFKEENKIIALQE----------EASTAVQVISRLEEQINQTQA
A0A2W1JVB9      LPKTREKIENLEEQLRRFKETNKIVAIDK----------EAEVAVEAVIRLAEKINEAQG
A0A3M1SVZ4      LPDAEYTLSQAEQELRQFKEENNFFALQE----------EAAAATQLMTGLQQRITDTQS
K9SSQ0          IPDAKKQLDQNSTALTRFRQQYNITDPDT----------YAASIFSTKQGLATQIQDLQI
A0A2W1JIN9      IPQRRQELLQVEARMSKFKQEYGYVTLSA----EGNNNEANQLLVNSYAQLEGQIRDLTS
A0A318AJV1      LDELARQVNDADTRLAAYRAGTGLSADGA----------GSNVVDQQIATLSGQLANAEA
A0A254WHG9      VPKKRAQLAQVEATLSQYKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLA
A0A2P8QIL5      VPKKRAQLAQVEATLSQYKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLA
A0A2T1FLY5      VPKKRAQLAQVEATLSQYKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLA
A0A433W447      VPKKRAQLAQVEATLSQYKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLA
K9U1K8          VPKKRAQLAQVEATLSQYKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLA
A0A1U7N2U4      VPLRRLEVEATEAALNKFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSI
A0A1D9G1F2      VPLRRLEVAAAEAALNKFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSI
F4XV38          VPLRRLEVAAAEAALNKFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSI
K9UYB2          LPKARQALMVAEMEESAYRERTGIISFDE----------QTKSLVQSLAALEDQQRTLGT
A0A0C1XJI7      IPNAYKRLREAENKESQYRHISGIISFEE----------QTKSTVESLATLEDQERSLTA
A0A218QN17      IPNARKRLATAEQNESNYRHISGIISFEE----------QTKSAVESLATLEDQERALTA
K9RKN2          LPIARKKLREAEATESQYRQASGIVSFAE----------QTESLVENLSSLEEQERTLSA
A0A2I8ADV2      VPVARNRLQQAEVAESRYRQKSGVVADTD----------QTKSLVQSLTNLEDQERTLIA
A0A1W5CKM3      VPIARQRLLQAELAETKYRQQSGVVATDD----------QTRSLVNSLAELENQERILAV
Q3MEW0          VPIARQRLLQAELAETKYRQQSGVVATDD----------QTRSLVNSLAELENQERILAV
A0A1Z4KIC7      VPIARQRLLQAELAETKYRQQSGVVATDD----------QTRSLVGSLAELENQERTLAV
Q8YSM5          VPIARQRLLQAELAETKYRQQSGVVATDD----------QTRSLVGSLAELENQERTLAV
A0A1Q4S1H4      VPNAQQRLKVAEIKENKYRQTSGIVSFDD----------QSKSLVTSLANLEDQERMLFA
A0A433VBU6      VPNAQQRLKAAEIKENKYRQTSGVVSFDE----------QSKSLVTSLANLEDQERMLFA
A0A1Q4RZJ6      LPQARTQLQAAEVAENNYRQQSSIVDFDE----------QTKSLVQSVASLEDQQRNLAT
A0A1Z4SNV3      LPQARAQLQAAEAAENKYRQASIIVNYDE----------QTKSLVQSVASLEDQQRTLAT
A0A2H2XJQ1      LPQARAQLQAAEAAENKYRQASIIVNYDE----------QTKSLVQSVASLEDQQRTLAT
A0A3S5K358      LPQARTQLQAAEAAENNYRQQSSIVDFDE----------QTKSLVQSVASLEDQQRTLAT
A0A0T7BPJ4      VPAAQRNLTVAEANENRQKQASGIVSFDE----------QSKSVVTSLASLEDQERTALA
A0A0C1QS61      VPKAREKLENAELTENRYRRSSGIISFTK----------QSESLVDSLAALENQERTLSA
A0A139X3R8      VPKARQNLEDAELKENKYRQSSGIISFTK----------QSESLVDSLATLENQERTLSA
A0A1Z4I7C5      VPQARQRLQQAELAETRYRQQSGVVAADD----------QTKSLVGSLADLENQERTLAA
A0A0C2MDK7      VPEAEKKLLQAEDLENKYRKSSGIVSVEE----------QTKSLVQSIATLEHQERTLSA
A0A1Y0RCK1      VPEADKQLRQAEAQENKYRQLSGIVSLEE----------QTKSLVQSIATVEDQERTLSA
A0A1Z4PWZ0      VPSAEKQLLQAEEKENKYRKSSGIVSFEE----------QTKSLVQSIATVEDQERTLSA
A0A0C2QLT0      VPEADKQLRLAEATENKYRKLSGIVSLEE----------QTKSLVQSIATVEDQERTLST
A0A1Z4J2K1      VPEADKQLRLAEATENKYRKLSGIVSLEE----------QTKSLVQSIATVEDQERTLSA
A0A3S0ZSX0      VPEARQRLEKAELIENKYRQDSGIVSFDE----------QTKSLVNSLATLEEQEGTLSA
A0A2N6K4T3      VPDARKRLQEAEQKENRYRQSSGIVSFDE----------QTKSIVESLATLEEQENTLSA
A0A370CKT2      VPEARKQLQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSA
A0A0S3TL97      VPEARKQLQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLATLEQQENTLSA
A0A2N6M8A0      VPEARKQLQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLATLEQQENTLSA
A0A2N6M9E1      VPEARKQLQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLATLEEQENTLSA
A0A2N6KJI4      VPEARKQLQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLANLEEQENTLSA
A0A2N6MZ77      VPEARKQLQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLANLEEQENTLSA
A0A2N6KT20      VPEARKQLQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSA
G6FSN3          VPEARKQLQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSA
A0A0D6YL98      VPDARKRVEEAEQKENKYRQSSGIVSFDE----------QTKSLVNSLATVEEQENTLVA
A0A328I8B9      VPDARKRVEEAEQKENKYRQSSGIVSFDE----------QTKSLVNSLATVEEQENTLVA
A0A0M0SU69      VPDARKRVEEAEQKENKYRQSSGIVSFDE----------QTKSLVNSLAIVEEQENTLVA
A0A1Z4TIZ8      VPDARKRVEEAEQKENKYRQSSGIVSFDE----------QTKSLVNSLATLEEQENTLVA
A0A318BG22      LTQQRARLEESERQLVAYAEQNGIISVTD---------AKTAGTGSGAQSLDSASMAALN
A0A2T1E9V8      LPKVKANVYNADAAIRKFKEKYKLTDLAQ----------TQRSVAENIERIGSQVDSIEA
A0A0P1C0L3      IEELRERLSISERDLVEYANENEILVLET-------GNREEGSGTASQTLIATDLAALNE
A0A3M2GQQ6      LPKAQQELSESALAIQSFRQTYGIVDPES----------YANQVLDIKQSLEKDAQSLEI
K9SGJ5          LPQVKKDLDESALTVTKFREKYKIVDPDT----------YAASVYTMKQDLDTQAQQLQI
L8MYT6          LPQVKQKLEKSALAVTQFRKTYNIVDPDT----------YAAAVFKMREALETQAQELQI
A0A352JGJ6      LPQVKQQLDKSALAVTRFRKTYNIVDPET----------YAAAVFKMREVLEVQAQELQI
A0A1J5GLS2      LPQVKQQLEKSALAVTQFRKSYNIVDPET----------YAASVYSMREALEKQAQELQI
A0A2W4W6M5      LPQVKQQLDKSALAVTQFRKTYNIVDPET----------YAASVYKMREALEVKAQELQI
A0A2W7AN33      LPQVKQQLDKSALAVTQFRKTYNIVDPDI----------YAASVYKMREALETQAQDLQI
A0A256BLV2      LPQVKQQLDKSALAVTQFRKTYNIVDPDT----------YAASVYKMREALENQAQDLQI
A0A2W6ZXF3      LPQVKQQLDKSALAVTQFRKTYNIVDPET----------YAASVYSMREALEKQAQDLQI
A0A2Z5WX66      LPQVKQQLDKSALAVTQFRKTYNIVDPEV----------YAAAVFKMREALEAQAQDLQI
K9W1T3          LPIIEVTVRQAEQDLRKFKEQNKVLDLAG----------EATSTTEVLNNLTQQISEAQS
A0A0D6YBN8      LAQAKQRLDDSQRQLVSYAEQQRIINLPS------QGA--NENTTAERSIVADELASLNS
A0A318BJ18      LALQKERLDDSQRQLVAYASAQQIINLPA------PGSGIGGTTTVERSIVADDLAALNA
A0A1Q4RTR1      LPEVEAKVRQAEVSLRLFKEKNRVVELQQ----------EAKTSIANQSDLADEIIKTEA
A0A1Z4SQV2      LPEVETKVRSAEYGLRQFKEKNRVVELQE----------EAKTSIKNQSDLADQIIKSEA
A0A2H2XGN1      LPEVETKVRSAEYGLRQFKEKNRVVELQE----------EAKTSIKNQSDLADQIIKSEA
A0A433UXH8      LPEVETKVRSAEYGLRQFKEKNRIVELQE----------EAKTSIKNQSDLADEIIKSEA
A0A1Z4RMB9      LPSIESKVQQAESQISAFRTQNNIVDIEE----------EKRGVVESIGALNQQISTTGS
D5A466          LPRVQQELFLAEKSIQNFKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEA
K1XF69          LPRVQQELFLAEKSIQDFKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEA
B5W297          LPRVQKELFLAEKSIQDFKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEA
H1W7M8          LPRVQKELFLAEKSIQDFKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEA
B4WP72          LPQTESAVSAAEANLRQFKEENGVVDLEQ----------EAAQAVDSIGNLDTQIDQAKT
A0A318B4H2      LAQLRSRLEASERELVAYASGKGIVSFSSGSTEKGGGGGERTLVTDDLSSLNTALNAAVA
B4WQE3          LPAVRARVNELEAELEALRQNSNLIDPLA----------QGDQLSQQMAQFTSDHLNLQV
A0A2K3BR24      LPKTEQSVQAAEEKFREFKEENNIIALSQ----------EASSTVDILASLDQQLIQAQA
K9YXY1          LPKTEQSVQAAEEKFREFKEENDIIALSQ----------EASSTVSILASLDQQLIQAQA
A0A2P8W4F7      LQEKWQEVEAIESDLSEFQKRYDIVDVNA----------TSESVTQRLNQMLADQEQLRV
U5QJM6          LPRVRMNVEASEEALRDFRSKNNILDPEE----------QAKALSGVMSDLMEEAEKAKV
A0A1U7HGH0      LPKVKANLQRADLAVRNFKEKNQLTNIEQ----------SQTALAANIERVGSQIDAVEA
K9XJD3          LPKVKANLQRADLAVRNFKEKNQLTNIEQ----------SQTALAANIERVGSQIDTVEA
K9SX01          LPKLQISLRQAEAALRRFKEVNKAYLPEA----------EAQSAVAAVTSLDTQITASKS
A0A1E5QIR9      LPKSEFTVQEAEANLRVFKENNRIVALDQ----------EASATVTLLGGLEGEITQAKV
A0A1Z4IBC7      IPKAEESVKKAESELRIFKEINKIVALEQ----------EATVAVDTVSKLSNQISQAQA
A0A1W5CPC7      IPKAETSVKKAESELRIFKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQA
Q3MDC6          IPKAETSVKKAESELRIFKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQA
A0A1Z4KM73      IPKAETSVKKAESELRIFKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQA
Q8YNX7          IPKAETSVKKAESELRIFKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQA
A0A367R4K6      LPKAEEIVSRAESQLRLFKEKNKVIVLDQ----------EASAAVDTISKLDNQIYQAQA
A0A1E2WSV8      VPKAEEIVRRAESKLRLFKETNKIVVLEQ----------EATAAVDTISKLGNQISQALA
A0A2R5FRT9      VPKAEEIVRRTESKLRLFKEKNKVVVLGQ----------EASAAVDTISKLGNQISQALA
A0A2K8T1B6      VPKAEEIVRRAESKLRLFKEKNKVVVLGQ----------EASAAVDTISKLGNQISQALA
A0A235I9I0      VPKAEEVVRRAESKLRVFKETNKVVVLDQ----------EAAAAVDTISKLGNQISQALA
A0A2D0HQT8      VPKAEEVVRRAESKLRVFKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALA
A0A2L2NU95      VPKAEEVVRRAESKLRLFKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALA
A0A367S084      VPKAEEVVRRAESKLRLFKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALA
A0A0V7ZFJ4      LPEVEQRLIRAEAELREFKEKNGIVALEQ----------EAQTGVEALKDLSEEIVKAQA
A0A0V7ZNJ9      LPEVESRVVKAEAELRKFKEENKVVALKE----------EAQFGVEGLKDSLQELNQAEA
A0A367RIS1      LPLVEAKVAEGEAALRQFKEKYEVVSLEV----------EAQEGVRSLNELSNQITQLRA
A0A235IXQ2      LPLVEAKVTEEEAALRRFKEKYEVVSLEE----------EAKEGVKRLNELSSQITELRA
A0A1W5CNX3      LPLVEAKVTEAEAALRRFKEKYEVVSLQE----------EAIQGVKRLNDLSGQVTQLRA
Q3MEB7          LPLVEAKVTEAEAALRRFKEKYEVVSLQE----------EAIQGVKRLNDLSGQVTQLRA
A0A1Z4KHN9      LPLVEAKVTEAEAALRRFKEKYEVVSLQE----------EAIQGVKRLNELSGQVTLLRA
Q8YT70          LPLVEAKVTEAEAALRRFKEKYEVVSLQE----------EAIQGVKRLNELSGQVTLLRA
A0A218Q4C1      LPLVEAKVSEAELALRRFKERNEVVALEE----------EAKQGVERVYEISNQITLLRA
A0A166IWU6      LPLVEKQVAESELALRQFKEKYEVVLLEE----------EAKQGVERLYQISNQLTLLRA
A0A2S0Q8C0      LPLVEKQVAESELALRQFKEKYEVVLLEE----------EAKQGVERLYQISNQITLLRA
W6FSX4          LPLVEKQVAESELALRQFKEKYEVVLLEE----------EAKQGVERLYQISNQITLLRA
A0A1B7WTD1      LPKVERRVTEAEIALRRFKEKNRVVALDV----------EARVSLESLGRLTESITQSQG
A0A1B7WX82      LPEVERQVTKAEMSLRRFKENNRVAVLDV----------EAKTGLESLAKLDQAIIESQG
A0A0R0M9H9      LPRIEKQVIKAELELRRFKEINRVVALDA----------EAKVGIETLGKIDEVITQAQG
A0A1S1ZVW2      LPRIEKQVTKAELELRRFKEVNRVVALDA----------EAKVGIESLGRIDEVITQAQG
A0A1Z4LRU5      LPQVEGRVVQAEAALRQFKEQNNVVALEE----------EAKFGVESLKDLSENITQSQA
A0A1Z4JVB4      LPEVENRVLRAEMALRRFKEKNRVVALDE----------EAKVGVEGLNQLSQEIISTQG
K9PIA4          LPQVEKRVMKAEMSLREFKEKNKVIALEI----------EAKAGVEGLKDLAAIITKVEA
A0A1Z4M597      LPEVEKRVLKAEMALRRFKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQG
A0A1Z4MWT1      LPEVEKRVLKAEMALRRFKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQG
A0A1Z4TX53      LPEVEKRVLKAEMALRRFKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQG
A0A1Z4HVE1      LPEVEKRVLKAEMALRRFKEKNRVVALDV----------EAKVGVEGLKDLLEEITKAQA
A0A252ECZ1      LPEVEKRVLKAEMALRRFKEKNRVVALDI----------EAKAGVEGLKDLLEEITTAQA
A0A1Z4G5Y1      LPEVEKRVLKAEMALRRFKEQNKVVALEV----------EAKTGVEGLKDLLGEITKAQA
A0A252DNA2      LPEVEKRVLKAEMSLRRFKEQNRVVALDV----------EAKAGVEGLKDLLEEITKAQA
A0A252E1Q4      LPEVEKRVLKAEMSLRRFKEQNRVVALDV----------EAKAGVEGLKDLLEEITKAQA
A0A2A2TNQ5      LPEIENKVVQAEATLRRFKDDNKVVSLAE----------EAKVGVEGMRNIAEESTRALA
A0A3S1C4K5      LPNIEGRVIAAEAGLRKFKDENKVVSLPE----------EAKYGVEALKDLSGDITKAQA
A0A1X4G3D5      LPRVERELAKAETDLRQFKESNEIISLEA----------EAESGMKNVSTVDAAINQAQA
D4TNI2          LPRVERELAKAETDLRQFKESNEIISLEA----------EAESGMKNVSTVDAAINQAQA
A0A1Z4H6Z8      LPEVEKRVLKAEMALRRFKEKNRVVALEV----------EAKVGVEGLKDLAEEITTAQG
A0A1Z4NPM1      VPQLERRVVVAEADLRRFKDENRVVELTE----------EAKVGVEAMRNLSAELTRAQA
A0A3F3KPR9      LPRIEKQVIKAELELRRFKEINRVVALDA----------EAKVGIETLGRINEVITQAQG
D4TGN7          LPRIEKQVIKAELELRRFKEINRVVALDA----------EAKVGIETLGRINEVITQAQG
A0A1Z4UZW9      LPEVEKRVTKAEMNLRRFKENNRVVALDV----------EAKTGLESLGKLDEAITKSQG
A0A0K2M5H0      LPEVEHRVTKAEMNLRRFKENNRVVALDV----------EAKTGLESLGKLNEAITQSQG
A0A1B7VSH4      LPEVESRVTKAEMNLRRFKENNRVVALDV----------EAKTGLESLGRLNEAITQSQG
A0A1B7W126      LPEVESRVTKAEMNLRRFKENNRVVALDV----------EAKTGLESLGRLNEAITQSQG
A0A3D4C6Q6      LPEVESRVTKAEMNLRRFKENNRVVALDV----------EAKTGLESLGRLNEAITQSQG
K7W0A4          LPEVEKRVTKAEMTLRRFKENNRVVALDV----------EAKTGLESLGKLDEAITRSQG
A0A1B7UTR1      LPEVEKRVTKAEMTLRRFKENNRVVALDV----------EARTGLESLGKLDEAITRSQG
A0A1B7UVJ4      LPEVERQVTKAEMSLRRFKENNRVAVLDV----------EAKTGLESLAKLDQAIIESQG
A0A2T1CIL7      LPKVELTVAKAEEDLRRFKTKNKIANLAQ----------EASNNINATKSLESEIDAVRA
A0A1Z4RPC6      IPKIEDKLQTLESRLQNFYERNQVVDLQE----------EKRILVGEVGNLNRQIADTGA
A0A2T1CMZ0      IPKIETKLNSLEANLQSFYEKNQVVDLQE----------EKKSLVDEIGTLNRAISGVGA
L8M4F7          IPTLKAKVESAESALAKFRADNKIVDLQQ----------EKQTVIEETANLNRQIAFIGS
L8LZE9          LPQVEKRLEEYESILQNIRERNNIVDLTQ----------EKRVLVQEIGTLNRQISAIGA
A0A140K2P2      LPQIESQVSQAESELRNFKESNQVVNLTK----------EAESTVMQMAEMNSEISKVAA
K9XWX4          LPQIESQVSQAESELRNFKESNQVVNLTR----------EAESTVVQMANLNSEIANVAA
A0A140KB14      LPQIEQKLSKAESDLRRFKEANRVVNLAK----------EKETLVLELGNLNQQIANVAA
K9XX88          LPQIEQKLSQAESDLRRFKEANRVVNLAK----------EKETLVVELANLNQQIANVAA
A0A433V7A0      LPTSEADVVRAEMALRKFKELNQVVDLNQ----------EATSTVKVIEDLEKAITQTQA
A0A0C2LBE2      LPTTEVSVKQAESALRQFKENNKIITLQE----------EASAAVQAIAKLNEQISQAQA
A0A433NN38      VPKTEQAVKQAEANLRKFKEANKVVVLQQ----------EAAEAVSTISKLEDNIATAQA
A0A2N6K0T2      LPKTEEAVQKAELALRRFKERNKIIVLQE----------EATAAVNTISKLEDEIAQAQA
A0A2N6ML72      LPKTEEAVQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQA
G6FQZ6          LPKTEEAVQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQA
A0A2N6MQX9      LPKTEEAVQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQA
A0A2N6KXT6      LPKTEEAVQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQA
A0A2N6KGB9      LPKTEEAVQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQA
A0A2N6L3Y5      LPKTEEAVQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQA
A0A0S3TIS7      LPKTEEAVQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQA
A0A1U7GW28      LPKTEEAVQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQA
A0A2N6LW63      LPKTEEAVQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQA
A0A1Z4TQ63      LPKTEEAVQKAELALRRFKEKNKVIVLQE----------EATAAVNTISKLEDEIAQAQA
A0A0D6YFE2      LPKTEEAVQKAELALRRFKEKNKVIVLQE----------EATAAVNSISKLEDEIAEAQA
A0A328IH74      LPKTEEAVQKAELALRRFKEKNKVIVLQE----------EATAAVNSISKLEDEIAEAQA
A0A1Z4NDS1      RPNAARIVQAAELELRRFKEENKVINLQE----------EATASVNAIARLEDQITQVQA
K9F4D9          LPESEEAVEEAEASLRRFKEGNNIVDLEE----------ESRNLVESLFTLDNALIQLKS
U9VXM0          LPESEAAVNEAEEALRQFREGNSIVDLEE----------ESRNLVESLFTLDNALIQLKS
A0A2T1FTR8      LPKIENEVKQAENDLRLFKEQYNVVDLPT----------ESVKAVETITSLNKEITSASA
K9UA41          LPKIETEVKQAENDLRLFKEQYNVVDLPT----------ESVKAVETITSLNKEITSASA
A0A1Z4SMD6      LPDSKAELEQAAEALRQFKNQFQIIELKD----------ESTAAINNVAKIDEEMNQVKA
A0A2H2Y096      LPDSKAELEQAAEALRQFKNQFQIIELKD----------ESTAAINNVAKIDEEMNQVKA
K9S8M8          LPKTEASLRQAEAQLRDFKERNGVISLNE----------EARTAVESIATLSTMIAQSEA
A0A1Z4NFV0      LPRARAELEKSAEELRKFRTQNQIANLPE----------EAKTTVESIAKLTDELNSTQA
B0CAX4          VPEVAAKLKNLDLSLRRFKETNGIIALEE----------EAKVSVEVEGNFYQEAAKMQS
U5DPF5          LPLTERSVREAEEALRRFKERNRIIVLNE----------EAQTTVRLLGSIDEELVKSQT
A0A350Y0P6      LPQIQNRVRQAESALRNFKEQHNIVSIDE----------EGTAAVEIMADLDKKISETKA
A0A352X940      LPKTESTVRQAEAALRRFKEENNIVAIEE----------EAKSAVQAMAELDSKLSQTKS
B8HTN4          LPDVTEQLRGLDRQIRSFKETHGIVDLPT----------EQIESVKFKSLLARDLAQAKS
A0A2A2TPF8      LPRAKGELDKTAEESRRFKEQNQIINLEE----------ESNETVKTIGELDKQLNETRG
A0A1Z4R0P8      LPRAKGELDKTTEDLRRFKERNQIINLEE----------ESNETVKTIGELDKQLNEAQG
A0A0T7BUI3      LPSSRKELESAAEALRQFKNKNKIVQLEQ----------ESSSAITSMAKLDEEINQATA
A0A1Z4LP32      VPLSRLELENATEALLQFKNQNQVIQLAE----------EATAAIQNISKLDDEINQARA
K9REP9          VPLSKIELEQATQALLQFKNKNQVIQLPE----------EATAAIQNISTLDGEINQARA
A0A1Z4SIJ3      LPFSRAELESASEALRRFKTENKIIQLSQ----------ESTAGINNIAQLDEQINQSKA
A0A2H2XPG4      LPFSRAELESASEALRRFKTENKIIQLSQ----------ESTAGINNIAQLDEQINQSKA
K9V3C7          IPQAKIELDKTSEALRNFKARNQIISLKE----------ESDSTVKIIEELSNKLNEARG
A0A1Z4T6Y7      LPRAEQELNKTTEELRSFKTNNKVINLDK----------ETEETVKNIGELDKQLNEVKG
A0A2H2Y561      LPRAEQELNKTTEELRSFKTNNKVINLDK----------ETEETVKNIGELDKQLNEVKG
A0A1Q4S362      LPRAEGQLNRATEDLRSFKAANQVINLEK----------ETEETVKNIGELDKQLNEVKG
A0A3S1CIN8      LPRAEGELNRATEQLRSFKAANQVINLEQ----------ETEETVKSIGELDKQLNEVKG
A0A2A2TC28      LPSSRAELERATEALRRFKIQNNIVQLPQ----------EATAAITNISNLNEQVSQNQA
A0A0C1NCB0      LPYARADLERASEALRQFKTSNKIVELKQ----------EATSAISNVAQLDDTINQAQA
A0A2N6K7Q9      LPASRQELERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKA
A0A2N6MXH6      LPASRQELERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKA
A0A2N6M5A8      LPASRQELERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKA
A0A2N6LL61      LPASRQELERAAEALRQFKIQNKVIQLAE----------ESTAAIDIIAKLDQEINQVKA
A0A0S3TP66      LPASRQELERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKA
G6FP91          LPASRQELERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKA
A0A1U7GYR5      LPASRQELERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKA
A0A2N6KY52      LPASRQELERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKA
A0A2N6KMP5      LPASRQELERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKA
A0A2N6MA45      LPASRQELERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKA
A0A1Z4TLC8      LPNSRRELERAAEALRQFKIQNRVIQLAE----------ESTAAIDIISKLDQEMNQIKA
A0A0M0SFT2      LPNSRRELERAAEALRQFKIQNRVIQLAE----------ESTAAIEIISKLDQEMNQIKA
A0A0D6Y7R4      LPNSRRELERAAEALRQFKIQNRVIQLAE----------ESSAAIDIISKLDQEMNQIKA
A0A328IGA1      LPNSRRELERAAEALRQFKIQNRVIQLAE----------ESSAAIDIISKLDQEMNQIKA
A0A0C2LFH0      LPQARVELNQAAEALREFKTRYKIIELPE----------EASAAVQNVASIDEEINQARA
A0A1Z4IYV4      LPYARAELDRSAEALRQFKIQYKIIELPE----------EASAAVKNLGQIDQEINQARA
A0A1Z4Q0T6      LPYARAELDRSAEALRQFKIQYKIIQLPE----------EASAAVQNLGQIDQEINQARA
A0A0C2PT44      LRYARAELERSAEALRQFKTRYKIIELPE----------EASAAVQNLGQIDQEINQARA
A0A1D2P6J4      LPYARAELDRSAEALRQFKTRYKIIELPE----------EASAAVKNLGEIDQEINQARA
A0A3M9ZEU1      IPRVEAAVRQAERALREFKEANQIVALDT----------EATAAVNIIASIDQQIADTEA
A0A1Z4JK72      LPRAEAELQKASEELRLFRTQNQIVDLER----------ESAANINSLSLLQDQLNQARS
A0A0N7Z489      IPPAEEALNRASEDLKNFRARNGIVDLER----------ESAANINSAAVLQDQLSQARA
A0A0S3TXS2      IPPAEEALNKASEDLRNFRAQNGIVDLER----------ESAANINSAAVLQDQLSQARA
A0A1Z4RN12      LPKAEENVREAEANLRIFKNRNRTINLDE----------ETASTIESISTIENQIDQVEA
A0A2T1CMF9      LPKLETEVENAEANLRNFKNRNGISDLQG----------QITADIDSVAQVENQINQVSA
Q7NDC5          LPAMEQRLRASERKLRSFKEQYGSVALAE----------EQQAAVRLLSEFRSQQAQADV
U5QGK3          LPKMEQRLRDSERRLREFKERYGSVALPE----------EQQAVVKQLAEFKSEQAQAAV
A0A2W4UY24      LPASKAKVGKIESDLRAFKEANGIVNLEE----------ESQNTVKTLSTVTDSITQLRS
A0A254WLE3      IPDVEARVRRAESALRRFKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRA
A0A433W533      IPDVEARVRRAESALRRFKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRA
A0A2P8QWJ3      IPDVEARVRRAESALRRFKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRA
A0A2T1FKP8      IPDVEARVRRAESALRRFKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRA
K9U6L7          IPDVEARVRRAESALRRFKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRA
A0A2T1GMT4      MPKTLAAVNAAESAVRSFKQQNNIVDLSE----------EAKSAVSVIGNLDNNINAVRS
K9UI51          MPKTLAAVNSAESAVRNFKQQNNIVDLSE----------EAKSAVGVIGNLENNINAVRS
K9TYI2          LPKSQAAVHQAEVKLRIFKQKNNIVDLSE----------EAKTAVANIGSLDNQIDNLKA
A0A254W5G5      LPKTQAAVHQAEVKLRIFKQKNNIVDLSE----------EAKTAVANIGSLDNQIDNLKA
A0A2T1FXY4      LPKTQADVHQAEVKLRIFKQKNNIVDLSE----------EAKTAVANIGSLDNQIDNLKA
A0A1Z4QL41      LPKTQTAVQTAEAALRRFKQQNSVVDLSE----------ETKSAVTIIGNLDNEINTIRA
A0A252D4T4      LPNTKNAVQEAEAALRIFKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKA
A0A252DJH5      LPNTKNAVQEAEAALRIFKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKA
A0A252EB80      LPNTKNAVQEAEAALRIFKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKA
A0A1Z4HPW5      LPNNRSAVQDAEAALRIFKQKYNIVDLAE----------ETRSAVAIIGNLDNNINGVRA
A0A1Z4MSN1      LPNNRSAVQDAEAALRIFKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKA
A0A1Z4U1C2      LPNNRSAVQDAEAALRIFKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKA
A0A0D6KV51      LPNNRSAVQDAEAALRIFKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKA
A0A1Z4MKF8      LPNNRSAVQDAEAALRIFKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKA
A0A2C6WC43      LPKTQEAVDKAERELRIFKQKNRIADLTE----------ETKSAVGIIGNLNNEINTVQA
A0A1Z4L5A1      LPKTQEAVDKAERELRIFRQKNRIADLTE----------ETKSAVSIIGNLNTEINTVQA
A0A367QD86      LPKTQEAVDKAERELRIFKQKNRIADLTE----------ETKSAVGIIGNLNNEINTVQA
A0A235IZ96      LPKTQAAVNNAEVALRIFKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKA
A0A2L2NGP0      LPKTQAAVNNAEVALRIFKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKA
A0A2K8SM78      LPKTQEAVNNAEVALRIFKQKHQIANLSE----------ETRSAVETIGNLDNEMNTVRA
A0A2R5FPC0      LPKTQEAVNNAEVALRIFKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKA
K9QM62          LPQTQAAVSTAEVALRKFKQQNNIVDLTE----------EARSAVTIIGGLDTEINTVKA
A0A1Z4FWI3      LPNTRAAVQEAEGALRRFKQSNNIVDLIE----------ETRSAVAIIGNLDNSINATRA
A0A1Z4JYE7      LPQTQAAVNYAEAVLRKFREQNNIVDLAE----------ETKTSVGVITGIDNEINAVKA
A0A140KBA0      LPEVEAKVAQAEADLRNFKNENQIANLSE----------ETTTLIETSKLVDTQIDQVAA
K9XSG1          LPEVEAKVAQAEADLRNFKNENQIANLSE----------ETTTLIETSKLVDTQIDQVAA
A0A0F5YE28      LPPVQQEVFRAEQALRSFKEKNQVLDLEE----------EFRTAVLEQAELNRKITVLES
U7QEH7          LPKVQEEVFRAEQALRSFKEKNQVLDLDA----------EFRTAVTELAELNRKITVLES
A0A3S1ATK5      LPKTQAAVYAAEVALRKFKQENRIVDLPE----------ETKSAVGIIGNLENEINTVKA
A0A2Z6CPH0      LPISQASVNRAEVALRVFRQKNNIADLSE----------ETKSSVGIIANLDNEINAIQA
A0A1Z4GT50      LPKMQAAVREAEVALRKFKEKHNIVDLSE----------EAKSGVAIIGNLNNEIHTIQA
A0A1Z4GIX0      LPNTQAAVHKAEVALRIFRQKNNIADLTE----------ETRSGVGIIGNLDNEINTVNS
A0A2H6LC24      LPNTQAAVHKAEVALRIFRQKNNIADLTE----------ETRSGVGIIGNLDNEINTVNS
B2J6N5          LPKTQEVVNNTEVALRIFKQKYQIADLSE----------ETKSAVATIGNLDNEMNTVKA
A0A367RMI4      LPTTQAAVNNAEVALRIFKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKA
A0A235HUM0      LPTTQAAVNNAEVALRIFKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKA
A0A2L2NW47      LPTTQAAVDNAEVALRIFKQKHQIADLAE----------ETRSAVATIGNLDNEMNTVKA
A0A1E2WUR1      LPKTQAAVNNAEVALRIFKQKHQIADLSE----------ETRSAVATIGNLDNEMNSVKA
A0A235IKU3      LPKTQAAVNNAEVALRIFKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKA
F4XKF3          LPQSEANVRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQA
A0A1D9FX10      LPQSEANVRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQA
A0A1D8TNX9      LPQSEANVRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQA
A0A1U7MYU6      LPQSEANVRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQA
A0A3C0NJ41      LPKAETNVGQAETSLRRFKQENQVIALDE----------EAKSAVGVMANLEQQITQVQA
A0A352AG88      LPKAEANVNQAEMALRQFKEVNKVVSLEE----------ESRAAVDTLAKLDQQITEVKS
A0A350Y374      LPKAEANVNQAEAAVQEFKERNQVVALDT----------EATTAVEVIAKLDEQIAQVQS
A0A355DPX0      LPKAEANVNQAEAAVQEFKERNQVVALDA----------EATTAVEVIAKLDEQIAQVQA
A0A0D8ZUV2      LPKTEARVRQAEAALRQFKEQNQIVSLDE----------EVKSAVGIIKELESQINTTEA
A0A433VDI0      LPRTETTVRQAEAALRQFKEQNRVVNLDE----------EAKSAVEIIQELESQINQSQT
A0A3D1PG43      LPTVQGTLRQAEAKLRRFKEQNQVVNLDE----------EGKSAVEVIKQLEDQVTATQA
A0A2P8QQ72      LPQTESTVRAAEASLRRFKERHQIVSLEH----------EAISAVEVLKELQDQITLAEA
K9TZQ7          LPQTESTVRAAEASLRRFKERHQIVSLEH----------EAISAVEVLKELQDQITLAEA
A0A2G7GPR0      LPQMEATVRQAELALRQFKEQNQVVALDE----------EAKTAVAAVKQLENQITETQA
K9XH68          LPQMETTVRQAELALRQFKEQNQVVALDE----------EAKTAVAAIKQLENQITETQA
A0A1U7HW70      LPQMETTVRQAELALRQFKEQNQVVALDE----------EAKTAVAAIKQLENQITETQA
A0A2S6VEJ8      LPQMEATVRQAEQALRQFKEQNQVVALDE----------EAKTAVAAIKQLENQITETQA
                                                                            

K9SLA9          ELAEVGA----RSKQLQQSL-----GMDAGLSV-----------A------WSSP-SAQQ
A0A168TT23      DLVQLRA--------FSQLI-----DQGRGDSI-----------R----PVVNDG-QIAE
A0A0M1JWX9      ALIQQQQ----LYTTLRQQV-GL--DPDVAIAS-----------S----VLSEAP-SYQS
A0A2T1M1V6      EAESHAT----QARVAAAQL-GM--NPQHALNS-----------L----RLAENK-EYQS
A0A2G7GCS2      QAQANQA----QAQAASQRL-GI--NAQQAMNS-----------L----RLGENR-EYQA
K9XBH8          QAQGSQA----QAIEASGRL-GM--NAQQAMNS-----------L----RLAENK-EYQA
A0A1Z4LJ30      QAQEFQS----RAKMLSARI-EM--SPSTAVNS-----------V----KLKENK-EYQL
K9RI76          EAESAAA----RVRMLSNRI-AL--SPAAAVNS-----------V----RLKEYK-EFQL
A0A352AE27      QALASIN----EVRTLSNRL-GL--TPDQAIRS-----------L----GLAENP-DYQF
A0A3B8JH60      LAQAGQN----RVSVLSAPL-SL--TPDQAIKS-----------L----GLGENQ-NYQF
A0A3C0N766      LAQAGQN----RVSVLSARL-SL--TPDQAIKS-----------L----GLGENQ-NYQF
K9W9J7          QAQASEN----RIQVLSSRL-SL--TPNQAIRS-----------L----GLGENQ-NYQF
A0A139WSU3      TAEASEN----RAKALSIRL-SL--TPNEAIRS-----------L----GLGENK-EYQF
A0A433VN22      LAQASAS----RSKVLSERI-NM--APASAVRS-----------L----SLSENQ-EFKA
Q7NF11          EGTADKA----RAQMLTARL-GM--DAPQAMRA-----------L----RLGESK-EYQA
A0A1Z4JCS8      ESQATRD----RANTLATRL-NL--SPTDAVQA-----------L----GLDQNE-DYKE
F4XTX2          EAQASQH----QLQILSTRL-GL--TPKQAIRS-----------L----GLAENR-DYQF
Q7NJN6          QAEAAAR----RATALEQAV-GM--DLRRATAA-----------L----NLGEDK-GLQA
U5QCC3          QAKAAED----RSRSLEQAV-GM--DLRRATSA-----------L----RVGEDK-EYQS
A0A0S3TYD7      KLVGAIQ----KVNALKNQV-GT--SNEIGVAQ-----------V----ALSQST-GVQE
U5QL42          NLAQTQR----QYSELRAQVGE---DPDIALSM-----------T----ILSQDP-TYTR
K9QF04          LLGETQS----TIKDLQQQLGI---DFKQAVAL-----------S----VLGEDP-NYLA
A0A3C0N2P0      QLSEAQK----LYTELQTQLSQLGVTPNQAIAS-----------S----ALSEAP-RYQA
K9TLQ0          QLVQAQA----LYGKLRGQLGL---ELEQAMLA-----------T----SLSDSP-RYQD
A0A076HBF2      DRNRLLK----VRGEIASGTLTARGFQEAIGQNNGGG----QANS----GLTVSD-VDQS
A0A354B169      ERNRLQR----VRAEISSGRLSARGFQEAISTGSGGS-SSDNSGK----GLSVGD-VDQS
G4FMX5          GRNRLSK----VREEIANGTLTARGFQEAIG-GMGNGLTAGGGVQ----GLTISD-VDQS
Q0IDT5          ERSRLKR----VRQDIASGSLSARGFQEAISTGSGGVVTGNQQSQ----GLAVSD-ADQS
A0A2D6FCW3      GRNRLLR----VRQEIANGTLTARGFQEAIG-GLGNGTTAGGDVQ----GLTISD-VDQS
A3ZA21          ERSRLQR----VRAEIAAGTLSARGFQEAISTGSGGG---GQSAQ----GLSVSD-ADQS
A0A140K3H3      ALARTQR----QYQEINRQLRDLGQNPETIVAY-----------T----LLSQDQ-VYQS
K9XUB8          SLAAAQR----RYEEINRQLRELGQNPETIVAY-----------T----LLSQDQ-VYQN
Q7NEU3          ELEASKE----HYWALSERLGI---SPGQALAS-----------A----TLSKDG-PYQE
A0A352XE00      QLAEAKA----LYNQLESQLAELGVSPDRAIAA-----------S----ALSEAP-RYQD
B4VS56          QLDEART----LAVQLQSQLGELGLSPKQAIAA-----------S----ALSEAP-RYQQ
A0A352AAQ3      QLVEAQR----LYTELQDQLGQLGVTPDQAIAA-----------A----ALSEAP-RYQQ
A0A350Y472      QLIESQQ----LYAELQTQLGQLGVTPDGAIAA-----------S----ALSEAP-RYQD
A0A355DVB4      QLIESQQ----LYAELQTQLGQLGVTPDGAIAA-----------S----ALSEAP-RYQD
A0A2P8VVX1      ELSGLEQ----QYATLEQQLNL---SPQSGVIA-----------A----RLSQSP-RIQS
A0A2P8WHY0      QLTELKS----RYQTLEQRTQL---SPANALLA-----------A----RLSQSQ-RVQQ
A0A2T1CMT9      QVGEIAG----SSSALQEQLGV---SVENALAL-----------S----RLSQSP-RYQN
A0A1D8TX52      QYMETQT----RYEAVQQKLAR---SPQNALTS-----------S----RLSQSG-RYQN
A0A1U7N5X9      QYMETQT----RYEAVQQKLAR---SPQNALTS-----------S----RLSQSG-RYQN
A0A1D9G4T2      QYMETQT----RYEAVQQKLAR---SPQNALTS-----------S----RLSQSG-RYQN
F4XP71          QYMETQT----RYQAVQQKLAR---SPQNALTS-----------S----RLSQSG-RYQN
A0A2P8QVH5      QFQDQQA----RYNKLQQQISR---SPQQALIA-----------S----RLSQSP-RYQS
A0A2T1FT70      QFQDQQA----RYNKLQQQISR---SPQQALIA-----------S----RLSQSP-RYQS
A0A433W4W4      QFQDQQA----RYNKLQQQISR---SPQQALIA-----------S----RLSQSP-RYQS
K9U5W1          QFQDQQA----RYNKLQQQISR---SPQQALIA-----------S----RLSQSP-RYQS
A0A254WLA7      QFQDQQA----RYNKLQQQISR---SPQQALIA-----------S----RLSQSP-RYQS
A0A2W6ZAV2      TEAKLLG----MASAVGSGMLT---GPQVQGSAGDPGSGSQDKPA----QGTMTT-TTSS
A0A2G7GMH8      QIQQTQS----RLHNLQQQLAR---TPRNALVS-----------S----RLSQSQ-RYQN
K9W742          QYRELQA----SYNTLQQQVAR---SPQDALVS-----------S----RLSQST-RYQS
K9SA61          ELQATQA----QFASLQRQLGR---SPQAALLA-----------S----RLSEST-RYQA
A0A350Y7Z1      QYQETQA----RYRVLQQQLER---SPQEALTS-----------S----RLSQSP-RYQA
A0A352X2A7      QYQETLA----RYNSLQKQLNR---STSEALTS-----------S----RLSQSP-RYQS
K9XPB0          EQKQTQG----NYRQLQQELGL---SAENSVAM-----------T----RLNQSS-QYQS
A0A0D8ZYV0      QFQDTEA----RYRVLQQQVGS---TPQVALSS-----------S----RLSQSP-RYQS
A0A3D1PBA3      QYKDLQA----RYNALQQQLAR---SPQQALAA-----------S----RLSQSS-RYQT
A0A254WJ87      QYNDLQA----RYGQLQQQLAR---SPQQALVA-----------S----RLSQSS-RYQT
A0A2T1FP73      QYNDLQA----RYGQLQQQLAR---SPQQALVA-----------S----RLSQSS-RYQT
A0A433VMS2      QYNDLQA----RYGQLQQQLAR---SPQQALVA-----------S----RLSQSS-RYQT
K9TYA7          QYNDLQA----RYGQLQQQLAR---SPQQALVA-----------S----RLSQSS-RYQT
A0A2P8QUE1      QYNDLQA----RYGQLQQQLAR---SPQQALVA-----------S----RLSQSS-RYQT
A0A2T1DWE8      QIREVQG----RYQTLQQELAL---SPQQALIA-----------A----RLSQSS-RYQS
A0A1U7I8L3      QYQEAQS----RFQTLQQQVKR---SPQDAVVS-----------S----RLSEST-RYQT
A0A2T1DJL8      ELQDLQA----RYGALQQQLAR---SPQQATIA-----------A----RLSQSP-RYQA
A0A1Z4J9W0      LLASSRA----KFIALQQQLQR---SPGQATVA-----------A----RLSQSK-QYQA
A0A0N7Z5K9      ELASAQA----RFLALQQQLAR---SPEQATIA-----------S----RLSQSN-QYQA
A0A0S3TXC5      ELASAQA----RFSALQQQLAR---SPEQATIA-----------S----RLSQSR-QYQA
A0A2T1DNG3      QIRELQT----RYGDLQQKV-NL--SPQQAVLT-----------A----RLNQSG-RYQA
A0A2P8W9H0      QLEQSQQ----LYQELQQTL-----NNDGELAA-----------N----SALLNSNRYQA
A0A3S0Y9N9      ELASQTA----KMKSIKQLF-GV--NSQEAVVA-----------G----FASESP-STSL
A0A433UNK7      DLSSQTA----RMQSIQKLF-GV--ASQDAVVA-----------G----FVGESP-STVA
B8HNB0          AVKTTQR----QLEEVNQQLADLKVNPSQAVPI-----------S----VLLQDS-NYQK
A0A1Z4LN32      ELADVGG----QEKEVSSQL-NL--PLNKAVDI-----------S----SLSQVK-GVQE
A0A2I8A9F5      QLAETIT----REKQILNQI-NL--PADQAVDI-----------S----SLSQAA-GVQD
A0A218Q6R8      LLADVSA----QEKQIIGQL-NL--PAEQALAI-----------T----SLSQES-GVQE
A0A0C1XVC4      ELADASA----QEIQIRRQM-NL--PVDQAVDI-----------T----SLSQIP-AVQG
A0A218QGE0      ELADARA----QEIQIRRQM-NL--RVDRAVDI-----------T----SLSQVP-RVQG
A0A3B8Y8H9      LLQEQEI----RYRNLQQQL-AM--GEQEAIDL-----------T----ALSESP-RYMN
A0A1Z3HMQ0      QLASAIT----RTGELRRQL-GI--PLAQARQV-----------D----SLSQSP-GVQR
A0A1E5QP61      QYEDATA----RSQALQSQM-GL--NPQQALAI-----------N----TLSQSA-AIQQ
A0A3M2GIL5      ALADATA----RSAALQQQM-GL--NSAQAIAL-----------G----AIGESM-AVQN
A0A433NM31      NLANANM----RSAALQREI-GI--NVEQAKVI-----------N----ALSQSA-GVQK
A0A3M1PML8      ELSDTSA----RLSQLQGRV-GA--DPRRATVI-----------A----ALSQSP-GVQE
A0A352X442      KLAEATA----QTETLRSQV-GL--NSKTAVAV-----------N----SLNQSA-GVNQ
A0A0T7BPZ0      KLTEVNA----QLDKLRSQA-KI--DTWQAVTL-----------T----ELSKEP-RTQQ
A0A0M0SHU3      QLVDANA----RLEKLQNQA-RV--NSQEAISA-----------V----DLSQVA-GTQQ
A0A1D2PBN3      QLADVSA----RSQKLQNQA-KI--DSQQGVTF-----------T----SLSQTP-GIQQ
A0A0C2LVR7      QLADVTA----KSQKLQNQA-KI--DSQQGVTF-----------T----SLSQTP-GIQQ
A0A1Z4PQB9      QLADVSA----RSQKLQNQA-KI--DSQQGVTF-----------T----SLSQTP-GIQQ
A0A1Z4SFN6      EYANVTA----KSQKLQNQG-SI--DSPQSVTF-----------A----SLSQIP-GIQQ
K9PGI8          KLVEVGA----RTKKLQKQA-NV--NSQQAVTL-----------A----SLSQIP-GVQQ
A0A2W1JVB9      RAISAQA----QSDSLRKQL-GI--DKQKSIAS-----------T----TLSQSP-GVQV
A0A3M1SVZ4      QIASTNS----RYNALQNQL-GM--NPKQAAQR-----------T----VISQST-TIQE
K9SSQ0          KMAQTQR----QLQELQRQV-GR--PADVAISS-----------A----ILSQDA-NYQA
A0A2W1JIN9      QIQEVDA----RNLSLSTLTNAG--SINNTYTS-----------V----RTGQDP-ELQN
A0A318AJV1      EAAGARS----SASVAQGQVRSG--NVD---AV-----------V----GVQGSN-VIRD
A0A254WHG9      QLQEVKA----RNSSLEQVTDSS--TLKNTYAT-----------V----RSGQNE-QLQA
A0A2P8QIL5      QLQEVKA----RNSSLEQVTDSS--TLKNTYAT-----------V----RSGQNE-QLQA
A0A2T1FLY5      QLQEVKA----RNSSLEQVTDSS--TLKNTYAT-----------V----RSGQNE-QLQA
A0A433W447      QLQEVKA----RNSSLEQVTDSS--TLKNTYAT-----------V----RSGQNE-QLQA
K9U1K8          QLQEVKA----RNSSLEQVTDSS--TLKNTYAT-----------V----RSGQNE-QLQA
A0A1U7N2U4      QLQDAKT----RSQELQTITSLN--NTQNAYIA-----------G----RIGQDQ-ELQA
A0A1D9G1F2      QLQDAKT----RSQELQTITSLN--NTQNAYIA-----------G----RIGQDQ-ELQA
F4XV38          QLQDAKT----RSQELQTITSLN--NTQNAYIA-----------G----RIGQDQ-ELQA
K9UYB2          QLQEARS----RGESIRRITDTS--TLNNAYTT-----------V----RGGQDD-ELKK
A0A0C1XJI7      QLQEAKG----RDASLRQITDAK--SLDKAYAS-----------V----RGGQDE-QLKT
A0A218QN17      QLQEAKG----RDASLRQITSAK--SLDKAYAS-----------V----RGGQDE-QLKT
K9RKN2          LLEQVRS----QENSLRQITNAD--SLNSAYSS-----------V----RSGSDE-ELVK
A0A2I8ADV2      QLQEARS----REASLRQLTATK--NINNAYTS-----------V----RSGQDE-QLRS
A0A1W5CKM3      QLQETRS----RDASLRQVTDAK--NINTAYAS-----------V----REGQDE-QLKV
Q3MEW0          QLQETRS----RDASLRQVTDAK--NINTAYAS-----------V----REGQDE-QLKV
A0A1Z4KIC7      QLQETRS----RDASLRQVTDAK--NINTAYAS-----------V----REGQDE-QLKV
Q8YSM5          QLQETRS----RDASLRQVTDAK--NINTAYAS-----------V----REGQDE-QLKV
A0A1Q4S1H4      QLQEARS----RDSSLRQVTNSS--NLGNAYAS-----------V----RSGQDE-QIKN
A0A433VBU6      QLQEARS----RDASLRQVTNSS--NLGSAYAS-----------V----RSGQDE-QIKN
A0A1Q4RZJ6      QLQEANS----RLDSLRQVTQSK--GLDTAYES-----------V----RGGQDQ-ELQK
A0A1Z4SNV3      QLQDANS----RGESLRQITQAK--GLDRAYES-----------V----RSGQDQ-ELQK
A0A2H2XJQ1      QLQDANS----RGESLRQITQAK--GLDRAYES-----------V----RSGQDQ-ELQK
A0A3S5K358      QLQEANS----RLDSLRQVTQAK--GLDTAYES-----------V----RGGQDQ-ELQK
A0A0T7BPJ4      QLQELRS----RAASLEKITKTT--SLDKAYSA-----------V----RTGQDE-EVKK
A0A0C1QS61      QLRELRS----QDASLRQITNAT--ALKSAYAS-----------V----RGGQDE-QLKE
A0A139X3R8      QLQELRS----QDASLRQITNST--AVKSAYAS-----------V----RGGQDE-QLKE
A0A1Z4I7C5      QLQEARS----RDASLRQVTDAK--NITAAYAS-----------V----REGQDE-QLKA
A0A0C2MDK7      QLQEIKT----KDASLGQITNAG--NLNNAYSS-----------V----RSGQDD-EIKK
A0A1Y0RCK1      QLQEIKA----RDVSLRQITNTE--NLNNAYSS-----------V----RSGQDE-EIKK
A0A1Z4PWZ0      QLQEIKA----RDASLRQITDSA--TLNKAYSS-----------V----RSGQDD-EIKK
A0A0C2QLT0      QLQEIKA----RDASLRQITNTE--NLNKAYSS-----------V----RSGQDD-EIKK
A0A1Z4J2K1      QLQEIKA----RDASLRQITDAG--NLNKAYSS-----------V----RSGQDD-EIKK
A0A3S0ZSX0      QLQELRS----KEVSLRQVTDAK--ALDQAYAS-----------V----RGGQNE-ELKM
A0A2N6K4T3      QLQELRS----KEASLQQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A370CKT2      QLQELRS----KEASLQQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A0S3TL97      QLQELRS----KEASLQQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A2N6M8A0      QLQELRS----KEASLQQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A2N6M9E1      QLQELRS----KEASLQQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A2N6KJI4      QLQELRS----KEASLQQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A2N6MZ77      QLQELRS----KEASLQQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A2N6KT20      QLQELRS----KEASLQQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
G6FSN3          QLQELRS----KEASLQQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A0D6YL98      QLQELRS----KEGSLRQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A328I8B9      QLQELRS----KEGSLRQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A0M0SU69      QLQELRS----KEASLRQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A1Z4TIZ8      QLQELRS----KEASLRQVTDAK--ALNQAYAA-----------V----RGGQDE-ELKA
A0A318BG22      DRVAAAR----ANRILAEQAWNL--ARSPRADS-----------L----PEVRDNVQIAA
A0A2T1E9V8      QLSDLNS----RSKGIQQKL-GM--SPQEAIVT-----------A----SVSQSS-AVQG
A0A0P1C0L3      ALAQAVT----D---------RI--SAEASVLS-----------G----EFPAAD-ARNS
A0A3M2GQQ6      TLTRSQR----LYAELRSQM--V--EAGQNPDT-----------ALVHSLLSQDS-VYQQ
K9SGJ5          QMAQTQR----QFKELQRQV-GG--STDLVLGK-----------A----ILAEDI-TYQN
L8MYT6          KIAQSQQ----QYEALSRQV-GK--SAESAIGG-----------A----ILQQDP-TYQS
A0A352JGJ6      KIAQTQQ----QYKSLSRQV-GK--SPDAAISG-----------V----ILQQDT-PYQS
A0A1J5GLS2      RIAQVEQ----QFEILSRQV-GK--TPDAAISG-----------A----ILQQDI-PYQS
A0A2W4W6M5      QIAQVQQ----QYKALSRQV-GK--SPDAAIGG-----------A----ILQQDI-PYQS
A0A2W7AN33      KIAQVQQ----QYEVLSRQV-GK--SPEAAISS-----------A----ILQQDA-PYQS
A0A256BLV2      KMAQVQQ----QYEALSRQV-GK--SPEAAIGS-----------A----ILQQDT-PYQS
A0A2W6ZXF3      RIAQLQQ----QFEILSRQV-GK--TPDAAIGS-----------A----ILQQDV-PYQS
A0A2Z5WX66      KIAQFQQ----QYKSLSSQV-GK--SPNAAISS-----------A----ILQQDT-PYQS
K9W1T3          KYAAETS----RVQGLQQLF-GN--DLNATVVA-----------A----SVGESP-TTQK
A0A0D6YBN8      ALSQATA----DRISAEARV-RA--AGQAGQST-----------E----ALRNLA-----
A0A318BJ18      SLAQATA----ERIQAEARS-QQ--GGRAGASA-----------E----ALRNQA-----
A0A1Q4RTR1      TLVDTSS----KIISLQNQL-GL--NSQKAIAL-----------N----ALSQSK-AVQQ
A0A1Z4SQV2      QLVDISS----QIQALQNQL-SL--NSRQAVAL-----------N----TLSQST-AVQP
A0A2H2XGN1      QLVDISS----QIQALQNQL-SL--NSRQAVAL-----------N----TLSQST-AVQP
A0A433UXH8      QLVNISS----QIQALQNQL-GF--NSRTAVAL-----------Y----SLSQST-AVQQ
A0A1Z4RMB9      ELQGLKA----QTAALEGQL-GL--NLNQAVAA-----------N----QLGASP-EVQS
D5A466          ELNAVQS----LVNSLGNQV-GL--NLEEAIAV-----------N----TLSQSP-VVRS
K1XF69          ELNAVQS----LVNSLGNQV-GL--NLEEAIAV-----------N----TLSQSP-VVRA
B5W297          ELNAVQS----LVNSLGNQV-GL--NLEEAIAV-----------N----TLSQSP-VVRA
H1W7M8          ELNAVQS----LVNSLGNQV-GL--NLEEAIAV-----------N----TLSQSP-VVRA
B4WP72          ELANVNA----RLLELRRQL-GM--ELETAIEL-----------N----TLSQSP-GVQE
A0A318B4H2      E--------------------RV--AAESAVRA-----------A----SVSPNS-ASQG
B4WQE3          EIAQTTE----LYNDLQQEL-SR--IDNEYAST-----------S----ALAQSA-RYQS
A0A2K3BR24      SLDDAQT----RLEKLTEQL-GL--PPEQALAA-----------G----ALSQSE-AVQK
K9YXY1          SLDDAQT----RLEKLTEQL-GL--PPEQALAA-----------G----ALSQSE-AVQK
A0A2P8W4F7      DLTAMEP----LYDSLRDQV-GF--DPDTAIRV-----------A----NLNESP-TYQA
U5QJM6          ELQTSRK----QYLALASRL-GS--SPEQALAA-----------A----TLSEDK-IYQD
A0A1U7HGH0      QLVDLNS----RTQSLQRQL-GM--NPQQAMTI-----------A----TISQSS-AIQG
K9XJD3          QLVDLNS----RAQSLQRQL-GM--TPQQAMTI-----------A----KISQSS-AIQG
K9SX01          DLAKVNS----EINDIRTRL-GF--TSEQAIIL-----------T----KLSASK-PVQE
A0A1E5QIR9      ALNSANT----RVAALRSQT-GI--DSQQAIAL-----------S----ALSQSE-GVQK
A0A1Z4IBC7      QLNDVKG----RLEQLRAQA-QV--NSQQGVIA-----------S----ELSQAP-GVQK
A0A1W5CPC7      QLNDVTG----RLEQLRAQA-QV--DSQQGVIA-----------S----ELSQAP-GVQK
Q3MDC6          QLNDVTG----RLEQLRAQA-QV--DSQQGVIA-----------S----ELSQAP-GVQK
A0A1Z4KM73      QLNDVKG----RLEQLRTQA-QV--DSQQGVIA-----------S----ELSQAP-GVQK
Q8YNX7          QLNDVKG----RLEQLRTQA-QV--DSQQGVIA-----------S----ELSQAP-GVQK
A0A367R4K6      QLDDVKG----RLEQLRAQA-QV--NSQQGVIA-----------S----ELSQAP-GVQK
A0A1E2WSV8      QLDDVKG----RLEQLRSEA-QV--DSQQGVIA-----------S----DLSQAP-GVQK
A0A2R5FRT9      QLDDVKG----RLEQLSSEA-KI--DSKQGVIA-----------S----ELTQAP-GVQK
A0A2K8T1B6      QLDDVKG----RLEQLRSEA-KI--DSQQGVIA-----------S----ELTQAP-GVQK
A0A235I9I0      QLDDVKG----RLEQLSSEA-QV--DSRQGVIE-----------S----ELSQAP-GVQK
A0A2D0HQT8      QLDDVKG----RLEQLSSEA-QV--DSRQGVIE-----------S----ELSQAP-GVQK
A0A2L2NU95      QLDDVKG----RLEQLSSEA-QV--DSRQGVIE-----------S----ELSQAP-GVQK
A0A367S084      QLDDVKG----RLEQLSSEA-QV--DSRQGVIE-----------S----ELSQAP-GVQK
A0A0V7ZFJ4      YLGEVTT----RSEGLQKQL-QL--ETQEAVAI-----------S----TLNQSP-IVQE
A0A0V7ZNJ9      KLAAANE----RSQALQREL-DI--EKQKAVEL-----------S----ELSQSP-AVQQ
A0A367RIS1      RLVDARS----RSGALQNQL-AL--NTKQAMAL-----------S----TLSQSR-AVQE
A0A235IXQ2      RLVDARS----RSGALQNQL-AL--NTQQAMAL-----------S----SLSQSR-AVQQ
A0A1W5CNX3      QLVDART----RSGALQNQL-AL--NTKQAMAL-----------S----SLSQSN-AVQQ
Q3MEB7          QLVDART----RSGALQNQL-AL--NTKQAMAL-----------S----SLSQSN-AVQQ
A0A1Z4KHN9      QLVDART----RSGALQNQL-EL--NTKQAMAL-----------S----SLSQSN-AVQQ
Q8YT70          QLVDART----RSGALQNQL-EL--NTKQAMAL-----------S----SLSQSN-AVQQ
A0A218Q4C1      RLVDASS----RSSALQNQL-QL--NTEQATAL-----------S----TLSQSR-AVQQ
A0A166IWU6      RLIDASS----RSDALQNQL-AL--NTQKATAL-----------S----TLSQSR-AVQQ
A0A2S0Q8C0      RLIDASS----RSDALQNQL-AL--NTQKATAL-----------S----TLSQSR-AVQQ
W6FSX4          RLIDASS----RSDALQNQL-AL--NTQKATAL-----------S----TLSQSR-AVQQ
A0A1B7WTD1      ELAAAYT----RSVALQNEM-KL--TTQQAVDL-----------S----SLSQSP-GVQQ
A0A1B7WX82      ELVAAST----RSLALQYEM-KL--DTRQAVDL-----------S----TLSQSP-GVQQ
A0A0R0M9H9      QLAAAST----RSLALQNEL-QL--STQQAVAL-----------S----NISQIP-GVQQ
A0A1S1ZVW2      QLAAAYT----RSLALQNEL-QL--STQQAVAL-----------S----SLSQIP-GVQQ
A0A1Z4LRU5      NLVEAMT----RSEALQNQL-KL--QPQQAVAL-----------S----SLSQSP-AVQQ
A0A1Z4JVB4      QLVAAKT----WSVGLQDQM-AL--STKQAVEL-----------T----TLSQSP-GIQS
K9PIA4          ELVGANT----RSLALQNQI-EL--NTNQAVAL-----------N----TLNESP-GIQQ
A0A1Z4M597      ELTAAKT----RSLALQNQM-KL--NTDTAVEL-----------T----TLSQSP-GVQQ
A0A1Z4MWT1      QLTAAKT----RSLALQNQM-KL--NTDTAVEL-----------T----TLSQSP-GVQQ
A0A1Z4TX53      QLTAAKT----RSLALQNQM-KL--NTDTAVEL-----------T----TLSQSP-GVQQ
A0A1Z4HVE1      NLVDANT----RTQALQNQI-AL--NTQQAVEL-----------S----TLSQSP-GVQQ
A0A252ECZ1      ELADANT----RTRALQSQM-AL--NTQQAVEL-----------S----TLSQSP-GIQQ
A0A1Z4G5Y1      GLADATS----RTKALQSQI-AL--NTQQAVEF-----------S----TLSQSP-GIQQ
A0A252DNA2      ELADAST----RTRALQSQI-AL--NTQQAVEL-----------S----TLSQSP-GIQQ
A0A252E1Q4      ELADAST----RTRALQSQI-AL--NTQQAVEL-----------S----TLSQSP-GIQQ
A0A2A2TNQ5      VLEEAKS----RSGTLQKQL-DL--TTQKAVEL-----------S----TLSQTP-GIQQ
A0A3S1C4K5      LLSDASS----RSVALQKEL-EL--TTQQAVEL-----------A----NLNQST-GVQQ
A0A1X4G3D5      ELAVVYT----RSSALQNEL-QL--NKQQAVLV-----------S----TLSQIP-GVQE
D4TNI2          ELAVVYT----RSSALQNEL-QL--NKQQAVLV-----------S----TLSQIP-GVQE
A0A1Z4H6Z8      ELVAAKT----RSVALQSQM-EL--NPHQAVEL-----------S----TLSQSP-GIQQ
A0A1Z4NPM1      ALAEKNT----RVQTLQNQL-EL--NRQQAVEL-----------S----TLNQSQ-GVQQ
A0A3F3KPR9      QLAAAYT----RSLALQNEL-QL--TTQQAVAL-----------S----NISQIP-GVQQ
D4TGN7          QLAAAST----RSLALQNEL-QL--TTQQAVAL-----------S----NISQIP-GVQQ
A0A1Z4UZW9      ELAAVLT----RSVALQNEM-KL--GTQQAVDL-----------S----SLSQSP-GVQQ
A0A0K2M5H0      ELAAALT----RSVALQNEM-KL--GTQQAVDL-----------S----TLSQSP-GVQQ
A0A1B7VSH4      QLAAALT----RSVALQNEM-KL--DRQQAVDL-----------S----TLSQSR-GVQQ
A0A1B7W126      QLAAALT----RSVALQNEM-KL--DRQQAVDL-----------S----TLSQSR-GVQQ
A0A3D4C6Q6      QLAAALT----RSVALQNEM-KL--DRQQAVDL-----------S----TLSQSR-GVQQ
K7W0A4          ELAAAYT----RSVALQYEM-KS--TTQEAVDL-----------S----ALSQSR-GVQQ
A0A1B7UTR1      ELAAAYT----RSVALQDKM-KA--TTQEAVDL-----------S----ALSQSP-GVQQ
A0A1B7UVJ4      ELVAAST----RSLALQYEM-KL--DTRQAVDL-----------S----TLSQSP-GVQQ
A0A2T1CIL7      NLKDVNG----RFEQLRSQL-NI--SWEEAVAI-----------S----SLSQS--AVPQ
A0A1Z4RPC6      QLQGAKA----QTESLQNQL-GL--DLKQAIAA-----------N----QLGSTP-QVQS
A0A2T1CMZ0      QLQGKKA----QTDSLQNQL-GL--NLKQAIST-----------V----QLGNTP-QVQS
L8M4F7          QYRGTKA----QTDALQAKI-GL--SLEQAIAA-----------D----QLGSTP-VVKS
L8LZE9          QLQGAKA----QTGALSQEL-GL--SLEQAISA-----------N----QLGRTP-IVQS
A0A140K2P2      QLQGTMA----QSEALQSQL-NL--NLNQAIAA-----------N----QLGASP-VVDG
K9XWX4          QLQGTMA----QSEALQSQL-NL--NLNQAIAA-----------N----QLGASP-VVDG
A0A140KB14      QYQGTQA----QTATLNQQL-GL--NLNQALAA-----------N----QLGGTP-VVES
K9XX88          QFQGTQA----QTATLNQQL-GL--NLNQALAA-----------N----QLGGTP-VVES
A0A433V7A0      ELAEVNNYYQILQNQIQSQI-GM--SVQDALAR-----------S----TLSQSA-GVQD
A0A0C2LBE2      QLEDVTA----RSQKLQNQA-KI--DSQQTVTN-----------S----SLTQAS-GIQQ
A0A433NN38      QLVNVTA----QSQKLKEQI-EV--ESQKAITY-----------A----ELSQIP-GTQQ
A0A2N6K0T2      QLVDVNA----RLEKLQTQA-RV--NSQEAVSA-----------V----NLSQVP-GTQK
A0A2N6ML72      QLVDVNA----RLEKLQTQA-RV--NSQEAVSA-----------V----DLSQVP-GTQK
G6FQZ6          QLVDVNA----RLEKLQTQA-RV--NSQEAVSA-----------V----DLSQVP-GTQK
A0A2N6MQX9      QLVDVNA----RLEKLQTQA-RV--NSQEAVSA-----------V----DLSQVP-GTQK
A0A2N6KXT6      QLVDVNA----RLEKLQTQA-RV--NSQEAVSA-----------V----DLSQVP-GTQK
A0A2N6KGB9      QLVDVNA----RLEKLQTQA-RV--NSQEAVSA-----------V----DLSQVP-GTQK
A0A2N6L3Y5      QLVDVNA----RLQKLQTQA-RV--NSQEAVSA-----------V----DLSQVP-GTQK
A0A0S3TIS7      QLVDVNA----RLEKLQTQA-RV--NSQEAVSA-----------V----DLSQVP-GTQK
A0A1U7GW28      QLVDVNA----RLEKLQTQA-RV--NSQEAVSA-----------V----DLSQVP-GTQK
A0A2N6LW63      QLVDVNA----RLEKLQTQA-RV--NSQEAVSA-----------V----DLSQVP-GTQK
A0A1Z4TQ63      QLVDANA----RLEKLQNQA-RV--NSQEAVSA-----------V----DLSQVA-GTQQ
A0A0D6YFE2      QLVDANA----RLEKLQNQA-RV--SSQEAVSA-----------V----DLSQVA-GTQE
A0A328IH74      QLVDANA----RLEKLQNQA-RV--SSQEAVSA-----------V----DLSQVA-GTQE
A0A1Z4NDS1      KLVDATA----RVKTLQEQA-NI--NSQQAITS-----------S----SLSQIP-GIQK
K9F4D9          QLADSSA----QASQLQQKL-KL--SSDEAYAV-----------G----LVSESP-GIQT
U9VXM0          ELADSTA----QASQLQQKL-KL--SSQEAYAV-----------G----LVSESP-GIQN
A0A2T1FTR8      QLAAETS----RLEGLKNLFGGR--DAQATIQS-----------G----LVSESP-GLQK
K9UA41          QLAAETS----RLEGLKNLFGGR--DAQATIQS-----------G----LVSESP-GLQK
A0A1Z4SMD6      AIAEAIA----QETQLRSQLNIA--QNQPVVEI-----------A----SLNQIP-GVQE
A0A2H2Y096      AIAEAIA----QETQLRSQLNIA--QNQPVVEI-----------A----SLNQIP-GVQE
K9S8M8          MLQDATA----RSGQLQRSL-GM--DARQAIAM-----------N----AVGESP-AVQQ
A0A1Z4NFV0      ELAQVTS----QMGQLRSQM-NI--SSEQAVDI-----------S--------TP-GVQD
B0CAX4          LLINARA----KSRALRNKL-GL--TPQQGEDI-----------N----ALSQST-VVQQ
U5DPF5          SLNDTQA----RIQELSAQL-GL--SSAEALAA-----------S----ALTQSR-AVRD
A0A350Y0P6      QLQEKTT----TATELQDKL-GL--NSQQAIAL-----------N----KLNQSR-AVQQ
A0A352X940      NLEDATA----RSIAIQNQL-NL--NENEAVAL-----------N----SLSQSR-AVQQ
B8HTN4          LLATAQA----RATGLSQQV-GM--SIDLARFS-----------N----AVSQSK-GVQV
A0A2A2TPF8      QLAEATS----QQTELRSQL-KI--KSDRAVDV-----------A----SLSLIP-GVQE
A0A1Z4R0P8      QLAEVIS----QYQELRSQV-KI--PSETAVDV-----------A----SLSLIP-GVQE
A0A0T7BUI3      NLAETLA----QESQVGNQI-KT--VKNQAIEI-----------T----SLNQIP-GVQE
A0A1Z4LP32      LLADVSA----QESRVASKL-DF--STNEAVEI-----------T----SLNQIS-GVQE
K9REP9          SLAELTA----QESQLASKL-DF--SANQAVEI-----------T----SLNQIS-GVQE
A0A1Z4SIJ3      SLADISA----QEALIASQL-NM--QSKEAVEV-----------A----SVSQMS-GVQD
A0A2H2XPG4      SLADISA----QEALIASQL-NM--QSKEAVEV-----------A----SVSQMS-GVQD
K9V3C7          QLADVAS----QQAEVRLSA-NI--PRDRTVTQ-----------TVNVSSLSVNP-GVQG
A0A1Z4T6Y7      QLAEVTS----QQAELRAQI-KI--PSNEAVDR-----------T----SLSLIP-GVQE
A0A2H2Y561      QLAEVTS----QQAELRAQI-KI--PSNEAVDR-----------T----SLSLIP-GVQE
A0A1Q4S362      QLAEVTS----QQAELRSQI-KI--PSSEAVDR-----------T----SLSLIP-GVQE
A0A3S1CIN8      QLAEVTS----QQAELRSQI-KI--PSSEAVDR-----------T----SLSLIP-GVQE
A0A2A2TC28      ALADIIA----QETELKKQL-NL--VGEEAVNI-----------T----SLSQIP-GVQE
A0A0C1NCB0      ELAEVSA----EQAKVLNQL-KL--AGQDAVEI-----------T----SLNQIP-GVQD
A0A2N6K7Q9      ALADVSA----QEQQIASQL-NV--SENQAVTV-----------T----SLSQIP-GVQE
A0A2N6MXH6      ALADVSA----QEQQIASQL-NV--SENQAVTV-----------T----SLSQIP-GVQE
A0A2N6M5A8      ALADVSA----QEQQIASQL-NV--SENQAVTV-----------T----SLSQIP-GVQE
A0A2N6LL61      ALADVSA----QEQQIASQL-NV--SENQAVTV-----------T----SLSQIP-GVQE
A0A0S3TP66      ALADVSA----QEQQIASQL-NV--SENQAVTV-----------T----SLSQIP-GVQE
G6FP91          ALADVSA----QEQQIASQL-NV--SENQAVTV-----------T----SLSQIP-GVQE
A0A1U7GYR5      ALADVSA----QEQQIASQL-NV--SENQAVTV-----------T----SLSQIP-GVQE
A0A2N6KY52      ALADVSA----QEQQIASQL-NV--SENQAVTV-----------T----SLSQIP-GVQE
A0A2N6KMP5      ALADVST----QEQQIASQL-NV--SENQAVTV-----------T----SLSQIP-GVQE
A0A2N6MA45      ALADVSA----QEQQIASQL-NV--SENQAVTV-----------T----SLSQIP-GVQE
A0A1Z4TLC8      ALADVSA----QEAQIASQL-NV--SENQAVTV-----------A----SLSQIP-GVQE
A0A0M0SFT2      ALSDVSA----QEAQIASQL-NV--SENQAVTV-----------A----SLSQIP-GVQE
A0A0D6Y7R4      ALADVTA----QEAQIASQL-NV--SENQAVTV-----------A----SLSQIP-GVQE
A0A328IGA1      ALADVTA----QEAQIASQL-NV--SENQAVTV-----------A----SLSQIP-GVQE
A0A0C2LFH0      ALADTSA----QEEKIRSQL-NL--AGSQAVEI-----------T----SISQIP-GVQE
A0A1Z4IYV4      ALADVSA----QEAKMNSQL-NL--AGDQAVEV-----------T----SISQIP-GVQE
A0A1Z4Q0T6      ALADVSA----QEAKMNSQL-NL--AGDQAVEV-----------T----SISQIP-GVQE
A0A0C2PT44      ALADVSA----QEAKINTQL-NL--AGDQAVEV-----------A----SISQIP-GVQE
A0A1D2P6J4      ALADVSA----QEAKINTQL-NL--AGDQAVEV-----------T----SISQIP-GVQE
A0A3M9ZEU1      ELAKMVA----RSSALRNQL-GM--DSRQAALL-----------A----SLSQTP-GVQE
A0A1Z4JK72      QLADVAR----QEQVVRDQL-GL--ETGQAIDL-----------A----SLSQSP-GVQE
A0A0N7Z489      QLADVGR----QERAVADQL-GL--ELGQAIDL-----------A----SLSQSA-GVQD
A0A0S3TXS2      QLADVGR----QERAVADQL-GL--ELGQAIDL-----------A----SLSQSA-GVQD
A0A1Z4RN12      ELSDINA----RYSRLQSQL-GM--NWREASAV-----------S----ALSQSP-GVQR
A0A2T1CMF9      DLNDVNA----RYNRLQSQL-GV--SWQEASAI-----------S----SLSQSI-SLQE
Q7NDC5          ALSEAGA----RVRAIDARMGGL--SEPEALVA-----------G----ALSGSD-GMRD
U5QGK3          KLAEAQT----RAGAIASRMGGL--SEKEALVA-----------G----ALSSSD-GMSE
A0A2W4UY24      DLADKNA----QFAQIQQQL-RL--NPQEAYAV-----------G----LVSESP-GVQE
A0A254WLE3      ELADANT----KLAKLRQQV-GM--DADNSLNL-----------N----ALNQSR-GVQR
A0A433W533      ELANANT----KLAKLRQQV-GM--DTDTSLNL-----------N----ALNQAR-GVQR
A0A2P8QWJ3      ELANANT----KLAKLRQQV-GM--DTDTSLNL-----------N----ALNQAR-GVQR
A0A2T1FKP8      ELANANT----KLAKLRQQV-GM--DTDTSLNL-----------N----ALNQAR-GVQR
K9U6L7          ELANANT----KLAKLRQQV-GM--DTDTSLNL-----------N----ALNQAR-GVQR
A0A2T1GMT4      ELEQANA----QSQELYKKV-NL--NSQDALAV-----------S----AISQSP-AIQG
K9UI51          ELEQANA----QSQELYKKV-NL--NSQDALAV-----------S----AISQSP-AIQG
K9TYI2          ELDQANT----QTNELRQKV-GL--NPQQASTV-----------S----ALSQSP-AVQG
A0A254W5G5      ELDQANT----QTKELRQKV-GL--NPQQASTV-----------S----ALSQSP-AVQG
A0A2T1FXY4      ELDQANT----QTKELRQKV-GL--NPQQASAV-----------S----ALSQSP-AVQG
A0A1Z4QL41      QLADFNA----QTDALRQKI-GL--NSQQAIVV-----------S----SLSNSP-AIQA
A0A252D4T4      DLDQATA----QTNELRQKV-AL--SSQEALSA-----------S----TLSQSP-AVQG
A0A252DJH5      DLDQATA----QTNELRQKV-AL--SSQEALSA-----------S----TLSQSP-AVQG
A0A252EB80      DLDQATA----QTRELRQKV-AL--SSQEALSA-----------S----TLSQSP-GVQA
A0A1Z4HPW5      DLDQATA----QTNELRQKV-NL--NSQEALSA-----------S----AVSQSP-AVQG
A0A1Z4MSN1      DFDQATA----QTNELRQKV-NL--NSQEALSA-----------S----AVSQSP-AVQG
A0A1Z4U1C2      DFDQATA----QTNELRQKV-NL--NSQEALSA-----------S----AVSQSP-AVQG
A0A0D6KV51      DFDQATA----QTNELRQKV-NL--NSQEALSA-----------S----AVSQSP-AVQG
A0A1Z4MKF8      DFDQATA----QTNELRQKV-NL--NSQEALSA-----------S----AVSQSP-AVQG
A0A2C6WC43      QLDEVNA----QTNELRQKV-NL--SSQNAIAV-----------S----ALSQSP-AVQG
A0A1Z4L5A1      QLDEVNA----QTNELRQKV-NL--SSQNAIAV-----------S----ALSQSP-AVQG
A0A367QD86      QLDEVNA----QTNELRQKV-NL--SSQNAIAV-----------S----ALSQSP-GVQG
A0A235IZ96      QLDEINA----QTNELRQKV-EL--NSQQAIAV-----------S----ALSQSP-AVQG
A0A2L2NGP0      QLDEINA----QTNELRQKV-EL--NSQQAIAV-----------S----ALSQSP-AVQG
A0A2K8SM78      QLDEVNA----QTNELRQKV-EL--NSQEAIAV-----------S----ALSQSP-AVQG
A0A2R5FPC0      QLDEVNA----QTNELRQKV-EL--NSQEAIAV-----------S----ALSQSP-AVQG
K9QM62          SLNEITA----QSNELRKKV-GL--DSPQAIAM-----------S----TLSQSP-AVQG
A0A1Z4FWI3      ELDQATA----QSNELRQKV-AL--NSQQALSA-----------S----AVSQSP-AVQG
A0A1Z4JYE7      QLADLVA----QRNQLSQQL-GL--TTQQAIAV-----------T----TLSQSP-AVQG
A0A140KBA0      ELGDVNA----RYTSLSSQL-GM--NVSEAAAI-----------S----SLNQSV-AVQK
K9XSG1          QLQDVNA----RYASLSSQL-GM--GVSEAAAI-----------S----SLNQSV-AVQK
A0A0F5YE28      ELSGVNA----LAESLQTQA-GF--DLEEAIAI-----------N----TLSQSP-VLIG
U7QEH7          ELSGVNA----LAESLQTQA-GF--DLEEAIAI-----------N----TLSQSP-VLIG
A0A3S1ATK5      QLEDLNG----QTETLRQKI-AL--NSQQAIAV-----------S----SLNNSP-AIRE
A0A2Z6CPH0      QLAEVNA----QSSELRQKL-GL--NSQNALAV-----------S----ALSQSP-AVQG
A0A1Z4GT50      QLDEVNA----QSNELRQKV-NL--NSPEAITV-----------M----AISQSP-AIQG
A0A1Z4GIX0      QLAEVTA----QSNELRQKI-NL--NSQQAIAV-----------S----TLSQSP-AVQG
A0A2H6LC24      QLAEVTA----QSNELRQKI-NL--NSQQAIAV-----------S----TLSQSP-AVQG
B2J6N5          QLDEVNA----QTNELRQKV-EL--NSQEAIAV-----------S----ALSQSP-AVQG
A0A367RMI4      QLDEVNA----QTNELRQKV-EL--NSQEAIAV-----------S----ALSQSP-AVQG
A0A235HUM0      QLNEVNA----QTSELRKKV-EL--NSQEAIAV-----------S----ALSQSP-AVQG
A0A2L2NW47      QLDEVNA----QTNELRQKV-EL--NSQEAIAV-----------S----ALSQSP-AVQG
A0A1E2WUR1      QLNEVNA----QTNQLRQKV-EL--NSQEAIAV-----------S----ALSQSP-AVQG
A0A235IKU3      QLDEINA----QTNELRQKV-EL--NSQQAIAV-----------S----ALSQSP-AVQG
F4XKF3          QLEEANA----QAAGLRNQV-GL--NPQQAIAI-----------S----ALSQST-SVQG
A0A1D9FX10      QLEEANA----QAAGLRNQV-GL--NPQQAIAI-----------S----ALSQST-SVQG
A0A1D8TNX9      QLEEANA----QAAGLRNQV-GL--NPQQAIAI-----------S----ALSQST-SVQG
A0A1U7MYU6      QLEEANA----QAAGLRNQV-GL--NPQQAIAI-----------S----ALSQST-SVQG
A0A3C0NJ41      ELQQANA----QTAALQNKV-GM--NSQEAINT-----------T----ALSQSA-GVQE
A0A352AG88      QFKDANA----RSAELRDQV-GM--NSQEAIVA-----------S----SLSQSP-GVQQ
A0A350Y374      DLKNINS----QSAALRDKV-GM--DAQEAIAI-----------T----SLNQSP-GVQD
A0A355DPX0      DLKNINS----QSAALRDKV-GM--DAQQAIAI-----------T----SLNQSP-GVQD
A0A0D8ZUV2      ALANANA----RYATLQQQV-GM--SSAQAVAT-----------N----SLNQAG-GIQK
A0A433VDI0      ALAGANA----RHTSLYKKV-GM--SSEQAIAT-----------N----SLNQSS-GVQK
A0A3D1PG43      ALVQAKT----RSANLQKEI-GI--NSSDIIAV-----------N----SLNQPAGGAQK
A0A2P8QQ72      ALVQTQG----RATKLQKEI-AL--TSQDVVPI-----------N----SLKESP-GIQK
K9TZQ7          ALVQTQG----RATKLQKEI-AL--TSQDVVPI-----------N----SLKESP-GIQK
A0A2G7GPR0      QLADTTT----RSATLQQQV-GM--NPQEGITL-----------T----SLNQSP-GIQK
K9XH68          QLADTTT----RSATLQQQV-GM--NPQEGITL-----------T----ALNQSP-GIQK
A0A1U7HW70      QLADTTT----RSATLQQQV-GM--NPQEGITL-----------T----ALNQSP-GIQK
A0A2S6VEJ8      QLADTTT----RSATLQQQV-GM--NPQEGITL-----------T----ALNQSP-GIQK
                                                                            

K9SLA9          LLE--ELQAIEQQIALES----TRYGAEHPSIIDLRAQREALQVVLQGRVGEDLL-----
A0A168TT23      LRS--RKAELETEISGLL----QRFMEDYPVIVELRSQINEIDTQIRERADTII------
A0A0M1JWX9      QLS--KLRELENQIAKEL----TRFTINSPQIQTMLEQRQQLEGMLSQEAQRAL------
A0A2T1M1V6      IRD--KLSATEIELSESR----GIYTDKMPQVKSLLLKRDELRREANRQMAQVLPGVSSS
A0A2G7GCS2      IRQ--KLSDAETALAEAR----SRYTDESPQVQSLLSQRDELMQIMNQQIAIAAPGASAN
K9XBH8          TRQ--QLSEVETALAEAR----SRYTDESPQVQSLLARRQQLMQTMNQQLAVALPNAASN
A0A1Z4LJ30      FRD--KLSEVEVALVEAR----GKLTNSHPQIQELVYQQRVLRSQLRQYLANTSSVAG--
K9RI76          IRD--KLSQIEVALIEAQ----GKLTSNHPEVQNLLYQRSVLRQQLNQFIAASRANAGG-
A0A352AE27      IRQ--KLTEVEAKLVEAK----ATYTMENPRVEGLVIQRDELQRQLQQYITQAAGDA-S-
A0A3B8JH60      VRNXXKLAEVNANLIRTR----ATFTDNHPTVQKLISERDDLQRQLQGYIAQSAAGT-R-
A0A3C0N766      VRN--KLAEVNANLIRTR----ATFTDNHPTVQKLISERDDLQRQLQGYIAQSAAGT-R-
K9W9J7          VRN--KLAEVDANLVKLR----ATFTDNHPAVRKLISERDELQRQLQGYVAQAAAGT-Q-
A0A139WSU3      VRQ--QLSEVEASLRQKQ----AIFTDVHPEVKTLLAQRESLQRKIQEHIRQTSAGT-K-
A0A433VN22      VRK--ELSEVEAKLVQKQ----AIFTINHPEVQTLLAQRSTLRRQIGAYITQVAGNI-P-
Q7NF11          MRL--KLSSLDTALAEAR----GLYTEKHARVQSLLVQREELQRSLRELLAKVVPASRTE
A0A1Z4JCS8      LRS--KLTEVESTLGKLR----STFTDRSPQVQRAIVERDTLRNQLQQYVG---QAAGR-
F4XTX2          VRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLLQREQLQQQIQQYI-FLAAGDTL-
Q7NJN6          LRQ--RLADIESQLAQAR----GLYTGKNLRVKSLELQREELLGKIKQQVGSIVPDASK-
U5QCC3          LRQ--KLTDIETQLAQAR----GIYTEKNQRIQSLLLQREELLSKIKLQLSKLVPDSEK-
A0A0S3TYD7      TLK--RSQELQNQLAVTL----GRYRAGHPKVTELQRQVSELQELLQQRVATVV------
U5QL42          LVS--KYKDAEADYVSQR----AKFKDAYKPVGDLKKQRDIYLRLLQEQATSVL------
K9QF04          LLE--KLQRVDAKIASES----VKLSDEHPSLIALREERQHLLSLIQQQVINLL------
A0A3C0N2P0      LLN--QLSEVESKLAKES----ARLTEDHPTILKLREEQRRLKPLVDQEAATVM------
K9TLQ0          LLN--RFHEIETKLAQES----TRFTVQSPAMQVLIDERNSLLPLLQEEALLVL------
A0A076HBF2      LLQ--QLLKVETELAEAR----SRYNPGSSMVLGLEERLNQLRPLLRQN-----------
A0A354B169      LLQ--LLLKVESELAAAR----SKYKPSSSMVQGIEARQRQLQPMLLRS-----------
G4FMX5          LLQ--QLLKVETELAEAR----STYKPNSSMVTGLEERINQLKPLLLRN-----------
Q0IDT5          LLQ--QLLKVETELAEAR----SKFVNNSSMVLSLEARLEQLQPLLREN-----------
A0A2D6FCW3      LLQ--QLLKVETELAEAR----AKYNPDSSMVRGLEARLNQLQPLLRKN-----------
A3ZA21          LLQ--QLLKVETELAEAR----AKYNPNSSMVLSLEARLNQLQPLLRQN-----------
A0A140K3H3      LAS--QLKELETQYALGS----VNFYDSYHVMEDIKLKQAELRTLMQERSQQIL------
K9XUB8          LTS--RLKELESQYGLGS----VNFHDSYHVMEEFKLKQVELRKLMKERAQQIL------
Q7NEU3          NLT--QLQKVETQLALEQ----ARFRDDYPAVQSLKSKRDRLRQVLASQAQQIL------
A0A352XE00      LLN--KLSEVETKIAVES----ARFTEESPTIQALRDEQKNLLPLLEKEAGTAL------
B4VS56          LLN--QLTEIESKIASES----ARFTEQSPTIQALREKQQNLLPLLSQEAGTVL------
A0A352AAQ3      LLN--QLSEVESKIAAES----ARFTEDSPTIQALREKQQRLLPLIEAEAANVV------
A0A350Y472      LLN--QLSEVESQIATEL----ARFKEENPAIETLREKKERLLPLIEEEAANVV------
A0A355DVB4      LLN--QLSEVESQIATEL----ARFKEENPAIETLREKKERLLPLIEEEAANVV------
A0A2P8VVX1      LLN--SLQEAELALADRQ----ILFTDEDPNVQVLKQQRENQLAQLRAEISAIS------
A0A2P8WHY0      LLN--DIQESELALADRQ----LIFTDQDATVQMLRQELDNNRKQLRQEIAAAI------
A0A2T1CMT9      LLN--NLKQMEQDLATQQ----TKFTNYNPALKSAIEEKKILQDLLSEEAERIL------
A0A1D8TX52      LLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL------
A0A1U7N5X9      LLN--EIQRIELALVEQS----RIYTEAHPTIQKLIEQRQSVFALLQEETRRVL------
A0A1D9G4T2      LLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL------
F4XP71          LLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVL------
A0A2P8QVH5      LLD--EIQALDVTLEKLR----VQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA------
A0A2T1FT70      LLD--EIQALDVTLEKLR----VQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA------
A0A433W4W4      LLD--EIQALDVTLEKLR----VQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA------
K9U5W1          LLD--EIQALDVTLEKLR----VQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA------
A0A254WLA7      LLD--EIQALDVTLEKLR----VQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA------
A0A2W6ZAV2      LLG--DLTDLEKQLAEAE----ASFSPTSPQVRSLRSRVNQLRPLLQRR-----------
A0A2G7GMH8      LLN--EIQKTELALAQQR----LRYTDSSPQVELLLSQRDTQRELLQQEMQTVV------
K9W742          LLD--EIQKTDLALAEQR----KRFTDDNPTIQKLLFQRQQQLALLEKEGERAV------
K9SA61          LLN--EIQKTEIELAQQR----LRFKDASPYVQQVIDKRQRQLALLQQEAQRVL------
A0A350Y7Z1      LLN--ELQKTELAIAQQR----VKFTDAEPRVEQLLEQRQRQLALLQEEAQRVL------
A0A352X2A7      LLD--ELQKTELALAERR----TRFTDADPSVQKLMEQQSRQYRMLQEEGERVL------
K9XPB0          LLN--KLQQIEIELADKQ----ARFTDDNPVVKDLLAQKNTQTTLLLQEVKKIL------
A0A0D8ZYV0      LLN--ELQRTDLLLAARR----GTFTDADPGVQKLIELRQSQQALLQAEQARVV------
A0A3D1PBA3      LLN--ELQKTELALSQRR----VTFTDEDPQVKKLLEQRQNTIEMLKSEGGRVV------
A0A254WJ87      LLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVL------
A0A2T1FP73      LLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVL------
A0A433VMS2      LLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVL------
K9TYA7          LLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVL------
A0A2P8QUE1      LLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVL------
A0A2T1DWE8      LLN--EIQKSELAIAQQR----LRFKAASPYVQQAIDQRQRQRDLLAAEVQRIL------
A0A1U7I8L3      LLS--EIQKIELELAKER----QRFTDSNPVIQNLLEQRQSQLALLQKEQQLVQ------
A0A2T1DJL8      LLN--EIQKTEVAIVQQR----LRFK-KGPFIDQLSEQRQKQQALLQQEVQRIL------
A0A1Z4J9W0      LLA--EIQKTEVELAQMQ----TKFTSNTPQVQQLAEQRQRQVSLLQQEAQRIL------
A0A0N7Z5K9      LLA--EIQKTEVALAQQQ----TRFTSKTPFVQQLLDQRQRQVALLQQEAQRVL------
A0A0S3TXC5      LLA--EIQKTEVALAQQQ----TRFTAKTPFVQQLLDQRERQVALLQQEAQRVL------
A0A2T1DNG3      VLN--EIQKTELAIQQQR----VRFKENTLNMQPLLDQRQRQLKQLQLEASRLL------
A0A2P8W9H0      LLN--QLLEVDSQLAADL----TLYLENSPEIEVVESRRENLQPLIE-------------
A0A3S0Y9N9      VLG--QLKETQQKIEMAR----LRLTDNHPTVINLKEQETVLKQELKRHIEQSFI-----
A0A433UNK7      VLG--QLQDVQQKIQVIG----LRLTDTHPTIMDLKKEEVILRQELKKRIEQSFI-----
B8HNB0          LTT--RLQEVELSLAQQS----LTLQNNHPTIENLRAERADLLKLMRQRANGLL------
A0A1Z4LN32      VLS--ELQKVQTELTTLK----TRMTNAHPSILDLQDKEAALNNLLQTRIMESV------
A0A2I8A9F5      AFI--ELQKIQTQLKIQQ----TRYTDANPIVINLKNQEKALNSLLKQRITEYL------
A0A218Q6R8      VLG--ELQKVQTNLAIQQ----TRYTDQNPHIANLKNQEAALASLLQQRITESL------
A0A0C1XVC4      LLA--ELQKVETQLAALK----ARYTETHPAVVDLESQEANINSLLQQQISQSL------
A0A218QGE0      LLA--ELQKVETQLAALK----ARYTERHPAIVDLESQKANINSLLQQQISQSL------
A0A3B8Y8H9      LLE--KLREVDTKLAEES----TRFTEDNPTIKKLRQQRRNLVPLIEEEAQAIL------
A0A1Z3HMQ0      ILE--DLQAVQTELASQR----SRYTASHPLIANLEREQASLQTLLNRRVGEVL------
A0A1E5QP61      VLT--EYQKVQDQLAVQR----TRYQSQHPIITNLERREAALSDLLQERVAQVL------
A0A3M2GIL5      LFR--ELQQVENDLAVQR----TRYQSKHPIIANLTRKRVSLQALLQERIRDIL------
A0A433NM31      ALA--DYQEVESKLANER----SRYQENTPVIADLKLKQASLREVLEKRVQQVF------
A0A3M1PML8      ALT--QLQLAQQELAVER----TRYTEDHPAIANLQRRVRSLEDMLQSRAVSVA------
A0A352X442      ALA--ELQKVQSQLAVER----GRFLEEAPIVQKLKEQETKLQTLVNQRIGENL------
A0A0T7BPZ0      MLT--QLREAETKLAVEQ----NRYLPGHPTLVNLQEQIASLKKLLQQRIKQVA------
A0A0M0SHU3      VLK--ELQEAQTKLTVAR----TRYLPGHPTVSNLEEQVSALKNLLQQRVEQVG------
A0A1D2PBN3      VLT--QLQEAQSQLAVER----TRLQPEHPIVINLEEKVAALNSLLQQRLKQVV------
A0A0C2LVR7      VLT--QLQEAQSQLAVER----TRLQPEHPIIINLEEKVAALNSLLQQRLKQAV------
A0A1Z4PQB9      VLT--QLQEAQSQLAVER----TRLQPEHPIIINLEEKVAALNSLLQQRLKQAV------
A0A1Z4SFN6      VLT--QLQEAQNQLTIEQ----TRLQPGHPTIINLEEKIAALNSLLEERIKQVV------
K9PGI8          VLT--QRQEAQSQLAIEL----IRLRPNHPTIINLKEKIAVLNLLLKGRIEEGV------
A0A2W1JVB9      VLQ--QLQEVEGQLAVEG----TRLTPENPILQDLQEQASTLRATLQNRVGEAL------
A0A3M1SVZ4      ARQ--QLQEAEAQLAVEK----TRLTENHPTIIDLQDKVATLRSMLQSRVGDVS------
K9SSQ0          LVK--QFQEAQTNYFLER----ARFQDAYPKVQALRDRRDQIYNLMQAQAQAIL------
A0A2W1JIN9      LKS--AVTNLESQVAARR----TELTDSHPIVIQLVQELDAARTLYNQRLSQL-------
A0A318AJV1      LRS--QRADIVRNLGEVE----GRYGPKHPESIRAHQQLADIDQQIRDEAQRVVG-----
A0A254WHG9      LRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGNET------
A0A2P8QIL5      LRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET------
A0A2T1FLY5      LRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET------
A0A433W447      LRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET------
K9U1K8          LRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET------
A0A1U7N2U4      LRA--QLVNLERELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLLPTNQPT
A0A1D9G1F2      LRA--QLVELDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLLPTNQS-
F4XV38          LRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLLPTNQS-
K9UYB2          LRA--KLAESETKLIEAR----LKFTESNPIVIQLSEERDALRNLYSQGLNRVSP-----
A0A0C1XJI7      LRA--KLTELNTKLIEAR----LRLTENHPSVISLVEQRDNLNKLYTEQLGRVSS-----
A0A218QN17      LRA--KLTELNTKLIEAR----LRLTENHPSVIALVEQRDKVNKLYTEQLAIVSP-----
K9RKN2          MRA--NLAELEREFVEAR----LRFTFNHPKLIELSQKRNAFRQMYEQQLANVSN-----
A0A2I8ADV2      LRA--KLTEIETQLIEAR----LQFTDNHPKVVSLLGQREQIRALYAQQVGRVSA-----
A0A1W5CKM3      LRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQQRDEIRALYGQQMARVSS-----
Q3MEW0          LRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQQRDEIRALYGQQMARVSS-----
A0A1Z4KIC7      LRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVEQRNEIRALYGQQMARVSS-----
Q8YSM5          LRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVEQRNEIRALYGQQMARVSS-----
A0A1Q4S1H4      LRA--RLTELETQIVALQ----QRFTPEHPELNSLIQQRDTLRAMYQQELARISN-----
A0A433VBU6      LRV--KLTELQTQIVALQ----QRFTPEHPELNSLIQQRDTLRAVYQQELARVSS-----
A0A1Q4RZJ6      LRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQQRDALRSLYAQELSRVAP---K-
A0A1Z4SNV3      LRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQQRDALRSLYAQQLARVAPVDTS-
A0A2H2XJQ1      LRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQQRDALRSLYAQQLARVAPVDTS-
A0A3S5K358      LRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQQRDALRNLYAQELSRVAP-----
A0A0T7BPJ4      LRS--KLTELEQQVIQAK----LKFTEEHPTVTKLVQERDAVKAMYEQEVARVSP-----
A0A0C1QS61      LRT--KLTELETKLAESR----AKYTEDHPDVRSLLYQRNTIRNLYIQGLNRVSS-----
A0A139X3R8      LRT--KLTEFETKLAESR----AKYTENHPDVQSLLYQRNSVRNLYIQGLNRISS-----
A0A1Z4I7C5      LRT--KLTDIETKLIEAR----TKFKEAHPTVVDLVQQRDEIKALYGQQMARVSS-----
A0A0C2MDK7      LRA--KLSELENKIIEAR----LRFTENHPVVANLVGERDALRKVLSEQLARVST-----
A0A1Y0RCK1      LRA--KLSELENKIIEAR----LRFTEEHPNVRNLVGERDALRAIYSEQLARVSS-----
A0A1Z4PWZ0      LRA--KLSELENKIIEAR----LRFTEEHPTVTNLVGERDALRAIYSEQVARVSP-----
A0A0C2QLT0      LRA--NLSELENKIVEAR----LRFTDEHPNVTNLVGQRDALRAMYSEQLARVSS-----
A0A1Z4J2K1      LRA--KLSDVENQLIEAR----LRFTDEHPNVTNLVGERDALRAMYSEQVARVSP-----
A0A3S0ZSX0      LRA--KLAELEAKVIETR----LYFTENHPTVIKLVEQRDGLRAFYQKELARVSP-----
A0A2N6K4T3      LRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVSP-----
A0A370CKT2      LRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVSP-----
A0A0S3TL97      LRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVSP-----
A0A2N6M8A0      LRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVSP-----
A0A2N6M9E1      LRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVSP-----
A0A2N6KJI4      LRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVSP-----
A0A2N6MZ77      LRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVSP-----
A0A2N6KT20      LRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVSP-----
G6FSN3          LRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVSP-----
A0A0D6YL98      LRT--KLAEIETNLVEAR----LSLTDSHPTVMNLLGQRNGLRALYFQGLARVSP-----
A0A328I8B9      LRT--KLAEIETKLVQAR----LSLTDSHPTVMNLLGQRNGLRALYFQGLARVSP-----
A0A0M0SU69      LRT--KLAEIETKLVQAR----LSLTDSHPTVINMLGQRNGLRALYFQGLARVSP-----
A0A1Z4TIZ8      LRN--KLAEIETKLIQAR----LYLTESHPTVINLLGQRNGLRGLYLQGLARVSP-----
A0A318BG22      LTG--QLATLEADYQQKR----QTYKPGYAPMEALAAQIASVRGQIATLRGRIVG-----
A0A2T1E9V8      VIK--ELQEVQRKLANAR----SLYKDDHPIIVQFKEKEAQLNILLNSETTRILQ-----
A0A0P1C0L3      LRA--DLAKAEAQLATLN----ANYGPMYPPLVEKAAEVASLRASLGGEARAAL------
A0A3M2GQQ6      LAS--ELKAVEAQYTLEA----SRFYETHPVVKNLAIQRDNLFRQLQQRSRRVL------
K9SGJ5          LVK--QFQEAETHYYLER----TRFQDDHPEVQVAKDRRDQLYKLMQVQAETVL------
L8MYT6          LVK--QFQDVETNYFLER----TRFREDYPSVLALKDRRDELYRLLEARAQSVV------
A0A352JGJ6      LVK--QFREVETNYFLER----TRFREDHPTVQALKDRRNELYKLLETRAQALV------
A0A1J5GLS2      LVK--QFQEVETNYFLER----TRFREDHPNVLALKDRRDELYRLLETRAQSVV------
A0A2W4W6M5      LVK--QFQDVETSYFLER----TRFREDHPNVQALKDRRDELYKLLETRAQSVV------
A0A2W7AN33      LVK--QFQEVETNYFLEQ----TRFRGDHPSVIALKDRRDELYRLLETRAQSVV------
A0A256BLV2      LVK--QFQEVETNYFLER----TRFREDHPTVIALKDRRDELYRLLETRAQSVV------
A0A2W6ZXF3      LVR--QFQEVETNYFLER----TRFREDHPNVLALKDRRDELYRLLETRAQSVV------
A0A2Z5WX66      LVK--QFQETETNYFLER----TRFREDHPTVKALKDRRDELYKLLETRAQSVV------
K9W1T3          LLS--NLQDIQEKLATER----TRFQEGHPVIEDLKSKEANLKALLQQQLQQTFL-----
A0A0D6YBN8      -IN--SLRQRRAELAAEHQRLLVQFEPNYPPARALQSQIDQLDRSIAREESRIS------
A0A318BJ18      -IN--NLRQRRAELSAEYQRLMVQFEPGYPAALAIQNQIDQLDRSIAREESRVS------
A0A1Q4RTR1      LLD--EFRSTQNKLAVER----IRFSDEHPTIIDLADKVQVLRQQLQQRIIQTL------
A0A1Z4SQV2      LLN--EFRSSQDKLAVER----TRYSDEHPIIIDLANKIQVLRQQLQLRIVQIL------
A0A2H2XGN1      LLN--EFRSSQDKLAVER----TRYSDEHPIIIDLANKIQVLRQQLQLRIVQIL------
A0A433UXH8      LLN--EFRSSQDKLAMER----TRYSDEHPIVIDLANKVQVLRQQLELRVVQTL------
A0A1Z4RMB9      ILD--QLAQTESDLSKER----QRFNDAHPSVVSLNAKKNDLTQQLEGLVANAV------
D5A466          ALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLESLLQREIQVYL------
K1XF69          ALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL------
B5W297          ALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL------
H1W7M8          ALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL------
B4WP72          VLT--ELQAVQSQLAIEQ----ARYQSTHPAVLNLQRQVNSLESLLRQRIRTVT------
A0A318B4H2      TIA--SLRQKRAELSARYSALLTKFEPGYPEAEALRTEIMGLDKAIAQ------------
B4WQE3          LLD--QLLVVDSELADNL----TVYVEDSPEVEVIEERRANLEPLLE-------------
A0A2K3BR24      VLT--EYQAVEQELTLKR----SRYQPEHPIIKRLEEQEATLANLLQERVNAVL------
K9YXY1          VLT--EYQAVEQELTLNR----SRYQPEHPIIKRLEEQEATLANLLQERVNAVL------
A0A2P8W4F7      LLG--DLRELEQTIAAES----ARFQTDTPMIEALEDQRQQLLPLLEAEAQRLV------
U5QJM6          VLK--QYQDTETQLALEK----TRFRDDYPTVQNLKDKRDSLQKRLNEQAGVLLG-----
A0A1U7HGH0      VLA--ELQTVQRQIADAR----SRYRDDHPILDSLQEREARFQQLLQTQTNQVLQ-----
K9XJD3          ILT--ELQTVQRQITDAR----SRYRDDHPILDSLQEREARFKQLLQTQINQVLQ-----
K9SX01          TLS--DLQKIDSQLVTLR----ATYTDNYPTITVLMEQRAPIQKLLQQRIKETL------
A0A1E5QIR9      AIA--ELQAIENRLELER----SRFLDEAPIIIDLETKQARLRGVLERRIIEVL------
A0A1Z4IBC7      VLA--ELQETQSKLAIER----TRFEPEHPAITALEEKVAVLEKLLKERTGEVA------
A0A1W5CPC7      VLA--ELQETESKLAVER----TRFESEHPAITSLEEKIVVLKNLLKDRTGQVA------
Q3MDC6          VLA--ELQETESKLAVER----TRFESEHPAITSLEEKIVVLKNLLKDRTGQVA------
A0A1Z4KM73      VLA--ELQEAESKLAVER----TRFEAEHPAITSLEEKIVVLKNLLKDRTGQVA------
Q8YNX7          VLA--ELQEAESKLAVER----TRFEAEHPAITSLEEKIVVLKNLLKDRTGQVA------
A0A367R4K6      VLA--QLQEAESQLALER----TRFQSGHPTIINLEGKVTALRSLLKERIEQVA------
A0A1E2WSV8      VLI--QLQETESQLALER----TRFEPEHPTITNLEEKVTALKSLLKERVGQVA------
A0A2R5FRT9      VLA--QLQETESQLALER----TRFSPEHPTITNLQEKVAALQSLLKERIGQFA------
A0A2K8T1B6      VFA--QLQDTESQLALER----TRFSPEHPTITNLQEKVVALQSLLKERIGQFA------
A0A235I9I0      VLA--ELQETESKLAIER----TRFSPEHPTITNLEEKVVALKNLLKERTGQVA------
A0A2D0HQT8      VLA--QLQETESQLALER----TRFSPEHPTITNLEEKVLALKNLLKERTGQVA------
A0A2L2NU95      VLA--QLQETESQLALER----TRFSPEHPTITSLEEKVAALNNLLKERTGQVA------
A0A367S084      VLA--QLQETESQLALER----TRFSPEHPTITNLEEKVLALKNLLKERTGQVA------
A0A0V7ZFJ4      ALT--QYQKVQDELAVAQ----TQFTSEHPMVISLLGKEQALRNQLGKRVGQLI------
A0A0V7ZNJ9      ALQ--EYQKVQDRLAVAR----TRLTNQHPTVIDLSNKERALRNQLEKRVGQVV------
A0A367RIS1      VLS--EYQKVQDLLAVER----SRFTDGHPVITSLLSKEQALKEQLERRVTQTL------
A0A235IXQ2      VLS--EYQKVQDQLTVER----SRFTDEHPVITNLLSKEQALKEQLKGRVSQTL------
A0A1W5CNX3      VLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKEQLEGRVSKTL------
Q3MEB7          VLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKEQLEGRVSKTL------
A0A1Z4KHN9      VLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKAQLEGRVSKTL------
Q8YT70          VLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKAQLEGRVSKTL------
A0A218Q4C1      VLL--EYQKVQDQLAVER----SRLTDEHPVVVNLLNEEEALRIQLEGRVTQTL------
A0A166IWU6      VLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL------
A0A2S0Q8C0      VLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL------
W6FSX4          VLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL------
A0A1B7WTD1      VLT--EYQKTQHELAIAR----TLYTNDNPKVVDLLLKEAAQKKELEARVTETV------
A0A1B7WX82      VLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIMKEASLKTVLKERVAQTV------
A0A0R0M9H9      VLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL------
A0A1S1ZVW2      VLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQSI------
A0A1Z4LRU5      VLT--EFQKTQKELAVAR----TKLTDQHPTVINLSKKLEALKNQLEGKVGQIV------
A0A1Z4JVB4      VLK--EYQKAEDDLAVAK----TRYTNDNPTIINLEQKAQALRSQLEGRVSQTI------
K9PIA4          VLT--EYQKVQDELAVAR----TRYTNNNPNILNLVEKEAALRNQVEGRVAQSL------
A0A1Z4M597      VLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQAVALKNQLEGRVAQTI------
A0A1Z4MWT1      VLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQEVALRNQLEGRVAQTI------
A0A1Z4TX53      VLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQEVALRNQLEGRVAQTI------
A0A1Z4HVE1      VLT--DYQKTQDELAVAR----TRFSDEHPLVINLDKKATALRSQLEGRVSKIV------
A0A252ECZ1      VLT--DYQKTEDELAVAR----TRFSDEHPTVINLDKKAAALRSQLEGRVSQTI------
A0A1Z4G5Y1      VLT--EYQKAEDELAVAR----TRFSEEHPIVINLAQKAAALRSQLEGRVSQTI------
A0A252DNA2      VLE--EYQKAEDELAVAR----TRFSEEHPIVINLDKKAAALRSQLEGRVSQTI------
A0A252E1Q4      VLE--EYQKAEDELAVAR----TRFSEEHPIVINLDKKAAALRSQLEGRVSQTI------
A0A2A2TNQ5      VLA--EYQKVQDDLAVAR----SRFTEEHPSVRNLVAKEQAFRQQMEKRVGRVI------
A0A3S1C4K5      VLA--EYQKAQDELAVLQ----TRFTAEHPKVRDSEAKVQALREQLEKRVGKIV------
A0A1X4G3D5      VLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTAKGQVLKKQLQERIYQSV------
D4TNI2          VLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTAKGQVLKKQLQERIYQSV------
A0A1Z4H6Z8      VLK--EYQKAEDEVAVAR----TRLTDDNPTLINLEQKQAALRNQLEGRVAQTI------
A0A1Z4NPM1      VLA--EYQKTQDELAVAK----TRLTNDHPTVINLTEKVNALRSQLEQRVGKVI------
A0A3F3KPR9      VLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL------
D4TGN7          VLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL------
A0A1Z4UZW9      VLT--EYQKTQSELAIAR----SLYTNDNPKVVDLVMKEASLKNVLKERVAQTV------
A0A0K2M5H0      VLT--EYQKTQSELAVAR----SLYTGDNPKVVDLVMKEASLKNVLEQRVSQTV------
A0A1B7VSH4      VLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV------
A0A1B7W126      VLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV------
A0A3D4C6Q6      VLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV------
K7W0A4          VLT--EYQKTQYDLATAR----TLYTSDNPKVVNLVLKEASLKKLLEERVTQTI------
A0A1B7UTR1      VLT--EYQKTQYDLAKAR----TLYTSDNPKVVNLVMQEASLKDLLEKRVAQTI------
A0A1B7UVJ4      VLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIMKEASLKTVLKERVAQTV------
A0A2T1CIL7      LIS--ELQQVRIDLIEQR----DRFSDNAPQVNSLVKREVELEALLENQIEQIQG-----
A0A1Z4RPC6      ILD--QLATTETELAQER----QRFNDNHPTVISLNDKKQALNSQLQQLITQYV------
A0A2T1CMZ0      ILD--QLSTTETELSQER----QRFKDNHPAVISLQEKKQNLNSQLQGLISQYV------
L8M4F7          IID--EMTRTENQLIQER----RRFKEDHPNIVSLQGKKAALNRQLQSLMSQTI------
L8LZE9          IVT--ELGNTESQLSQER----QRFNDNHPEIVSLLDTKASLRRELQQQIAQKV------
A0A140K2P2      LLK--EMATVESELAKEK----QRFLDNHPSIQSLEEKKASLNKELKDLISQNV------
K9XWX4          LLK--EMATVESELAKER----QRFLDNHPSIKSLEEKKASLNQELKNLISQNV------
A0A140KB14      IFK--DLADVETELAQQR----QRFRDNHPMIQSLLEKKQDLNQKLQGLITETV------
K9XX88          IFK--DLADVETELAQQR----QRFRDNHPMVQSLLEKRQDLNQKLEGLITETV------
A0A433V7A0      ILK--KIQQVQSELAVQQ----TRLSNDHPSINNLKKQETALKSLLEDRVKAVV------
A0A0C2LBE2      VLT--QLQEAQSQLAVER----SRLKPEHPIIVNLEEKVAALNSVLQQRMKQVT------
A0A433NN38      LLS--QLQKTQADLEVAR----TRFQPEHPQIVNLEEQISALSQVLQQRVEQVA------
A0A2N6K0T2      VLT--ELQEAQSQLTVAR----TRYQPGHPTVIDLEEKVAALRNLLQERVGQVA------
A0A2N6ML72      VLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEEKVSALRSLLQQRVQQVG------
G6FQZ6          VLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG------
A0A2N6MQX9      VLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG------
A0A2N6KXT6      VLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG------
A0A2N6KGB9      VLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG------
A0A2N6L3Y5      VLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEEKVSALRSLLQQRIQQVG------
A0A0S3TIS7      VLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG------
A0A1U7GW28      VLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG------
A0A2N6LW63      VLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG------
A0A1Z4TQ63      VLK--ELQEAQTELTVAR----TRYLPGHPTVSNLEEKVSALKSLLQQRVEQVG------
A0A0D6YFE2      VIK--QLQEAQTELAVAR----TRYLPGHPTVSQLAEKVSALKNLLQQRVEQVG------
A0A328IH74      VIK--ELQEAQTELAVAR----TRYLPGHPTVSQLAEKVSALKNLLQQRVEQVG------
A0A1Z4NDS1      VLS--QLQEVQSQLALQQ----TRFHPEHPSIQDLQARVATLQNLLQQRINQVD------
K9F4D9          VLE--QLQTVQSDLTLAR----TRYRDEHPEIITLRNQEAGLQALLQERLDVTLG-----
U9VXM0          ALE--QLQTVQSDLALAR----TRYREEHPEIVTLRNQESSLQALLQQRLDITLG-----
A0A2T1FTR8      SLK--ELQEVEAKIATER----TRFSDNDPSILNLKEKRQALVEILQKRFKQSLV-----
K9UA41          SLK--ELQEVEAKIATER----TRFSDNDPSILNLKEKRQALVEILQKRFKQSLI-----
A0A1Z4SMD6      VLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKNQEINLNNLLRSRIEQVL------
A0A2H2Y096      VLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKNQEINLNNLLRSRIEQVL------
K9S8M8          ALS--ELQQIEDELAVAR----TRYQEQHPTIAGLRRKQAALQSLVQERVGQVLN-----
A0A1Z4NFV0      AIT--ELQKLQRQLANER----SRYTEFHPKILNLKQEIAQVQGLIQQRVNASS------
B0CAX4          ALA--DYQENERELAEAL----KVFQPTHPTVLDLKEKRIALKGVLGEQTSQII------
U5DPF5          ALE--SYQSIESELAVAE----SRYQPQHPAIVSLVESRDALRQVLNERIQTVLS-----
A0A350Y0P6      ALI--ELEQVQEQLNIEG----TRFQNEAPIIVSLKEKEAARQRLLNQRVEQVI------
A0A352X940      ILV--DIEQIEAQLTVQR----TRYQEEHPIIQNLKRREDAQKSLLQERISKVL------
B8HTN4          VLD--QYQQVEAELAVAR----TELQPDHPKIKTLEEQLTELNTILRERVRDVAQ-----
A0A2A2TPF8      VLG--ELQKVQSKLATAQ----SRYTSTHPSIANLKEEEKALTNLLQQRVSQSV------
A0A1Z4R0P8      VLS--ELQKVQTKLATEK----SRYNSTHPSVINLEEQEKALASLLQQRASQSV------
A0A0T7BUI3      VLS--ELQKTQSRLALER----VKYTNNHPNVVYLENQEKTLKSLLNRRTQEIT------
A0A1Z4LP32      VLT--ELQKVQTELAAER----ANYTQIHPLIRKLESQESALNALLQQRKSEAS------
K9REP9          VLG--ELQKVQTQLASER----ANYTSAHPLIRKLENQATLLQSLLQQRKQEAS------
A0A1Z4SIJ3      VLS--ELQKVETKLAAER----GRYTNQHPSIVYLKNQQAALKSILNERAGKAL------
A0A2H2XPG4      VLS--ELQKVETKLAAER----GRYTNQHPSIVYLKNQQAALKSILNERAGKAL------
K9V3C7          TLA--ELQKVENNLAVAR----ARYTENSPIVMDLREQQATLKQLLQERVADSS------
A0A1Z4T6Y7      SLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQKEAALNNLLQQRASQSL------
A0A2H2Y561      SLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQKEAALNNLLQQRASQSL------
A0A1Q4S362      ALG--ELQKVQTQIATQR----ALYTSDNPIMITLREKEASLNKLLQQRASQSL------
A0A3S1CIN8      ALG--ELQKVQSQIATQQ----ALYTSDNPIMITLREKEASLSQLLQQRASQSL------
A0A2A2TC28      VLG--EQQKVQAKLATLK----ARYTDEHPAIADLKSQELALNSLVKQRVEQSL------
A0A0C1NCB0      VLT--ELQKVQTKLANER----ARYTEKHPSVVNLENEEVTLKALLKQRVGETA------
A0A2N6K7Q9      VLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS------
A0A2N6MXH6      VLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS------
A0A2N6M5A8      VLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS------
A0A2N6LL61      VLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS------
A0A0S3TP66      VLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS------
G6FP91          VLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS------
A0A1U7GYR5      VLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS------
A0A2N6KY52      VLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS------
A0A2N6KMP5      VLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS------
A0A2N6MA45      VLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS------
A0A1Z4TLC8      VLT--ELQKIQTKLANAR----AIYTEQHPTITDLKNQQATLNSLLQQRTQQYS------
A0A0M0SFT2      VLT--ELQKVQTKLANAR----AIYTEQHPIITDLKNQQATLNALLQQRTQQYS------
A0A0D6Y7R4      VLT--ELQKVQTKLANAR----AIYTERNPIIIDLKNQQATLNSLLQQRTQQYS------
A0A328IGA1      VLT--ELQKVQTKLANAR----AIYTERNPIIIDLKNQQSTLNSLLQQRTQQYS------
A0A0C2LFH0      VLT--ELQKVQTKLANER----ARYTSEHPAITELKNKEITLNALLQQRVEQVL------
A0A1Z4IYV4      VLS--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL------
A0A1Z4Q0T6      VLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL------
A0A0C2PT44      VLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL------
A0A1D2P6J4      VLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL------
A0A3M9ZEU1      VLS--QYQNVQSQLAIEQ----ARYRSSHPTVANLQRQADQLRTLLQERVQQAI------
A0A1Z4JK72      ALS--QLQQVQTRLVTEQ----ARFKSTTPQIQTLQQQEQDLNALLQSRVSEAV------
A0A0N7Z489      VLS--QLQTVESRLVTES----SRFKDTTPQIQTLKQQRDDLNALLQARVSEAV------
A0A0S3TXS2      VLA--QLQSVESRLVTEQ----ARFKDTTPQIQTLKQQRDDLNALLQTRVSDAV------
A0A1Z4RN12      ALS--QLQDVKVALAQKQ----AFLSNNAPQIVSLKQEEADLTSLLEQQIASTL------
A0A2T1CMF9      TLA--QLQKIKVELAQKS----NVLSDSSPQIISLKEEQADLEDLLRQEVAGTL------
Q7NDC5          LRK--TLLEIESKLAVAR----AQYQDSYPEVEQLIKRRGALRALLASEADRLL------
U5QGK3          LRK--DLVEVESKLALAR----AQYQDNYPDVDRLIKQRNALRALLKTEAGRLL------
A0A2W4UY24      VIT--TLQAVQSQLAIAL----TRYREGHPEIASLRSQEVALLTLLQTRVGLALG-----
A0A254WLE3      VLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRIAQAV------
A0A433W533      VLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV------
A0A2P8QWJ3      VLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV------
A0A2T1FKP8      VLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV------
K9U6L7          VLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV------
A0A2T1GMT4      ILT--QLQDVDRQLATES----SRFSDDNPIIVSLKEKQSKLKTLLSQQIRNTI------
K9UI51          ILT--QLQDVDRQLATES----SRFSDDNPIIVGLKEKQSKLKALLEQQIRSTI------
K9TYI2          VLT--QLQDTERQLASQR----SRYLNDNPIIVDLEAKKYNLEALLQKQIKQTV------
A0A254W5G5      VLA--QLQDTERQLASQR----SRYLNNNPIIVDLEAKKSNLVALLQKQIKQTV------
A0A2T1FXY4      VLI--QLQDTERQLASQR----SRYLNNNPIIVDLEAKKSNLEALLKKQIKQTV------
A0A1Z4QL41      ILT--QLQEIDRQLAVER----SRFLDENPVIINLEAKRFNLKNLLQKQIEQTI------
A0A252D4T4      ILT--QIQEVDRQLATER----SRFQEENPVIVNLVARRANLQALLKQEVGQNG------
A0A252DJH5      ILT--QIQEVDRQLATER----SRFQEENPVIVNLVARRANLQALLKQEVGQNG------
A0A252EB80      ILT--QLQEVDRQLATER----SRFQDENPVIVNLVAKKANLQALLKQEVGQNG------
A0A1Z4HPW5      ILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKANLQALLKKEIGQTD------
A0A1Z4MSN1      ILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQRKANLQALLKKEIGQTG------
A0A1Z4U1C2      ILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQRKANLQALLKKEIGQTG------
A0A0D6KV51      ILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKTNLQALLKQEIGQTG------
A0A1Z4MKF8      ILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKTNLQALLKQEIGQTG------
A0A2C6WC43      ILT--QLQDIERQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTV------
A0A1Z4L5A1      ILT--QLQDIERQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTV------
A0A367QD86      ILT--QLQDIDRQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTI------
A0A235IZ96      VLV--QLQETDRQLAIER----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI------
A0A2L2NGP0      VLV--QLQETDRQLAIEH----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI------
A0A2K8SM78      VLT--QLQDTDRQLAIER----SRFLDDNPVIINLEAKKASLKSLLQQQIGQTV------
A0A2R5FPC0      VLA--QLQDTDRQLAIER----SRFLDDNPVIINLQAKKASLQSLLQQQIGQTV------
K9QM62          ALT--QYQDIERQLATER----SRFSEAHPTIVNLEARKSNLKTLLQQQINQTL------
A0A1Z4FWI3      IVT--QLQDVERQLATER----SRFQDENPVIINLEAKKANLKALLQQEIGQAG------
A0A1Z4JYE7      ILS--QLQELERQLANER----SRFTDDNPIIVSLEAKKDNLNNLLQLQIAKTV------
A0A140KBA0      ALT--QLQNVKVELASKR----NLFGENAPQIISLKEQEAELTALLEQQIRQTL------
K9XSG1          ALT--QLQDVKVQLATKR----NLFGENAPQIISLKEQEAELTALLEQQIQQTL------
A0A0F5YE28      ILT--ELENVESELVNER----KRFKDQNPRIIALKQKRDSLNAALQEQVEQVL------
U7QEH7          ILT--ELENVESELVNER----KRFKDQNPRIIALNQKRDSLNAALQEQVEQTL------
A0A3S1ATK5      IVI--QLHEIERQLATER----SRYFDNNPVIISLEAKKANLNNLLQTQIKATI------
A0A2Z6CPH0      VLT--QLQDVERQLANER----SRFLDDNPVIVGLEARKANLTNLLQQQITQTL------
A0A1Z4GT50      ILA--QLQDLERQLATER----SRFYDDNPVITNLEAKKTTLQTLLQKQIEQIV------
A0A1Z4GIX0      VLT--QLQEVERQLANER----SRFLDDNPIIVSLEARKANLTALLQQQVGQTL------
A0A2H6LC24      VLT--QLQEVERQLANER----SRFLDDNPIIVSLEARKANLTALLQQQVGQTL------
B2J6N5          VLT--QLQETERQLAIER----SRFLDDNPVIINLEAKKASLKSLLQQQIGQTV------
A0A367RMI4      ILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKANLKSLLQQQVGQTV------
A0A235HUM0      ILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKTNLKSLLQQQVGQTV------
A0A2L2NW47      ILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKANLKSLLQQQVGQTI------
A0A1E2WUR1      VLT--QLQETDRQLAVER----SRFLDDNPVIINLEARKASLNSLLQQQIGQTI------
A0A235IKU3      VLV--QLQETDRQLAIER----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI------
F4XKF3          VLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL------
A0A1D9FX10      VLQ--ELQEVERQLAVSK----NRYGKNHPVMIRLTKQQRSLRGHLQQQIDQIL------
A0A1D8TNX9      VLQ--ELQEVERQLAVGR----NRYGKNHPIMIRLTKQQRSLTGHLQQQINQIL------
A0A1U7MYU6      VLQ--ELQEVERQLAVGN----NRYGKNHPVMIRLTKQQSSLRGHLQQQIDQIL------
A0A3C0NJ41      VLK--QYQDIQAQLTLQR----TRFLDDSPVIVSLKEKEASLKSLLQDRVSQTV------
A0A352AG88      VLQ--EFQQVQSKLRVEQ----TRFQDEDPTIISLKEREAALRNLLQERVVQTI------
A0A350Y374      ILK--EFQKVQADLTIQR----TRFQEADPTIISLKQKEAALKSLLEERVGQTI------
A0A355DPX0      ILK--EFQTVQADLTIQR----TRFQEADPTIISLKQKEAALKSLLEERVGQTI------
A0A0D8ZUV2      LLE--ESQQLEDRLATER----TRLQEDHPTIVNLKLRQAALKALLDKRV----------
A0A433VDI0      TLE--ELRQVEDQLVVQR----TRLQEDHPAIVNLELKKNAFKAQLQGLVK---------
A0A3D1PG43      VVA--ELQQVEADLVVLQ----TRFLDGHPKIAELQNKKAALKALLQQRITQTL------
A0A2P8QQ72      TLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQKRNALKQLLEGRIGQML------
K9TZQ7          TLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQKRNALKQLLEGRIGQML------
A0A2G7GPR0      VLT--EYQQVEAELAVQQ----TRFVGEHPTILGLQERRDALRALLEERVQGAI------
K9XH68          VLA--EYQQVEAELAVQQ----TRFVGDHPTLLSLTERRDALRALLEERVQGAI------
A0A1U7HW70      VLA--EYQQVEAELAVQQ----TRFVGDHPTLLGLTERRDALRALLEERVQGAIG-----
A0A2S6VEJ8      VLQ--EYQQVEAELAVQQ----TRFVGDHPTILSLTERRDALRALLEERVQGAI------
                                                                            

K9SLA9          ---EN----------------------------LT------TQNL---------------
A0A168TT23      ---GN-------------------------------------------------------
A0A0M1JWX9      ---GR----------------------------EIVTVARVPEAQ---------------
A0A2T1M1V6      Q-VDV----------------------------TL-GDSSTDSRT---------------
A0A2G7GCS2      Q-IDP----------------------------TLGGNGTRDSRI---------------
K9XBH8          Q-VDP----------------------------TLSGSGTRDSRI---------------
A0A1Z4LJ30      --VDT----------------------------SVGQNT-----A---------------
K9RI76          --VNP----------------------------AIGENT-----A---------------
A0A352AE27      --IDT----------------------------TMTGER--QGRA---------------
A0A3B8JH60      --VDT----------------------------TVSTNN--EGRA---------------
A0A3C0N766      --VDT----------------------------TVSTNN--EGRA---------------
K9W9J7          --VDT----------------------------TVSTNS--DGRA---------------
A0A139WSU3      --VDT----------------------------TVATDS--QGRA---------------
A0A433VN22      --VDP----------------------------TIATDS--QGRA---------------
Q7NF11          RALDD----------------------------SLAGGGNRDSRI---------------
A0A1Z4JCS8      --ISA----------------------------NTDFTTGAEGRN---------------
F4XTX2          --VDP----------------------------TLTDSA--QGRA---------------
Q7NJN6          --VNV----------------------------SLGGNSYRDSRI---------------
U5QCC3          --VDT----------------------------TLGGNTYRDSRI---------------
A0A0S3TYD7      ---GQ-----------------------------TTAPRATEDDL---------------
U5QL42          ---GSAKVAKLGLKSGAVPALGDSAITGSGGANPPVAPAASAPTPATVASKGEPAPPAAP
K9QF04          ---GIQL------------------------FKEIQQLPGVASPSKIRT-----------
A0A3C0N2P0      ---GNAA------------------------SGVPDNAESLASPSSIRK-----------
K9TLQ0          ---GPNV------------------------SQFRGDIRGLSTPNSLRS-----------
A0A076HBF2      ------------------------------------------------------------
A0A354B169      ------------------------------------------------------------
G4FMX5          ------------------------------------------------------------
Q0IDT5          ------------------------------------------------------------
A0A2D6FCW3      ------------------------------------------------------------
A3ZA21          ------------------------------------------------------------
A0A140K3H3      ---GDAV------------------------SQVNLEAIIVSQGSTSQVMGINGADTQAQ
K9XUB8          ---GDAV------------------------SQVNLEAIIVNQGSTSQIMGINTANTQVS
Q7NEU3          ---GDRT------------------------VPAIVSGGASLQDSIADSVNNTGSPKGIT
A0A352XE00      ---SSAK------------------------LTQS-------DNLASLA-----------
B4VS56          ---GANA------------------------SAVP-------ENPESLA-----------
A0A352AAQ3      ---GSGS------------------------SGVP-------NNAESLA-----------
A0A350Y472      ---GNAA------------------------FGIP-------NNPESLA-----------
A0A355DVB4      ---GNAA------------------------FGIP-------NNPESLA-----------
A0A2P8VVX1      ---RQNV------------------------TELD-------PTLLSYL-----------
A0A2P8WHY0      ---RRPV------------------------ETLN-------PDIASLL-----------
A0A2T1CMT9      ---GELP------------------------PNFSSDL-----KLLQKQ-----------
A0A1D8TX52      ---GQVP------------------------TQLVSTG----SNLLTEG-----------
A0A1U7N5X9      ---GQVP------------------------TQLVTTG----NNLLTEG-----------
A0A1D9G4T2      ---GQVP------------------------TQLVSTG----SNLLTEG-----------
F4XP71          ---GQVP------------------------TKLVTTG----NNLLTEG-----------
A0A2P8QVH5      ---DRLP------------------------AQLSTTE----KSLPKQL-----------
A0A2T1FT70      ---DRLP------------------------AQLSTTE----KSLPKQL-----------
A0A433W4W4      ---DRLP------------------------AQLSTTE----KSLPKQL-----------
K9U5W1          ---DRLP------------------------AQLSTTE----KSLPKQL-----------
A0A254WLA7      ---DRLP------------------------AQLNTTE----KSLPKQL-----------
A0A2W6ZAV2      ------------------------------------------------------------
A0A2G7GMH8      ---GENA------------------------IAS-------EEDTTTAG-----------
K9W742          ---GKNS------------------------SQLK------GENLLTEG-----------
K9SA61          ---SSTS------------------------TGTSSQG----DRLLTEG-----------
A0A350Y7Z1      ---GETS------------------------TQIAFST----QNLLTEG-----------
A0A352X2A7      ---GRVA------------------------RGEDLTS----NTLLTEG-----------
K9XPB0          ---GAVP------------------------PNFAVQL----QSLLRQG-----------
A0A0D8ZYV0      ---GANV------------------------AQ-----ANAAGDLLSQG-----------
A0A3D1PBA3      ---GKEQ------------------------AQ----SGSTGENILTQG-----------
A0A254WJ87      ---GEGQ------------------------AAQAAAS-NGGDGILQQG-----------
A0A2T1FP73      ---GEGQ------------------------ASQAAAAGNAADGILQQG-----------
A0A433VMS2      ---GEGQ------------------------ASQAAAAGNAADGILQQG-----------
K9TYA7          ---GEGQ------------------------ASQAAAAGNAADGILQQG-----------
A0A2P8QUE1      ---GEGQ------------------------ASQAAAAGNAADGILQQG-----------
A0A2T1DWE8      ---GNNA------------------------A-QVNVK---GDGGLSVG-----------
A0A1U7I8L3      ---GNNN------------------------PLPPTTT---NSNLLEKG-----------
A0A2T1DJL8      ---GAQA------------------------A-AIAQS---GDGLVAIG-----------
A0A1Z4J9W0      ---GSEA------------------------G---AAS---SESLFATG-----------
A0A0N7Z5K9      ---GADA------------------------G-AIAGS---DSALFSTG-----------
A0A0S3TXC5      ---GSEA------------------------S-SIAGS---DAGLFSTG-----------
A0A2T1DNG3      ---GS---------SSPGSG---------------------ESLLSTG------------
A0A2P8W9H0      ------------------------------------------------------------
A0A3S0Y9N9      ---GEAGRLNKSKDSESIVQ----------------------------------------
A0A433UNK7      ---GKSGRLNQSVEPEKIVQ----------------------------------------
B8HNB0          ------------------RTQLNR-------DLTTLPSSASSGS----------------
A0A1Z4LN32      ---GY---------R---TQ-------------IA------PSSL---------------
A0A2I8A9F5      ---GY---------P---IQ-------------IE------TARL---------------
A0A218Q6R8      ---GY---------P---MQ-------------IP------PTML---------------
A0A0C1XVC4      ---GY---------K---AA-------------IA------PGKL---------------
A0A218QGE0      ---GY---------K---AA-------------IA------PGKL---------------
A0A3B8Y8H9      ---GN----------------------------IPQTSLTDLTAL---------------
A0A1Z3HMQ0      ---GT---------Q---AN-------------ISPG------DL---------------
A0A1E5QP61      ---GN---------N---QA-------------VDRR------DL---------------
A0A3M2GIL5      ---GS---------Q---LQ-------------LPRE------SF---------------
A0A433NM31      ---KG---------Q---QP-------------LLDQ------NL---------------
A0A3M1PML8      ---KS---------D---WS-------------SIRN------DL---------------
A0A352X442      ---GS---------E---AE-------------VATT------NL---------------
A0A0T7BPZ0      ---GE---------S---TK-------------LSIQ------NL---------------
A0A0M0SHU3      ---GS---------N---QQ-------------MSTA------SL---------------
A0A1D2PBN3      ---GS---------G---RQ-------------IPTL------NL---------------
A0A0C2LVR7      ---GN---------S---RQ-------------IPTL------NL---------------
A0A1Z4PQB9      ---GS---------D---RQ-------------IPTL------NL---------------
A0A1Z4SFN6      ---GS---------N---QQ-------------IPLENVQNLQNL---------------
K9PGI8          ---GS---------T---KT-------------VIKG------NL---------------
A0A2W1JVB9      ---G-----------------------------VPSSPTQGTGQL---------------
A0A3M1SVZ4      ---GS----------------------------LKS-----IGNL---------------
K9SSQ0          ---GT-------------KP-------------AD------VTPE---------------
A0A2W1JIN9      ---GG-------------GS-------------SV------NIAP---------------
A0A318AJV1      ------------------------------------------------------------
A0A254WHG9      ---GN-------------PA-------------AS------TPNA---------------
A0A2P8QIL5      ---GN-------------PA-------------AS------TSNP---------------
A0A2T1FLY5      ---GN-------------PA-------------AS------TPNA---------------
A0A433W447      ---GN-------------PA-------------AS------TPNA---------------
K9U1K8          ---GN-------------PA-------------AS------TPNA---------------
A0A1U7N2U4      NQLTN-------------QI-------------IP------PADV---------------
A0A1D9G1F2      ---NN-------------QI-------------IA------PGDV---------------
F4XV38          ---NN-------------QI-------------IA------PGDV---------------
K9UYB2          ---DN-------------QS-------------IP------DNNI---------------
A0A0C1XJI7      ---AN-------------SS-------------VA------TNSV---------------
A0A218QN17      ---AN-------------SS-------------VA------TNSV---------------
K9RKN2          ---TN-------------NS-------------VR------DNQI---------------
A0A2I8ADV2      ---NN-------------QT-------------IP------TEDV---------------
A0A1W5CKM3      ---SN-------------QT-------------AN------FNNL---------------
Q3MEW0          ---SN-------------QT-------------AN------FNNL---------------
A0A1Z4KIC7      ---SG-------------QT-------------DN------FQDL---------------
Q8YSM5          ---SG-------------QT-------------DN------FQDL---------------
A0A1Q4S1H4      -------------------G-------------NA------VANI---------------
A0A433VBU6      -------------------G-------------NA------LTSV---------------
A0A1Q4RZJ6      ---AG-------------AN-------------NS------NNNI---------------
A0A1Z4SNV3      ---SS-------------NN-------------SN------LNNV---------------
A0A2H2XJQ1      ---SS-------------NN-------------SN------LNNV---------------
A0A3S5K358      ---GA-------------GV-------------NN------SNNI---------------
A0A0T7BPJ4      ---DG-------------QS--------------Q------TTNF---------------
A0A0C1QS61      ---GE-------------RP-------------VS------PNNV---------------
A0A139X3R8      ---EN-------------QP-------------VS------PNNV---------------
A0A1Z4I7C5      ---SN-------------QT-------------AN------FQDL---------------
A0A0C2MDK7      ---KD-------------QS-------------VS------TKNF---------------
A0A1Y0RCK1      ---EN-------------QN-------------AS------AKNF---------------
A0A1Z4PWZ0      ---QG-------------QT-------------VS------ANNF---------------
A0A0C2QLT0      ---QN-------------QT-------------TS------ANNF---------------
A0A1Z4J2K1      ---KD-------------QT-------------SS------ANNF---------------
A0A3S0ZSX0      ---QN-------------QA-------------IP------TNAV---------------
A0A2N6K4T3      ---RN-------------QS-------------IS------SGSV---------------
A0A370CKT2      ---RN-------------QS-------------IS------SGSV---------------
A0A0S3TL97      ---RN-------------QS-------------IS------SGSV---------------
A0A2N6M8A0      ---RN-------------QS-------------IS------SGSV---------------
A0A2N6M9E1      ---RN-------------QS-------------IS------SGSV---------------
A0A2N6KJI4      ---RN-------------QS-------------IS------SGSV---------------
A0A2N6MZ77      ---RN-------------QS-------------IS------SDSV---------------
A0A2N6KT20      ---RN-------------QS-------------IS------SGSV---------------
G6FSN3          ---RN-------------QS-------------IS------SGSV---------------
A0A0D6YL98      ---RS-------------KS-------------IS------SSSV---------------
A0A328I8B9      ---RS-------------KS-------------IS------SSSV---------------
A0A0M0SU69      ---GN-------------TS-------------IS------SSSV---------------
A0A1Z4TIZ8      ---GN-------------TS-------------IS------SSSV---------------
A0A318BG22      ---GF-------------RA---------------------AYEL---------------
A0A2T1E9V8      ---GQ-------------KI-------------SS------YSNL---------------
A0A0P1C0L3      ------------------------------------------------------------
A0A3M2GQQ6      ---GD---------A---VAKVDL-------DEVT-------------------------
K9SGJ5          ---GG---------RAAQVG-------------ISTAVPASADGS---------------
L8MYT6          ---GV---------KGNTVN-------------IAN----EPSSL---------------
A0A352JGJ6      ---GT---------KG--TN-------------ITN----EPNSP---------------
A0A1J5GLS2      ---GV---------GANSRN-------------LTN----EPNSL---------------
A0A2W4W6M5      ---GV---------RGGNVN-------------LTN----EPNST---------------
A0A2W7AN33      ---G-----------DSTAN-------------ITN----QPNSA---------------
A0A256BLV2      ---GV---------RGSTTN-------------ITN----EPNSA---------------
A0A2W6ZXF3      ---GV---------GVG-NN-------------FTN----EPNSP---------------
A0A2Z5WX66      ---GL---------KGS-AN-------------IAR----EPNST---------------
K9W1T3          ---GQ-------------QP-------------LP------NRIV---------------
A0A0D6YBN8      ---GS----------------------------IQ-------------------------
A0A318BJ18      ---GS----------------------------IQ-------------------------
A0A1Q4RTR1      ---GG-------------AP-------------QGL----NERDL---------------
A0A1Z4SQV2      ---GS-------------T--------------QAL----NERDL---------------
A0A2H2XGN1      ---GS-------------T--------------QAL----NERDL---------------
A0A433UXH8      ---GK-------------V--------------QNL----NERDL---------------
A0A1Z4RMB9      ---GQ---------G---VQ-------------VS------QGLL---------------
D5A466          ---GS---------G---RA-------------FS------RGLL---------------
K1XF69          ---GS---------S---RP-------------FS------RGLL---------------
B5W297          ---GS---------S---RP-------------FS------RGLL---------------
H1W7M8          ---GS---------S---RP-------------FS------RGLL---------------
B4WP72          --------------TNGRQQ-------------FE------NSNM---------------
A0A318B4H2      ------------------------------------------------------------
B4WQE3          ------------------------------------------------------------
A0A2K3BR24      ------------------QEELPS-------NALAD----DNFSL---------------
K9YXY1          ------------------QEELPS-------NALAD----DNFSL---------------
A0A2P8W4F7      ---GE---------A------------------VE------ANSL---------------
U5QJM6          ---GD---------G---KQ-------------AES----LRDSLAGTLESNRTSSSTAD
A0A1U7HGH0      ---GQ----------------------------TPN----GNNQL---------------
K9XJD3          ---GQ----------------------------ALN-----NSQL---------------
K9SX01          ---GT---------N---EL-------------IS------DQDL---------------
A0A1E5QIR9      ---GN---------SPGAIA---------------------PGNL---------------
A0A1Z4IBC7      ---GN-------------AP-------------VT------QGSL---------------
A0A1W5CPC7      ---GT-------------AQ-------------VT------QGSL---------------
Q3MDC6          ---GT-------------AQ-------------VT------QGSL---------------
A0A1Z4KM73      ---GT-------------AQ-------------VT------QGSL---------------
Q8YNX7          ---GT-------------AQ-------------VT------QGSL---------------
A0A367R4K6      ---GE-------------AQ-------------VT------EGSL---------------
A0A1E2WSV8      ---GT-------------AQ-------------IT------EGSL---------------
A0A2R5FRT9      ---GT-------------AQ-------------IT------EGSL---------------
A0A2K8T1B6      ---GT-------------GQ-------------IT------EGSL---------------
A0A235I9I0      ---GG-------------AQ-------------IT------QGSL---------------
A0A2D0HQT8      ---GG-------------AQ-------------IT------QGSL---------------
A0A2L2NU95      ---GK-------------AQ-------------IT------QGSL---------------
A0A367S084      ---GG-------------AQ-------------IT------QGSL---------------
A0A0V7ZFJ4      ---DN---------G---NS-------------IS------ERNL---------------
A0A0V7ZNJ9      ---NN---------NSNDSS-------------IT------EDNL---------------
A0A367RIS1      ---GS---------A---QP-------------IP------DQDL---------------
A0A235IXQ2      ---GS---------S---EP-------------IP------EQDL---------------
A0A1W5CNX3      ---GS---------W---QP-------------IP------EQDL---------------
Q3MEB7          ---GS---------W---QP-------------IP------EQDL---------------
A0A1Z4KHN9      ---GS---------S---QP-------------IP------EQDL---------------
Q8YT70          ---GS---------S---QP-------------IP------EQDL---------------
A0A218Q4C1      ---GS---------S---QP-------------IP------EQNL---------------
A0A166IWU6      ---GS---------S---QP-------------IP------EQDL---------------
A0A2S0Q8C0      ---GS---------S---QP-------------IP------EQDL---------------
W6FSX4          ---GS---------S---QP-------------IP------EQDL---------------
A0A1B7WTD1      ---GN---------S---NS-------------LP------KQNL---------------
A0A1B7WX82      ---GS---------S---DA-------------LP------QQNL---------------
A0A0R0M9H9      ---GN---------A---EV-------------LQ------QSNL---------------
A0A1S1ZVW2      ---GN---------V---EV-------------LQ------QSNL---------------
A0A1Z4LRU5      ---GN---------G---VS-------------VR------EPDL---------------
A0A1Z4JVB4      ---GT---------S---AD-------------VP------EQNL---------------
K9PIA4          ---GN---------S---KY-------------VP------EQKL---------------
A0A1Z4M597      ---GN---------S---EY-------------MP------EQNL---------------
A0A1Z4MWT1      ---GN---------S---EY-------------TP------EQNL---------------
A0A1Z4TX53      ---GN---------S---EY-------------TP------EQNL---------------
A0A1Z4HVE1      ---GT---------S---ES-------------VP------EQNL---------------
A0A252ECZ1      ---GN---------S---EF-------------VP------EQNL---------------
A0A1Z4G5Y1      ---GS---------S---EF-------------VP------EQNL---------------
A0A252DNA2      ---GS---------S---EF-------------VP------EQNL---------------
A0A252E1Q4      ---GS---------S---EF-------------VP------EQNL---------------
A0A2A2TNQ5      ---GV---------G---ES-------------VK------EQDL---------------
A0A3S1C4K5      ---DT---------K---QP-------------VS------EKNL---------------
A0A1X4G3D5      ---GN---------V---GA-------------LG------ERSL---------------
D4TNI2          ---GN---------V---GA-------------LG------ERSL---------------
A0A1Z4H6Z8      ---GS---------S---ES-------------VP------EQNL---------------
A0A1Z4NPM1      ---GG---------G---VA-------------VP------ERDL---------------
A0A3F3KPR9      ---GN---------A---EV-------------LQ------QSNL---------------
D4TGN7          ---GN---------A---EV-------------LQ------QSNL---------------
A0A1Z4UZW9      ---GS---------S---ES-------------LP------KQNL---------------
A0A0K2M5H0      ---GS---------S---EF-------------LS------KQNL---------------
A0A1B7VSH4      ---GN---------F---ES-------------LS------QQNL---------------
A0A1B7W126      ---GN---------F---ES-------------LS------QQNL---------------
A0A3D4C6Q6      ---GN---------F---ES-------------LS------QQNL---------------
K7W0A4          ---GS---------S---KS-------------LP------QQNL---------------
A0A1B7UTR1      ---GS---------S---KS-------------LP------QQNL---------------
A0A1B7UVJ4      ---GS---------S---DA-------------LS------QQNL---------------
A0A2T1CIL7      ---GK---------Q---LGSLKS-------KLLS---------I---------------
A0A1Z4RPC6      ---GT--------------K-------------VS------EGLL---------------
A0A2T1CMZ0      ---GA--------------K-------------VS------EGLL---------------
L8M4F7          ---GQ--------------Q-------------VS------PGLI---------------
L8LZE9          ---GS---------N---VQ-------------IS------DGLL---------------
A0A140K2P2      ---GQ---------G---VE-------------IS------EGLF---------------
K9XWX4          ---GQ---------G---VE-------------IS------EGLF---------------
A0A140KB14      ---GS---------N---TK-------------IS------EGLL---------------
K9XX88          ---GS---------N---TK-------------IS------EGLL---------------
A0A433V7A0      -------------MQ---QP-------------IP------KGNF---------------
A0A0C2LBE2      ---GS---------N---QQ-------------IS------LGNL---------------
A0A433NN38      ---GK---------N---QQ-------------VS------LKNL---------------
A0A2N6K0T2      ---GN---------N---QP-------------VS------PANL---------------
A0A2N6ML72      ---GN---------N---QQ-------------IS------TANL---------------
G6FQZ6          ---GN---------N---QQ-------------IS------TANL---------------
A0A2N6MQX9      ---GN---------N---QQ-------------IS------TANL---------------
A0A2N6KXT6      ---GN---------N---QQ-------------IS------TANL---------------
A0A2N6KGB9      ---GN---------N---QQ-------------IS------TANL---------------
A0A2N6L3Y5      ---GN---------N---QQ-------------IS------TANL---------------
A0A0S3TIS7      ---GN---------N---QQ-------------IS------TANL---------------
A0A1U7GW28      ---GN---------N---QQ-------------IS------TANL---------------
A0A2N6LW63      ---GN---------N---QQ-------------IS------TANL---------------
A0A1Z4TQ63      ---GN---------N---PQ-------------IS------TANL---------------
A0A0D6YFE2      ---GN---------N---QQ-------------IS------TANL---------------
A0A328IH74      ---GN---------N---QQ-------------IS------TANL---------------
A0A1Z4NDS1      ---GN----------------------------QQI----QLDNL---------------
K9F4D9          ---AN---------E---LN-------------LP------SDDL---------------
U9VXM0          ---AN---------Q---LD-------------LP------EDDL---------------
A0A2T1FTR8      ---GE---------Q---QF---------------------QGKLVEL------------
K9UA41          ---GE---------Q---QF---------------------QGKLVEL------------
A0A1Z4SMD6      ---GPSGMNLVFGNR---QT-------------VS------TGKL---------------
A0A2H2Y096      ---GPSGMNLVFGNR---QT-------------VS------TGKL---------------
K9S8M8          ---GT---------P---AS-------------DI------NPSY---------------
A0A1Z4NFV0      ---GA---------N---FN-------------TT------PERL---------------
B0CAX4          --------------E---TK-------------QPQ----PLRNL---------------
U5DPF5          ---ESPAAGGAIPVD---VA-------------IA------SGTL---------------
A0A350Y0P6      ---GL---------K---QS-------------IP------LNNL---------------
A0A352X940      ---GT---------G---EI-------------LP------TENL---------------
B8HTN4          ---AS---------R---KG-----------GSLP------TSNL---------------
A0A2A2TPF8      ---PS--------KN---VK-------------ID------PNSL---------------
A0A1Z4R0P8      ---GA---------N---VK-------------IS------PNSL---------------
A0A0T7BUI3      ---GN---------Q---LE-------------VS------LSNL---------------
A0A1Z4LP32      ---GR---------Q---QN-------------IS------NSRL---------------
K9REP9          ---GR---------Q---QN-------------IP------NNRL---------------
A0A1Z4SIJ3      ---GT---------T---DN-------------IS------TNKL---------------
A0A2H2XPG4      ---GT---------T---DN-------------IS------TNKL---------------
K9V3C7          ---GS---------S---QQ-------------IT------PGNL---------------
A0A1Z4T6Y7      ---GT---------N---VK-------------VS------PNKL---------------
A0A2H2Y561      ---GT---------N---VK-------------VS------PNKL---------------
A0A1Q4S362      ---GT---------N---VK-------------VS------PDKL---------------
A0A3S1CIN8      ---GT---------N---VK-------------VS------PDKL---------------
A0A2A2TC28      ---GS----GKIGST---KN-------------IS------PTNL---------------
A0A0C1NCB0      ---GS---------Q---RE-------------IS------TDKL---------------
A0A2N6K7Q9      ---GI-------------PI-------------VS------PGKL---------------
A0A2N6MXH6      ---GI-------------PI-------------VS------PGKL---------------
A0A2N6M5A8      ---GI-------------PI-------------VS------PDKL---------------
A0A2N6LL61      ---GI-------------PI-------------VS------PGKL---------------
A0A0S3TP66      ---GI-------------PI-------------VS------PGKL---------------
G6FP91          ---GI-------------PI-------------VS------PGKL---------------
A0A1U7GYR5      ---GI-------------PI-------------VS------PGKL---------------
A0A2N6KY52      ---GI-------------PI-------------VS------PGKL---------------
A0A2N6KMP5      ---GI-------------PI-------------VS------PGKL---------------
A0A2N6MA45      ---GI-------------PI-------------VS------PGKL---------------
A0A1Z4TLC8      ---GI-------------PL-------------VS------PGKL---------------
A0A0M0SFT2      ---GI-------------PL-------------VS------PSKL---------------
A0A0D6Y7R4      ---GI-------------PL-------------VS------PSKL---------------
A0A328IGA1      ---GI-------------PL-------------VS------PSKL---------------
A0A0C2LFH0      ---GPSGVKQVLGTQ---QN-------------VA------PGKL---------------
A0A1Z4IYV4      ---GTKGIKQVLGTQ---KN-------------VP------PGKL---------------
A0A1Z4Q0T6      ---GTKGIKQVLGTQ---QN-------------VP------PGKL---------------
A0A0C2PT44      ---GAKGIKQVLGTQ---QN-------------VP------PGKL---------------
A0A1D2P6J4      ---GTKGIEQVLGTQ---KN-------------VP------PGKL---------------
A0A3M9ZEU1      ---GM---------Q---IP-------------IS------EGGL---------------
A0A1Z4JK72      ---GA---------S---VQ-------------VA------PGAL---------------
A0A0N7Z489      ---GS---------S---VQ-------------VS------PNRL---------------
A0A0S3TXS2      ---GA---------N---VS-------------VA------PGAL---------------
A0A1Z4RN12      ---GP---------G---QQ------------GLVN----SVNIA---------------
A0A2T1CMF9      ---GP---------Q---QQ------------GLAG----QINIL---------------
Q7NDC5          ---GR---------R---GLPDSL-------LDANL----GTGRTEPAAVPDDLP-----
U5QGK3          ---GQ---------P---GLPDSL-------VDASV----AAEAQAPAT-KDNLP-----
A0A2W4UY24      ---SD---------Q---IA-------------LP------DDDL---------------
A0A254WLE3      ---GK---------A---RT-------------VA------DGKL---------------
A0A433W533      ---GK---------T---RT-------------LA------DGKL---------------
A0A2P8QWJ3      ---GK---------T---RT-------------LA------DGKL---------------
A0A2T1FKP8      ---GK---------T---RT-------------LA------DGKL---------------
K9U6L7          ---GK---------T---RT-------------LA------DGKL---------------
A0A2T1GMT4      ---GS---------Q---AQ-------------IP------QGLL---------------
K9UI51          ---GS---------Q---AQ-------------IP------QGLL---------------
K9TYI2          ---GS---------Q---TK-------------VA------AGLL---------------
A0A254W5G5      ---GS---------Q---TK-------------VA------SGLL---------------
A0A2T1FXY4      ---GS---------Q---TK-------------VA------AGLL---------------
A0A1Z4QL41      ---GS---------Q---TQ-------------FT------QGFL---------------
A0A252D4T4      ---GT---------S---AN-------------IQ------PKTL---------------
A0A252DJH5      ---GT---------S---AN-------------IQ------PKTL---------------
A0A252EB80      ---GT---------Q---VN-------------IQ------PQSL---------------
A0A1Z4HPW5      ---AG---------P---VN-------------YQ------PKTL---------------
A0A1Z4MSN1      ---AG---------P---VN-------------YQ------PKTL---------------
A0A1Z4U1C2      ---AG---------P---VN-------------YQ------PKTL---------------
A0A0D6KV51      ---AG---------P---VN-------------YP------PKTL---------------
A0A1Z4MKF8      ---AG---------P---VN-------------YP------PKTL---------------
A0A2C6WC43      ---GS---------N---AQ-------------VP------QNLL---------------
A0A1Z4L5A1      ---GS---------N---AQ-------------VP------QNLL---------------
A0A367QD86      ---GN---------N---AQ-------------VP------QNLL---------------
A0A235IZ96      ---GN---------Q---TQ-------------VP------QSLL---------------
A0A2L2NGP0      ---GN---------Q---TQ-------------VP------QSLL---------------
A0A2K8SM78      ---GN---------Q---TQ-------------IP------QSLL---------------
A0A2R5FPC0      ---GN---------Q---TQ-------------IP------QRLL---------------
K9QM62          ---GK---------R---TT-------------VS------PKLL---------------
A0A1Z4FWI3      ---GN---------P---SN-------------IQ------PRTL---------------
A0A1Z4JYE7      ---GL---------G---QK-------------LQF----SPTLL---------------
A0A140KBA0      ---GS---------Q---SA---S-------SVAQ------LNIL---------------
K9XSG1          ---GS---------Q---SA---S-------SVAQ------LNIL---------------
A0A0F5YE28      ---GS---------Q---AV-------------VP------EGLL---------------
U7QEH7          ---GS---------Q---AV-------------VP------EGLL---------------
A0A3S1ATK5      ---GS---------S---AK-------------IP------EEQLQKTIASIGSGTQFPQ
A0A2Z6CPH0      ---GQ---------Q---SQ-------------FA------PRLL---------------
A0A1Z4GT50      ---GN---------Q---VK-------------IP------QGQL---------------
A0A1Z4GIX0      ---GT---------Q---AQ-------------VP------QRLL---------------
A0A2H6LC24      ---GT---------Q---AQ-------------VP------QRLL---------------
B2J6N5          ---GN---------K---TE-------------VS------QNLL---------------
A0A367RMI4      ---GN---------Q---TQ-------------VP------QNLL---------------
A0A235HUM0      ---GN---------Q---TQ-------------VP------TSLL---------------
A0A2L2NW47      ---GN---------Q---TQ-------------VP------QSLL---------------
A0A1E2WUR1      ---GN---------Q---AP-------------VP------QSLL---------------
A0A235IKU3      ---GN---------Q---TQ-------------IP------QSLL---------------
F4XKF3          ---GS---------Q---SLAGTQ-------IQIT------QGLL---------------
A0A1D9FX10      ---GS---------Q---SLAGTQ-------IQIT------EGLL---------------
A0A1D8TNX9      ---GS---------Q---SLASTQ-------IQIT------QGLL---------------
A0A1U7MYU6      ---GS---------Q---SLAGTQ-------IQIT------QGLL---------------
A0A3C0NJ41      ---GS---------Q---QQ-------------VP------TGNL---------------
A0A352AG88      ---GV---------V---RP-------------VS------ASSL---------------
A0A350Y374      ---GY---------D---QF-------------VA------TQNL---------------
A0A355DPX0      ---GY---------D---QF-------------VA------TQNL---------------
A0A0D8ZUV2      ----A---------N---TN-----------SPVQ------GANL---------------
A0A433VDI0      ---DA---------G---VR-----------RQVT------SQQL---------------
A0A3D1PG43      ---GE--------------P-----------KQVP------IKDL---------------
A0A2P8QQ72      ---GN--------------S-----------KQVS------NRNL---------------
K9TZQ7          ---GN--------------S-----------KQVS------NRNL---------------
A0A2G7GPR0      ---GN---------A---AA-----------TEVS------PSNL---------------
K9XH68          ---GN---------A---AA-----------TEVS------PGNL---------------
A0A1U7HW70      ---GN---------A---AA-----------TEVS------PGNL---------------
A0A2S6VEJ8      ---GN---------A---AA-----------TEVS------PGNL---------------
                                                                            

K9SLA9          -RISD-TQA-----------------QLISNLANLETSKYGLRSRLEALSKLHQDYQKRI
A0A168TT23      ----------------------------------VLAEYSNLEAEVAALEDEIAANEERI
A0A0M1JWX9      -AFQNSVRV-----------------GLIQQMVAAASQIEVLKMRNQVLAQAAGMLSEYR
A0A2T1M1V6      --------------------------AIVADLIRSQSTAQGLKQQASLLEKELDKLNNEV
A0A2G7GCS2      --------------------------EMIAELIRSQNNAAGLQQQANQIASEINRVNAEL
K9XBH8          --------------------------DMIAELIRAQNTASGLQQQANQISSEINRVSTEL
A0A1Z4LJ30      --------------------------ALAEQMILAESQAFGMLKKAEQLQPTIDNLIKTL
K9RI76          --------------------------SLAEQVILAESQVIGMQKKAEKLQPQIDKLSASL
A0A352AE27      --------------------------TLIQQLILAESTASAQQRQATQLQSQAEQLNATL
A0A3B8JH60      --------------------------TLIQQLATAESEASAQQRQADQLKSEIEKLNASL
A0A3C0N766      --------------------------TLIQQLATAESEASAQQRQADQLKSEIEKLNASL
K9W9J7          --------------------------TLIQQLVLAESEASGQRRQAEQLQNEIQKLSTTL
A0A139WSU3      --------------------------ALIQQQVLAESEATAQRRQAQQLNNQITQLQTTL
A0A433VN22      --------------------------VLIQQQLLSESEAEAQFQQARQLEKQITELQRYL
Q7NF11          --------------------------DLILSLLEAERAAEARSRQSAQLGRTIEQATERL
A0A1Z4JCS8      --------------------------TLIEQLVLAETNANGQQRQAEQLQQQIDQRQKIL
F4XTX2          --------------------------MLIQQLILAESAASGQQQQAEQLQQQIDQMKNTL
Q7NJN6          --------------------------DLILQLVQSQAENGALTNQAARIGEKAASLEERL
U5QCC3          --------------------------DLILQLIQARSEGLAQNSQANQITEKIDSIDSQL
A0A0S3TYD7      -QMGQ-FRQ-----------------QLVTELVMAEIEQMSLEGQVESLSGALSAQQQRA
U5QL42          TSKAP-AALPEARSLAAAPVRQTIQQSLASQLLSTQVTLSVQKAQLASLTKAQNDIVARF
K9QF04          --------------------------EIIEKLIAASNQFQALLARQKALAIAENQARRNL
A0A3C0N2P0      --------------------------DLAQKLVDTQNQIQVLEVRRNKIAKAESVVGQQL
K9TLQ0          --------------------------DLTGKLIETVNLMEMTRARQWAIAQAETIVQQQM
A0A076HBF2      -QLEA-ADA----------------------------ALSLNAGRLATARMQQATLNQQF
A0A354B169      -QLEA-VDG----------------------------ALKLNAGRLAMARSQQQALTFQF
G4FMX5          -QLEA-VDA----------------------------ALNLNNGRLQTAQQQVAQLNAQF
Q0IDT5          -QLEA-VDA----------------------------ALGLNANRLATARAQERTLQDNF
A0A2D6FCW3      -QLEA-VDA----------------------------ALNLNAGRLETAKAQETSLNNQF
A3ZA21          -QLEA-VDA----------------------------ALSLNAGRLATAQAQERQLNVQF
A0A140K3H3      ALNPG-QPVDSQGASTQVSGTISTIQSLASMRSQVETEQAALQSQIAGIQQAKTKVEKTF
K9XUB8          AANTN-QAVESQGGSTQVSGTISTIQNLASMRLQVETEQASLQTQIAGIQRAKTQVENTF
Q7NEU3          DRLGD-LQV-----------------NLAAELIKAENAYRVQTARVAGLENVKNRMIGQF
A0A352XE00      -SPSS-VRL-----------------EITKKLIDTKNEIQSLSVREAALERTENLMESQI
B4VS56          -SPSS-LRL-----------------ALTQQLVETTNQINMLEVRSGAIAKAERLMSQQL
A0A352AAQ3      -SPSS-LRL-----------------DLTQKLVETENQIQVLQVRQTEIADAESRVSQQI
A0A350Y472      -SPSS-IRL-----------------NLTQKLVETKNQIQVLEVRRNEIADAEIRLSQQL
A0A355DVB4      -SPSS-IRL-----------------NLTQKLVETKNQIQVLEVRRNEIADAEIRLSQQL
A0A2P8VVX1      -QLGG-IDF-----------------GLVSQILEADVTLESLEARMETLASLESILRDEV
A0A2P8WHY0      -QLGG-VDL-----------------SLVTDLLEADVAIAGISARWESLATQEQSLRQEL
A0A2T1CMT9      -GLVG-SDT-----------------GIANTVNDSQARLTGIRQRDLSLAQTEAALKQRL
A0A1D8TX52      -QLGG-VDI-----------------NLVNELITSQINLVSLQTRDQALIKTEQEIRIQL
A0A1U7N5X9      -QLGG-VDI-----------------NLVNELITSQINLVSLQTRDQALAKTEQEIRIQL
A0A1D9G4T2      -QLGG-VDI-----------------NLVNELITSQINLVSLQTRDQALIKTEQEIRIQL
F4XP71          -QLGG-VDL-----------------NLVNELITSQINLVSLQTRDQALAKTEQEIRIQL
A0A2P8QVH5      -QLGD-SDR-----------------KLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTL
A0A2T1FT70      -QLGD-SDR-----------------KLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTL
A0A433W4W4      -QLGD-SDR-----------------KLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTL
K9U5W1          -QLGD-SDR-----------------KLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTL
A0A254WLA7      -QLGD-SDR-----------------KLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTL
A0A2W6ZAV2      ------------------------------KLDSIKATLAENRSEQAEVNRQALQLSRQF
A0A2G7GMH8      -QQGQ-LDI-----------------NLAGELVEAQTNLVSLQANAQSLANAEQQLSAEI
K9W742          -QLGE-TDV-----------------NLTNKLLELESSIRGLMAREQTLAEKEQQLRVEL
K9SA61          -QMGE-LDL-----------------NLAGQLVETQTRLQALQARGRSLSQTEQQLTGEL
A0A350Y7Z1      -QLGN-NDL-----------------TLSSQLAEAQTTLQALQARDRSLAITQQQLRAKL
A0A352X2A7      -QLGE-NDL-----------------DLSQKLAEAQSSIQGLQARDRSLAQTEQKLRTKI
K9XPB0          -ELVN-SKT-----------------NFIETITQSQADLKGLEERDRSLAQTESELREKL
A0A0D8ZYV0      -QRGG-LDL-----------------NITAQLAEVQTSLSALQAQDVSLAKTEQGLRSQL
A0A3D1PBA3      -QLGG-IDL-----------------NLTNQLVDVQTNLNALRARDVSLEQTQKQLRTDL
A0A254WJ87      -QLGA-LDL-----------------NLAGQLIEIQTNMNAMRARDNSLAQTQQKLRSEL
A0A2T1FP73      -QLGA-LDL-----------------NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDL
A0A433VMS2      -QLGA-LDL-----------------NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDL
K9TYA7          -QLGA-LDL-----------------NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDL
A0A2P8QUE1      -QLGA-LDL-----------------NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDL
A0A2T1DWE8      -QLSA-TDL-----------------TLANALVDAQVNLVALQGRAQSLNEAERSLQQQL
A0A1U7I8L3      -QLGK-LDV-----------------NLSSKLLEEQTNVQGWQARVQSLTQKAQQIQAEL
A0A2T1DJL8      -QLGE-NDL-----------------KFASALVESQVNLVAAQARDRSLTNNELQLRGEL
A0A1Z4J9W0      -QLGE-NDL-----------------KFASDLTDAQVEFFGARARDQELARTEQQLRGQL
A0A0N7Z5K9      -QLGE-NDL-----------------KFASDLTQAQVDFFAARARDQTLAAEAQRLQSQL
A0A0S3TXC5      -QLGE-NDL-----------------KFASDLTQAQVDFFAARARDQSLVAEAQRLQAQL
A0A2T1DNG3      -QLGG-FDQ-----------------TLIGQFVETQGSLSTAQARYLSLLSSEQKVRAEL
A0A2P8W9H0      -REGLRVQR-----------------ELASYIRELENRDRALSETIVTL-------NQTT
A0A3S0Y9N9      -LKPQGLQQ-----------------GLLTNYASAEAERLSLQVRLKALAEMIQSYRQRA
A0A433UNK7      -LRGQGLQQ-----------------GLLGNYANVEAERLSLQVRLKSLAGVIESYRQRA
B8HNB0          -SDGS-VVQ-----------------GLTDKALEAQISLATQTAQLNGIRQAQQQVAERF
A0A1Z4LN32      -QIGR-VKQ-----------------ELISRFVNLRSQRLGLTQKIDSLSDLKNRYKQRA
A0A2I8A9F5      -QIGE-IKR-----------------DLSLELGKLQSQRLGLEKRITSLSNLKSAYEQRL
A0A218Q6R8      -QMGE-IRQ-----------------EIVSEFVKLKSQRLGLAEKIQSISNFRNSYSQRV
A0A0C1XVC4      -QMGE-IKQ-----------------NLTSDFVRLQSQRLGLEKKVEALSAIIASYKRRA
A0A218QGE0      -QMGE-IKQ-----------------NLTSDFVRLQSQRLGLEKKVEALSAVIASYKRRA
A0A3B8Y8H9      -TSPNTIRE-----------------DILSSLLKAETQLEELRARQKELIGLENDIRQEI
A0A1Z3HMQ0      -QMSE-LSR-----------------QLTSQLTEAEVNRLSLASQVQALLDSRQAYIEWS
A0A1E5QP61      -QIGE-LQQ-----------------QLTADLVNAEVQRLGLGSNVSALVRAQGSYRDRA
A0A3M2GIL5      -EIGL-VQQ-----------------QLLLDLVDSEVQRLGLVSQVRALEEARYSQQQRA
A0A433NM31      -QIGE-LQQ-----------------KLTEDYVKTEVERIVFNNQLSALSKVYSNYKQRA
A0A3M1PML8      -QAGA-LQQ-----------------DLIGELVRLEVQRQGIVLRLNTLSEASNAYRQRA
A0A352X442      -QIGQ-TKQ-----------------DLAAKLVAAEVEQSGLSRQLAVLTTARIAYKERS
A0A0T7BPZ0      -QIGD-VRY-----------------ELIADIVKTERERVVLERKLAKQKSTWAKYRERA
A0A0M0SHU3      -QMGE-VRQ-----------------KLIEDLANTDKERAGLEKRIAELKQTWSLYKQRA
A0A1D2PBN3      -QTGE-LRQ-----------------KLLEDYARSEAERVGLERQITTLSNKRSAYKQRA
A0A0C2LVR7      -QTGE-LRQ-----------------KLLEDYARSEAERVGLERQIITLSSKRSAYKQRA
A0A1Z4PQB9      -QTGE-LRQ-----------------KLLEDYARSEAERVGLEKKIITLSSKRSAYKQRA
A0A1Z4SFN6      -QIGE-LRQ-----------------NLIQNFATTEAERVGLSQQIATLSSKLSSYKQRV
K9PGI8          -QIGE-LRQ-----------------GLIADFARSEVERAGLEGEITTLSNKLSVYKKRA
A0A2W1JVB9      -QVGE-LQQ-----------------RATSELVRFETERLAAEQVAAALATSQTDFQQRT
A0A3M1SVZ4      -EFSQ-MEQ-----------------ELTQELVSLESERQGLNSQISALAQLQAGYQERL
K9SSQ0          -GQSS-IKQ-----------------NLATQLFDTQTRLATQTAELGSLKIAQTQVEQVF
A0A2W1JIN9      -ESAR-VGQ-----------------DLSVQLIQGKIERLSLQERLEAARGSMKQLESRR
A0A318AJV1      ---------------------------------SLQAQARAGDAQVASLRSTMAGLEAAR
A0A254WHG9      -ATDK-LSQ-----------------DLATQLITGEVEASALEGRLAAIRRDRATLQERL
A0A2P8QIL5      -ATDK-LSQ-----------------DLATQLITGEVEASALEGRLAAIRRDRATLQERL
A0A2T1FLY5      -ATDK-LSQ-----------------DLATQLITGEVEASALEGRLAAIRRDRATLQERL
A0A433W447      -ATDK-LSQ-----------------DLATQLITGEVEASALEGRLAAIRRDRATLQERL
K9U1K8          -ATDK-LSQ-----------------DLATQLITGEVEASALEGRLAAIRRDRATLQERL
A0A1U7N2U4      -ASDQ-LSQ-----------------DFTSRFILAETERSALEQKLYLVQTERIKLQNRL
A0A1D9G1F2      -ASDQ-LSQ-----------------DFTSRFILAETERSALEQKLYLVQTERIKLQNRL
F4XV38          -ASDQ-LSQ-----------------DFTSRFILAQTERSALEQKLYLVQTERIKLQNRL
K9UYB2          -ADDQ-ISQ-----------------QLVSSLITSNIERAAIENKLTLVNASVSELRSRL
A0A0C1XJI7      -AGDQ-ISQ-----------------DLTSKLLANETERSAIENKLKTVQAQRTQLQSRL
A0A218QN17      -AGDQ-ISQ-----------------ELTSKLLANETERSAIENKLTTVKAQRTQLQVQI
K9RKN2          -ASDE-ISQ-----------------ELTSKLITNEIERLAVERKLAVVRAQTADLKARV
A0A2I8ADV2      -ASDQ-ISQ-----------------NLTTQLINNEVERVAVENKLQTVQSLRKNLQAQL
A0A1W5CKM3      -SNDQ-ISQ-----------------TLISDLITNDITRLAVENKLNAIQKMRANIQSRL
Q3MEW0          -SNDQ-ISQ-----------------TLISDLITNDITRLAVENKLNAIQKMRANIQSRL
A0A1Z4KIC7      -ANDQ-ISQ-----------------TLISDLITNDITRLAVENKLNAIQKMRANIQSRL
Q8YSM5          -ANDQ-ISQ-----------------TLISDLITNDITRLAVENKLNAIQKMRANIQSRL
A0A1Q4S1H4      -SNDT-LSQ-----------------TLNSQLVTNTVEGTAVANKLRTLQAERVRLQNRL
A0A433VBU6      -SNDN-LSQ-----------------TLNSQLVTNTVEGTAIANKLRTLQAERVKLQTRL
A0A1Q4RZJ6      -AGDP-ISQ-----------------DLTSQLITNEIERAAVAEKLQLTQNNIAQLRNRL
A0A1Z4SNV3      -AGDA-ISQ-----------------DLTSKLITNEIERAAITDKLRVTQNNIAQLRNRL
A0A2H2XJQ1      -AGDA-ISQ-----------------DLTSKLITNEIERAAITDKLRVTQNNIAQLRNRL
A0A3S5K358      -AGDP-ISQ-----------------DLTSQLITNEIERAAVAQKLQLTQNNIAQLRNRL
A0A0T7BPJ4      -ASDD-LTK-----------------DLTAQLITNQTESLAVQKKLRVIQAERANLQARL
A0A0C1QS61      -AADQ-VSQ-----------------NFSAQLIANDIERTAVENKLKSVQTQRANLQLRL
A0A139X3R8      -AADQ-VSQ-----------------NFSAQLIANDIERTAVENKLKSVQAQRANLQTRF
A0A1Z4I7C5      -ANDQ-ISQ-----------------NLISELITNDITRLAVENRLNAIRQMRADIQRRL
A0A0C2MDK7      -AGDQ-LSQ-----------------ELNSKFILNRIEESAVKERLTLLQKKEADLQNRL
A0A1Y0RCK1      -AGDQ-LSQ-----------------DLNSKFIVNRIEESAVNDRLKLLQTKKVNLQARL
A0A1Z4PWZ0      -AGDQ-LSQ-----------------ELNSKFILNRIEESAVNDRLKLLQTTKTDLQKRL
A0A0C2QLT0      -AGDQ-LSQ-----------------ELNSKFILNSIEESAVNNRLKLLQVKKANLQARL
A0A1Z4J2K1      -AGDQ-LSQ-----------------ELNSKFILNSIEESAVNNRLKLLQVKKANLQARL
A0A3S0ZSX0      -ASDR-ISQ-----------------DLTSQLLVNDVERTAVENKLRVVQANRANLQTRL
A0A2N6K4T3      -AGDQ-ISQ-----------------DLTSQLIINDVERLAVENKLKVVQTNRANLQARL
A0A370CKT2      -AGDQ-ISQ-----------------DLTSQLIINDVERLALENKLKVVQTNRANLQTRL
A0A0S3TL97      -AGDQ-ISQ-----------------DLTSQLIINDVERLAQENKLKVVQTNRANLQTRL
A0A2N6M8A0      -AGDQ-ISQ-----------------DLTSQLIINDVERLALENKLKLVQTNRANLQTRL
A0A2N6M9E1      -AGDQ-ISQ-----------------DLTSQLIINDVERLALENKLKVVQTNRANLQARL
A0A2N6KJI4      -AGDQ-ISQ-----------------DLTSQLIINDVERLALENKLKVVQTNRANLQARL
A0A2N6MZ77      -AGDQ-ISQ-----------------DLTSQLIINDVERLALENKLKVVQTNRANLQARL
A0A2N6KT20      -AGDQ-ISQ-----------------DLTSQLIINDVERLALENKLKVVQTNRANLQTRL
G6FSN3          -AGDQ-ISQ-----------------DLTSQLIINDVERLALENKLKVVQTNRANLQTRL
A0A0D6YL98      -AGDK-ISQ-----------------DLTSELIINDVERLAVEKKFRSVQANRNNLQARL
A0A328I8B9      -AGDK-ISQ-----------------DLTSELIVNDVERLAVEKKFRSVQANRNNLQARL
A0A0M0SU69      -AGDQ-ISQ-----------------DLTSQLIVNDVERLAVEKRFRSVQAHRANLQARL
A0A1Z4TIZ8      -AGDK-ISQ-----------------DLTSQLIVNDVERLAIENKFRSVQANRANLQTRL
A0A318BG22      -ALNQ---------------------------------ERALQVQLDQLKGSVSDLQTR-
A0A2T1E9V8      -QVGS-IQQ-----------------DLITTLTKLEIDRLGLITQKTTLLKQQAFYQKKA
A0A0P1C0L3      -KAASTRER-----------------EIRKKLEEAKNKFLGQQT----------------
A0A3M2GQQ6      -GSGA-IKE-----------------SLATQLLQVETEMSAGLSQLARIRQAQQDVAIQF
K9SGJ5          ------IQQ-----------------NLAGALFETQTTMAVQAAQMGSVKLAQERVSAIF
L8MYT6          ------IQQ-----------------NLASQLFDAQTNLAVSQAQLESIRNAQSEVAAVF
A0A352JGJ6      ------IQQ-----------------TLATQLFEAQTSLAVNQAQLESIRGAQSEVAKAF
A0A1J5GLS2      ------IQQ-----------------TLATQLFETQTNLAVSEAQLASIRSAQSEVSRAF
A0A2W4W6M5      ------IQQ-----------------NLATQLFEAQTTLAVSQAQLESIRNAQAEVSSAF
A0A2W7AN33      ------IQQ-----------------NLASQLFDAQTTLAVSQAQLQSIRNAQSEVSKAF
A0A256BLV2      ------IQQ-----------------NLASQLFDAQTTLAVSQAQLESIRNAQSEVATAF
A0A2W6ZXF3      ------IQQ-----------------GLATQLFETQTTLAVSEAQLESIRSAQSEVSRAF
A0A2Z5WX66      ------IQQ-----------------TLATQLFETQTSLAVSQAQLESIRSAQAEVAKAF
K9W1T3          -PLADGVQQ-----------------SLITDFARASAERASLEKQIYALANVEAAYRERI
A0A0D6YBN8      -----------------------------SEYNQAASRENALRARVERLKSSYLDLRRR-
A0A318BJ18      -----------------------------AEYREAVQRENALQARVNQLKASYLDNRRR-
A0A1Q4RTR1      -NLDS-LKQ-----------------NLIAELVKLEVERTGLSNRISTLSNALTLYKQRA
A0A1Z4SQV2      -QIDP-LKQ-----------------NLIAELVKLEVERTGLSNRVSTLGNAFTLYKQRA
A0A2H2XGN1      -QIDP-LKQ-----------------NLIAELVKLEVERTGLSNRVSTLGNAFTLYKQRA
A0A433UXH8      -QIDP-LKQ-----------------NLTAELVKLEVERTGLSNRVATLGNAFNLYKQRA
A0A1Z4RMB9      -EGQDGTKE-----------------NQLERFITLKIDELSRQRQVESLYQSQQEYLKRA
D5A466          -RVMD-VKN-----------------NKIEEFVNAEIRRMDLTKQLDSLYEARDGLERRA
K1XF69          -RVMD-VKN-----------------NKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRA
B5W297          -RVMD-VKN-----------------NKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRA
H1W7M8          -RVMD-VKN-----------------NKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRA
B4WP72          -QLGE-LQQ-----------------SLIELYLQLEVDRVGLSQRVSELSDLQGVYRRRA
A0A318B4H2      -EGGR-SRS-----------------DAEAALRAAQSKEAQFREQVANLTKNFNTQRTNL
B4WQE3          -REGVRVQE-----------------QLASRIRELNARDQALRESIATL-------DEQI
A0A2K3BR24      -QLSS-LKI-----------------DLVGDLVKAQINYLAQKSRIKGLKAEKADYQARA
K9YXY1          -QLSS-LKI-----------------GLVGDLVKAQINYLAQKSRIKGLKAEKADYQARA
A0A2P8W4F7      -GYKGSVSQ-----------------GLMQQLVNTANQMQVLQTQDQAIGQVVQQLQAEI
U5QJM6          -RYGE-LRV-----------------SLAGDLVKAENLYLVQSARVTGLEAAKERLLGKF
A0A1U7HGH0      -QVGQ-IQQ-----------------DLISDLIAAEIERQGLISQQATLTQQQKAYLQKA
K9XJD3          -QVGE-IQQ-----------------ELISDLIAAEVERQGLISQQATLTQQQEAYLQKA
K9SX01          -QIGG-AQL-----------------ELITQLVTKEIERVGLEKQIATINDSFIEYQKRL
A0A1E5QIR9      -QMGQ-LQL-----------------DLMQQLVNSEVDRLVVNSQLNELLNEYAIHKQRA
A0A1Z4IBC7      -QVGQ-LRQ-----------------SLIADITRAEAQRVGLERQITTLIQQRDAYIKRA
A0A1W5CPC7      -QVGQ-LKQ-----------------SIIADITRAESQRVGLERQISTLLQQREAYIKRA
Q3MDC6          -QVGQ-LKQ-----------------SIIADITRAESQRVGLERQISTLLQQREAYIKRA
A0A1Z4KM73      -QVGQ-LKQ-----------------SLIADITRAESQRVGLERQISTLLQQREAYIKRA
Q8YNX7          -QVGQ-LKQ-----------------SLIADITRAESQRVGLERQISTLLQQREAYIKRA
A0A367R4K6      -QVGQ-LRQ-----------------SLIADITRAEAQGVGLERQINTLLQQRYAYARRA
A0A1E2WSV8      -QVGQ-LRQ-----------------SLIADITRAQAERVGLERQIGTLLRQQDAYIKRA
A0A2R5FRT9      -QVGQ-LRQ-----------------SLIADITRAQAERVGLERQIATLVRQQEAYIKRA
A0A2K8T1B6      -QVGQ-LRQ-----------------SLIADITRAQAERVGLERQIATLLRQQDAYIKRA
A0A235I9I0      -QVGQ-LRQ-----------------SLIADITRAQAERVGLERQIATLKEQQNAYIKRA
A0A2D0HQT8      -QVGQ-LRQ-----------------SLIADITRAQAERVGLERQIATLKQQQNAYIKRA
A0A2L2NU95      -QVGQ-LRQ-----------------SLIADITRAQAERVGLERQIATLKQQQNAYIKRA
A0A367S084      -QVGQ-LRQ-----------------SLIADITRAQAERVGLERQIATLKQQQNAYIKRA
A0A0V7ZFJ4      -QIGE-IKQ-----------------NLTAELVKSEVERLAAANRVGILRKNFITQQGRL
A0A0V7ZNJ9      -QVGE-IKQ-----------------TLTSELLKSEVERLAVAKQVGVLRKAFALQQARL
A0A367RIS1      -QIGE-LKQ-----------------TLTANLVQVEVERLGLENQVGVLMKAFVLYQARL
A0A235IXQ2      -QIGE-LKQ-----------------TLTANLVQVEVEKLGLKNQVSVLMKAFLLYQARL
A0A1W5CNX3      -QIGE-LKQ-----------------TLTANLVQVEVERLGLENQVGVLMKAFVLYQARL
Q3MEB7          -QIGE-LKQ-----------------TLTANLVQVEVERLGLENQVGVLMKAFVLYQARL
A0A1Z4KHN9      -QIGE-LKQ-----------------ALTANLVQVEVERLGLENQVGVLMKAFVLYQARL
Q8YT70          -QIGE-LKQ-----------------ALTANLVQVEVERLGLENQVGVLMKAFVLYQARL
A0A218Q4C1      -QIGE-LKQ-----------------ALTANLVQVEVERLGLENQVDVLTQAFTFDQVRL
A0A166IWU6      -QIGE-LKQ-----------------ALTANLVQVEVERLGLENQVGVLTNAFKQDRARL
A0A2S0Q8C0      -QIGE-LKQ-----------------ALTANLVQVEVERLGLENQVGVLTNAFKQDRARL
W6FSX4          -QIGE-LKQ-----------------ALTANLVQVEVERLGLENQVGVLTNAFKQDRARL
A0A1B7WTD1      -QIGE-LKQ-----------------ALTQDLVKSEVERLALTNQVGELRKVFMVNKSRL
A0A1B7WX82      -QIGE-LKQ-----------------SLTEALVKSEVERLALTNKIGELQRVFIVNRRRL
A0A0R0M9H9      -QIGE-LKQ-----------------GLTQDLVRSEVERLALANQVKALQSVFIINRRRL
A0A1S1ZVW2      -QIGE-LKQ-----------------ALTQDLVRSEVERLALANQVKALQSVFIINKRRL
A0A1Z4LRU5      -QIGE-LKQ-----------------SLTAELIKSEVERLAATNRVGLLRKAFVSNQARL
A0A1Z4JVB4      -QIGD-LKQ-----------------NLSQDLVKAEVERLALANRVMELQRAYLLNKRRL
K9PIA4          -QMGK-LKQ-----------------TLTTDLVKSEVERLALARQLADLQQTFILSQKRL
A0A1Z4M597      -QIGN-LKQ-----------------TLTENLVKSEVERLALTNQVAELKQVLLVNKNRL
A0A1Z4MWT1      -QIGN-LKQ-----------------TLTENLVKSEVERLALTNQVAELQQVLIVNKNRL
A0A1Z4TX53      -QIGN-LKQ-----------------TLTENLVKSEVERLALTNQVAELQQVLIVNKNRL
A0A1Z4HVE1      -QIGQ-LKQ-----------------ILSQDLVKAEVERLALAKRVAELRQAYLINQRRL
A0A252ECZ1      -QIGK-LKQ-----------------NLTEELVKSEVNRLAITNRLAELRQVYIVNQRRL
A0A1Z4G5Y1      -QIGV-LKQ-----------------NLTEALVKSEVDRLAFTNRVATLRQVYLTNQRRL
A0A252DNA2      -QIGK-LKQ-----------------NLTEELVKSEVDRLAVANRLAELRQVYVVNQRRL
A0A252E1Q4      -QIGK-LKQ-----------------NLTEELVKSEVDRLAVANRLAELRQVYVVNQRRL
A0A2A2TNQ5      -QIGE-LKQ-----------------SLTGELVKSEVERLAALQRVQVLRNAYITYETRM
A0A3S1C4K5      -QIGQ-LKQ-----------------TLTLDLVKSEVDRLAVNNQVQVLQTAYLNYQGRL
A0A1X4G3D5      -YMPS-LKQ-----------------GLTEELVKSEIEKLTLSSNINALQNVLSIYKRRL
D4TNI2          -YMPD-LKQ-----------------GLTEELVKSEIEKLTLSSNINALQNVLSIYKRRL
A0A1Z4H6Z8      -QIGE-LKQ-----------------TLSEDLVKSEVEGLALQNRVAELRKAFIINKSRL
A0A1Z4NPM1      -QIGQ-LKQ-----------------SLTADLVRAEADRLAAEQQVQVLSRALTDYQNRL
A0A3F3KPR9      -QIGE-LKQ-----------------GLTQDLVRSEVERLALANQVKALQSVFIINKRRL
D4TGN7          -QIGE-LKQ-----------------GLTQDLVRSEVERLALANQVKALQSVFIINKRRL
A0A1Z4UZW9      -HIGE-LKQ-----------------SLTQDLVKSEVERLALTKQVEELQRVFIVNRRRL
A0A0K2M5H0      -QIGE-LKQ-----------------ALTQDLVKSEVERLALTKQIEELQRVFIVNRRRL
A0A1B7VSH4      -QIGE-LKQ-----------------TLTQDLVKSEVERLALTKQVEELQRVFIFNRRRL
A0A1B7W126      -QIGE-LKQ-----------------TLTQDLVKSEVERLALTKQVEELQRVFIFNRRRL
A0A3D4C6Q6      -QIGE-LKQ-----------------TLTQDLVKSEVERLALTKQVEELQRVFIFNRRRL
K7W0A4          -QVGE-LKQ-----------------ALTQDLVKSEVERLALTNQIGELRKVFIINRRRL
A0A1B7UTR1      -QVGE-LKQ-----------------ALTQDLVKSEVERLALTNQIGELRKVFIINRRRL
A0A1B7UVJ4      -QIGE-LKQ-----------------SLTQELVKSEVERLALTNKIGELQRVFIVKRRRL
A0A2T1CIL7      -SDGA-SEQ-----------------KMVAEYANLGVERSGLLGKLAELESNLQVRQQNL
A0A1Z4RPC6      -QAG-NVRE-----------------NQLERFISLKIDELSLQTELASLYKYQQVYLDRA
A0A2T1CMZ0      -QSD-NLKD-----------------NQIEKFINLKIEELSLQTELSSLYQYQQVYLNRA
L8M4F7          -KNN-QYAP-----------------GQLEKFIELKIQELSLRRQNLALAQAQQIASKRA
L8LZE9          -QSDLGQKE-----------------NPLERFISLKIDELSLQQQFASMNDYQQAYLQRA
A0A140K2P2      -NND-GLKE-----------------NQLEKFITLEIDKINQQRQLSSLYQTQESYLERA
K9XWX4          -NND-GLKE-----------------NQLEKFITLEIDKINQQRQLSSLYQTQQSYLERA
A0A140KB14      -RSD-GNKE-----------------NQLEKYISLEIDRISQQRQLASLYQSQQAYLQRA
K9XX88          -RSD-GNKE-----------------NPLEKYISLEIDRISQQRQLASLSQSQQAYLQRA
A0A433V7A0      -QFGE-THQ-----------------KLLEELVKTQAKNLSLSSRLTSLENAKVRSQRRV
A0A0C2LBE2      -QNGS-LRQ-----------------KLLEDYAGTEAQRVGLVKQIATLSNQRTVYKERA
A0A433NN38      -QIGG-VRQ-----------------NLIQDLANTEKVRLGLEKQIADLNNTLFEYKQRA
A0A2N6K0T2      -QMGE-VRQ-----------------RLIEDLANTEKERVGLERRIAELTNTWSVYKQRA
A0A2N6ML72      -QMGE-VRQ-----------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRA
G6FQZ6          -QMGE-VRQ-----------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRA
A0A2N6MQX9      -QMGE-VRQ-----------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRA
A0A2N6KXT6      -QMGE-VRQ-----------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRA
A0A2N6KGB9      -QMGE-VRQ-----------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRA
A0A2N6L3Y5      -QMGE-VRQ-----------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRA
A0A0S3TIS7      -QMGE-VRQ-----------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRA
A0A1U7GW28      -QMGE-VRQ-----------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRA
A0A2N6LW63      -QMGE-VRQ-----------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRA
A0A1Z4TQ63      -QMGE-VRQ-----------------KLIEDLANTDKERAGLEKRLADLRNTWSLYKQRA
A0A0D6YFE2      -QMGE-VRQ-----------------KLIEDLANTDKERAGLEQRIADLRNTWSLYKQRA
A0A328IH74      -QMGE-VRQ-----------------KLIEDLANTDKERAGLEKRIADLRNTWSLYKQRA
A0A1Z4NDS1      -QLGD-LRQ-----------------KLMEDYARAEAERSGLARQLVSLQKQWLTYKQRA
K9F4D9          -QSGQ-LEQ-----------------DLIAEYLRLDGATSGLQQQVEELTTARLGQQSRA
U9VXM0          -QSGD-LEQ-----------------ELIAEYLRLDGEQSGLQQQVEQLANARLSQQSRA
A0A2T1FTR8      -QPSG-IQG-----------------NLIADYAKSEAQRTSLQKQIAALVYVVDAYKQRM
K9UA41          -QPSG-IQG-----------------NLIADYAKSEAQRTSLQKQIAALVYVVDAYKQRM
A0A1Z4SMD6      -QIGQ-IKQ-----------------NLASQLSQLQTQRQGLEKKILALSNIRDSYKQRL
A0A2H2Y096      -QIGQ-IKQ-----------------NLASQLSQLQTQRQGLEKKILALSNIRDSYKQRL
K9S8M8          -QSGE-LHR-----------------TLTNNLVETENQRRGLREQVTALRESQVQYQQRA
A0A1Z4NFV0      -EVQG-LRE-----------------KLLNEYVQLQAQQAGLASRVQELSNLHRIYRQRT
B0CAX4          -QAGE-SRQ-----------------SLTDALVEAEVERLGLEKQVLSLAQTQAENKRRQ
U5DPF5          -QLSE-VEI-----------------QLTGDLVRAEVDRLGTSSRLSSLQREREAYQSRA
A0A350Y0P6      -QSNE-FQQ-----------------QMMATLVNAEAERLSLAQRVASLEQTKLTYKRRA
A0A352X940      -QIGD-LKE-----------------SMTKDLVKAEVERLGFVRQAAYLERAKLAYQQRA
B8HTN4          -QTGA-SEQ-----------------QLVDNFINAEVERLALSSQVTSLSRTEQTYQQRM
A0A2A2TPF8      -QLGA-LKE-----------------QLLGESVRLQAQRLGFENKVQTLTNLHQEYKKRA
A0A1Z4R0P8      -QLGG-LKE-----------------QLVGESVRLQAQRLGLANKVQTLTNLHQIYKRRA
A0A0T7BUI3      -QVGK-IRE-----------------DLANQYVQLKTKRQGLQKKIAALQGVQQIYQKRL
A0A1Z4LP32      -QIGD-IKQ-----------------NLVNQLVQLQTQKDGLQNKLATLNNIKNDYQRKL
K9REP9          -QIGE-IKQ-----------------SLVNQLVQVQTQKDGLQTKLQTLTNIRDNYQQKL
A0A1Z4SIJ3      -QVGK-IKQ-----------------DLAVQYLQFQGQRQGLEKKIRAMEAVQANYQQRL
A0A2H2XPG4      -QVGK-IKQ-----------------DLAVQYLQFQGQRQGLEKKIRAMEAVQANYQQRL
K9V3C7          -QIGD-IKQ-----------------DLANQYVSLQSQRAGLEEKVQTLSSLHEAYKRRA
A0A1Z4T6Y7      -QLGQ-LKE-----------------QLVGESVRLQAQRLGLENKVQTLSGLHEQFKQRA
A0A2H2Y561      -QLGQ-LKE-----------------QLVGESVRLQAQRLGLENKVQTLSGLHEQFKQRA
A0A1Q4S362      -QLGQ-LKE-----------------QLVGESVRLQAQRLGLESKVQTLSGIYEQFKQRA
A0A3S1CIN8      -QLGQ-LKE-----------------QLVGESVRLQAQRLGLESKVQTLSGLHQQFRQRA
A0A2A2TC28      -QIGK-IKE-----------------DLASQYVQLLAQRQGLEKKVQTLLNIREGYQRKL
A0A0C1NCB0      -QLGK-IKQ-----------------DMTVEYANLEKKRQGLEEKIKSLSDIRNGYKQRL
A0A2N6K7Q9      -QIGK-IRE-----------------ELTDKYVELKAERQGLEKKIRTLSNIRANYQQQL
A0A2N6MXH6      -QIGK-IRE-----------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQL
A0A2N6M5A8      -QIGK-IRE-----------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQL
A0A2N6LL61      -QIGK-IRE-----------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQL
A0A0S3TP66      -QIGK-IRE-----------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQL
G6FP91          -QIGK-IRE-----------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQL
A0A1U7GYR5      -QIGK-IRE-----------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQL
A0A2N6KY52      -QIGK-IRE-----------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQL
A0A2N6KMP5      -QIGK-IRE-----------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQL
A0A2N6MA45      -QIGK-IRE-----------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQL
A0A1Z4TLC8      -QIGK-IRE-----------------EMVGNYVQLKAERQGLEKKFRTLSNIRANYQQQL
A0A0M0SFT2      -QIGK-IRE-----------------NLVDNYVQLKAERQGLEKKFRTLSNIRANYQQQL
A0A0D6Y7R4      -QIGK-IRE-----------------SLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQL
A0A328IGA1      -QIGK-IRE-----------------SLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQL
A0A0C2LFH0      -QIGK-IKE-----------------NLTTQYALIQAQRQGLENKIQALSNIRGTYKQRL
A0A1Z4IYV4      -QVGK-IKE-----------------NLTSEFAKIQAQRQGLESKIQALSNIQASYKQRL
A0A1Z4Q0T6      -QVGK-IKE-----------------NLTSEFARIQAQRQGLESKIQALSNIQASYKQRL
A0A0C2PT44      -QVAK-IKE-----------------NLTSEFAKIQAQRQGLESKIQALSKIQASYKERL
A0A1D2P6J4      -QIGK-IKE-----------------NLTSEFAKVQAQRQGLESKIEALSNIQASYKQRL
A0A3M9ZEU1      -QLGT-LRE-----------------TLTANLIDAEVERISLLGQTQTLRNTLSAYRQRA
A0A1Z4JK72      -QVGD-IKR-----------------KLAESLATLQSQKLGLEGRVGTLAGLQSSFRSRM
A0A0N7Z489      -QVGD-IKR-----------------NLAAALSTLQSQRAGLEGRITTLSGLLINYSSRA
A0A0S3TXS2      -QVGD-IKR-----------------NLAAALSTLQSQRIGLEGRISTLAGLLANYRSRA
A0A1Z4RN12      -SLGE-LKQ-----------------SQLAEFAELGLQKEGLDKRLASLRSNYNNYQQRS
A0A2T1CMF9      -RLGE-LKQ-----------------GQLTEFADLGLRKEGLEQRLASLKNSYNNYQKRS
Q7NDC5          -RLDA-VRQ-----------------QLLKDLIAARVEELAARTRTEALARVSAEYDARV
U5QGK3          -RLDL-VRQ-----------------KLLKDLVDARVEELAARTRTDALNSVSERYSSQV
A0A2W4UY24      -QAGE-LEQ-----------------SLILSFLQLDAERAGLQQRLNQLTSAQAAQQSRA
A0A254WLE3      -QIGE-SKQ-----------------KLTEAYIQLEVERLGLASRLASLSGEYKLYKQRA
A0A433W533      -QIGE-SKQ-----------------KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRA
A0A2P8QWJ3      -QIGE-SKQ-----------------KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRA
A0A2T1FKP8      -QIGE-SKQ-----------------KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRA
K9U6L7          -QIGE-SKQ-----------------KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRA
A0A2T1GMT4      -KIGD-LKQ-----------------NLITELLRSQVQQTGLVNKLNSLQSSRAAYEKRV
K9UI51          -KIGD-LKQ-----------------NLITELLRSQVQQTGLVNKLNSLQSSRAAYEKRV
K9TYI2          -QIGE-LRQ-----------------DLIENLLQSDVQRRSLAQKLASLSNSRSTYEQRK
A0A254W5G5      -QIGE-LRQ-----------------DLIRTLLQSDVQRRSLAQKLASLSNSRSTYEQRK
A0A2T1FXY4      -QIGE-LRQ-----------------DLIENLLQSDVQRRSLAQKLASLSNSRSTYEQRK
A0A1Z4QL41      -QIGE-LRQ-----------------KLIQDFLQSEVQRIGLAKRLASLYNSRSAYEQRT
A0A252D4T4      -QIGP-TKQ-----------------DLIKEFLQSEVQRQGLAQKLNSLYNSRSIYEQRV
A0A252DJH5      -QIGP-TKQ-----------------DLIKEFLQSEVQRQGLAQKLNSLYNSRSIYEQRV
A0A252EB80      -QIGE-TKQ-----------------NLIRDFLQSEVQRQGLAQKLSSLYNSRSTYEQRV
A0A1Z4HPW5      -QIGE-TKQ-----------------NLIREFLQSDVQRRGLEQKLTSLYNSRSVYEQRV
A0A1Z4MSN1      -QIGE-TKQ-----------------NLIRDFLQSDVQRRGLEQKLTSLYNSRSVYEQRV
A0A1Z4U1C2      -QIGE-TKQ-----------------NLIRDFLQSDVQRRGLEQKLTSLYNSRSVYEQRV
A0A0D6KV51      -QIGE-TKQ-----------------NLIRDFLQSEVQRRGLEQKLTSLYNSRSVYEQRV
A0A1Z4MKF8      -QIGE-TKQ-----------------NLIRDFLQSEVQRRGLEQKLTSLYNSRSVYEQRV
A0A2C6WC43      -QIGE-LRQ-----------------TLIQDFLQSEVQRFGLSQRLASLYNSRTNYQKRV
A0A1Z4L5A1      -QIGE-LRQ-----------------NLIRDFLQSEVQRFGLSQRLASLYNSRSNYQKRV
A0A367QD86      -QIGE-LRQ-----------------NLIQDFLQSEVQRYGLSQRLASLYNSRSNYQKRV
A0A235IZ96      -QIGE-LRQ-----------------GLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRV
A0A2L2NGP0      -QIGE-LRQ-----------------GLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRV
A0A2K8SM78      -QIGE-LRQ-----------------NLIQNFLQSEIQRFGLAKRLSSLSNSRSTYEQRV
A0A2R5FPC0      -QIGD-LRQ-----------------NLIQSFLQSEIQRFGLAKRLSSLSNSRFTYEQRV
K9QM62          -QIGE-LQQ-----------------GLITDFLRSEVQRLGLAQRLTSLSNSRATYEQRM
A0A1Z4FWI3      -QIGE-TKQ-----------------NLINTFLQAEVQRQGLAQKLTSLYNSRGAYEKRV
A0A1Z4JYE7      -QIGE-VRQ-----------------NLINNFLQLELQSTGLNQKLNSLLNTRSAHEKRM
A0A140KBA0      -GLGR-LKQ-----------------EQISEFASLGLKKTGLEQKLANLKQTKTDYQQRL
K9XSG1          -GLGK-LKQ-----------------EQISEFANLGLQKTGLEQKLANLKQTKTNYQQRL
A0A0F5YE28      -QVPQGQKN-----------------NQLERFIANEIQRVELTRQLDSLYASRINYEQRS
U7QEH7          -QVPQGQKN-----------------NQLERFIANEIQRVELTRQLESLYTSRRNYEQRS
A0A3S1ATK5      GQAGE-IRQ-----------------KFIQDFLQVEVQRIGLSKRLASLYNSRSGYQRRV
A0A2Z6CPH0      -QIGE-LRQ-----------------NLIQNFLQLEVQSFGFKQRLASLYNSRSVYERRM
A0A1Z4GT50      -QIGE-LKQ-----------------NLIKDFLQSEVQRNGLTKKLASLYNSRSAYEQRL
A0A1Z4GIX0      -QIGE-LRQ-----------------TLIQNFLQLEVQRFGLTNRLASLYNSRSAYERRM
A0A2H6LC24      -QIGE-LRQ-----------------TLIQNFLQLEVQRFGLTNRLASLYNSRSAYGRRM
B2J6N5          -QIGG-LKQ-----------------NLIQNFLQSEIQRIGLAKRLSSLYNSRSIYEKRV
A0A367RMI4      -QIGE-LRQ-----------------SLIQNFLQSEIQRFGLTQRLSSLYNSRVSYEQRV
A0A235HUM0      -QIGE-LRQ-----------------SLIQNFLQSEIQRFGLTQRLSSLYNSRVSYEQRV
A0A2L2NW47      -QIGE-LRQ-----------------SLIQNFLQSEIQRFGLTQRLSSLYNSRVKYEQRV
A0A1E2WUR1      -QIGE-LRQ-----------------NLIQNFLQSEIQRFGLTQRLSSLYNSRSTYEQRV
A0A235IKU3      -QIGE-LRQ-----------------GLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRV
F4XKF3          -EVDQ-LKQ-----------------KLINDFIESEVKRQSLAEGLSTLAKARIAYEQRV
A0A1D9FX10      -EVDE-LKQ-----------------KLINDFIESEVKRQSLAEGLSTLAKARIAYEQRV
A0A1D8TNX9      -EVDQ-LKQ-----------------KLINDFIESEVKRQSLAEGLATLAKARIGYEQRV
A0A1U7MYU6      -EVDQ-LKQ-----------------KLISDFIESEVKRRSLAEGLATLAKARIAYEQRV
A0A3C0NJ41      -QIGQ-FKE-----------------QLTSDFVKAEVERLGLANRLTQLSNTRSAYKQRL
A0A352AG88      -QMGD-FRQ-----------------ELTLNLVNAEVERLGLASQLNELENVRLAYQQRL
A0A350Y374      -QIGE-FKN-----------------QLIKDFVNSEVNRLGLKSKLDQLTNSRLIYKQRL
A0A355DPX0      -QIGE-FKN-----------------QLIKDFVNSEVNRLGLKSKLDQLTNARLIYKQRL
A0A0D8ZUV2      -QIGE-SKQ-----------------KLNEELVQSEAERLGLAKQLALLSSTQDTYKQRA
A0A433VDI0      -QIGE-SQQ-----------------KLNEALVKLEEERSGLTSQLAELSNAQATYKQRV
A0A3D1PG43      -QMGA-LKQ-----------------KLTEDFATSEVERLSLSSRLAYLSKNLSAYKQRA
A0A2P8QQ72      -EAGE-LQQ-----------------KLAEDLVRAEVERLSLSNRLKFLAQARTNYRQRA
K9TZQ7          -EAGE-LQQ-----------------KLAEDLVRAEVERLSLSNRLKFLAQARTNYRQRA
A0A2G7GPR0      -QMGE-IRQ-----------------ELTQNYVNSEIQRLGLTSRLSSLNNTYSAYRQRI
K9XH68          -QMGE-IRQ-----------------ELTQNYVNSEIQRLGLTSRLNSLNNTYNAYRQRV
A0A1U7HW70      -QMGE-IRQ-----------------ELTQNYVNSEIQRLGLTSRLNSLNNTYNAYRQRV
A0A2S6VEJ8      -QMGQ-IRQ-----------------ELTQNYVNSEIQRLGLVSRLNSLNNTYNAYRQRA
                                                                            

K9SLA9          DSLPKIEQQQSQLERDLTLARVNYDHLLQQQTSLRSQLRQISAGARIVSPATIP--TN--
A0A168TT23      LALNQQGVQYNILRREFETNRELYDGMLQRLKEIGVAAGAQENNIAVIDSALRP--GY--
A0A0M1JWX9      EQFPIVIRQYTDLMRELEVASQTLNQLLAQREQLRLEAAQSETPWEIIALPEIPRNEDGE
A0A2T1M1V6      KFIAKNQGILIELQRKYEIAEGVYKGIIAQLSQNKINAFDAYPNVQLIDGPSLN--PK--
A0A2G7GCS2      NSITQNRSQLINLQRQYEIAEGVYKSILGQVEQTKTNPFSVYPNVQTLDAPVID--PK--
K9XBH8          NNITKNRAQLLDLQRRYEIAEGVYKSIIAQVEQAKTNPFNVYPNVQTLDAPTID--PK--
A0A1Z4LJ30      NGLPQKQATLLELQRQYDIAEGVYNGVVAQAEQAKLGSFSAYPSVQVLDQPIMD--TK--
K9RI76          NSLPQKQAKLLELQRQYDIAEGVYNGVVAQIEQAKLGAFSAYPSVQVLDKPMVD--NK--
A0A352AE27      KLIPGHQAKLLELKRQYEVAEGVYKGLVAQIQKVNIDAFNAYPNVQVLDPPTVS--SN--
A0A3B8JH60      KALPGNQARVLELQRQVDVAEGVYKGLVAQVQKNNIDAFNTYPNVQVLDSPTVD--PK--
A0A3C0N766      KALPGNQARVLELQRQVDVAEGVYKGLVAQVQKNNIDAFNTYPNVQVLDSPTVD--PK--
K9W9J7          RTFPANQSRLLELQRQVDVAEGIYKGLVAQVQQNNIDAFDTYPNVQVLDPAKVD--SK--
A0A139WSU3      KSFPVNQARLVELQRQVDVTEGVYKGLIAQIQQSNIDAFDAYPNIQVLDAPQVD--PK--
A0A433VN22      NSLPAKQAQLLELQRQLDVAEGIYKGLVAQVQQKSVDAFDAYPNVQVLDPPRVN--SK--
Q7NF11          SAISTRQATLLDLQRRYELAEAAYKAIVAQMQQARLSAFNAFPDIEVLDKAYSN--PK--
A0A1Z4JCS8      NQLPANQAKLNALQRQADVAEGVYKGLVAQTQQSNIDAFNAYPNIQELNAPFVD--AK--
F4XTX2          TVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVD--EK--
Q7NJN6          RTLAPQQSRLKELQRRYEIAEGIYRGLVAQVQQAKVNAFDAYPNVQILDAPSVD--SK--
U5QCC3          RTMAPQQSKLLELNRRYGIAEGVYKAMLAQVQQAKINAFDTYPNVQVLDPPAVD--PK--
A0A0S3TYD7      STLPRLSTRQAELERRLRASQSTYESLLSKLQEIQVAEQQQLGNARITSKALIP--EK--
U5QL42          KKIPQLQQQYTELQRDYNVNSQIVNGLLTKLEELRITEAQETSPWRVLEPPDLP--DT--
K9QF04          QQFAGIARQYADLSRDLEIANQSLNRFLVAKENLQIETARKVPPWQVISRIEAP--NK--
A0A3C0N2P0      TALPDIARRYTDLQQQLKVATESLGRFLTVQETLQVEKARTSTSWKKISGPQKP--QA--
K9TLQ0          QEQATLMRQYTDLQRELELGTESLNRFLAVRENLQIESAQKAMPWQLISQPEVG--TV--
A0A076HBF2      LQQPGLIKQYEALQQRLEIAKQNLAGLVSAREKFQLEIAQRSVPWRVIAEPTIN--PK--
A0A354B169      LRQPALIKQFTDIMQDLKIAEENLAGLVSARENFQLEMAQRSVPWRVIAPPQIN--PR--
G4FMX5          LKQPALIKQYEALQTRLTIANQNLAGLVSARENFQLEIAQRSVPWRVIDPPEIN--PN--
Q0IDT5          LKQPALIKQYETLQTKLTLAQENLSGLVSARETFRLESAQSSVPWRVIDPPEID--PN--
A0A2D6FCW3      LKQPALIKQYEALQTRLKIAQENLTGLVTARENFQLEIAQRSVPWRVIDPPEIN--PN--
A3ZA21          LRQPALIKQYEALQTRLKIAQDNLAGLVSARENFQLEIAQRSVPWRVIDPPKIN--PD--
A0A140K3H3      KQIPQLQQYYAEVKRQFDIKSKAVDYLMQRRQELYIEQAQENAPWQILEAPPLP--SI--
K9XUB8          NSIPQLQQYYAELTRQFEVKSGAVNYLMQRRQELDINKAQENAPWQILEAPRLP--NV--
Q7NEU3          KVVPSLAKRYQELVRDSNLASNSLNRLLERLQELRIQAAQELSPWRVIEPAAIP--EK--
A0A352XE00      KQLPIIARQYTDLQRELKVATESLNRFLAVRETLQIESAQKTLPWQLIAPPQTP--IK--
B4VS56          KNLAVVARQYTDLQRELKVATESLNRFLAVRETLQIEAAQKTLPWQLIAEPQQP--QA--
A0A352AAQ3      KELPIIARRYTDLNRRLNVATESLSRFLAVREKLQIEESQKTPPWQKLSDPQKP--QT--
A0A350Y472      KTLPVIARRYGDLQRRLTVATESLNRFLAVQEKLQIDESQKTPPWQQLSQPQKP--QQ--
A0A355DVB4      KTLPVIARRYGDLQRRLTVATESLNRFLAVQEKLQIDESQKTPPWQQLSQPQKP--QQ--
A0A2P8VVX1      NRYPSLMAEYDRLQPAVDTERSTLQELLIQREQISAELSRGGFSWEVVEPPLPG--QR--
A0A2P8WHY0      NRYPSWIAEYDRLQPRVEIERATLQDLLLQREQISAELARGGFDWQIVEPPDVG--DQ--
A0A2T1CMT9      VGFPELISQYRNLTQESEIKRQAVQRLLEAKQKLEIELSRGGNNWQVIEPPQAG--LQ--
A0A1D8TX52      REFPALIAQYNRLQPQVAIKQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--FK--
A0A1U7N5X9      REFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--LK--
A0A1D9G4T2      REFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--FK--
F4XP71          REFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SK--
A0A2P8QVH5      LKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPG--VY--
A0A2T1FT70      LKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPG--VY--
A0A433W4W4      LKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPG--VY--
K9U5W1          LKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPG--VY--
A0A254WLA7      LKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPG--VY--
A0A2W6ZAV2      ATNPNLVKQYEAIEQRLEIARANLSTYIKTREDFRLEVAQRTRPWRIISPPEFE--DT--
A0A2G7GMH8      QRFPTLLAQYNRLLPEVSVNRETLQQLMTARQELGLQLARGGFDWQVVEQPGIG--EQ--
K9W742          ERFPSVLADYNRLQPEIKLKRETLDQLEKARQELSLEIARGGFDWQVVEQPLLG--EK--
K9SA61          QRFPQLLAEYGRLEPQLQLRRETLQELLKARQELGLEIARGGFDWQVVEEPRTG--NQ--
A0A350Y7Z1      NRLPELMAEYERLQPEVQIRRDTLQKLLEARQELGIEIARGGFKWQVVEPPKPG--KQ--
A0A352X2A7      NTLPQLMARYERMQPEVQLKRDTLQKLMQARQDLGIEIARGGFKWQVVEAPLPG--EQ--
K9XPB0          TQFPALIARYDSLTQEANLKKNALQRLLAAKQELEIALSRGAYNWQVIESPQLG--VQ--
A0A0D8ZYV0      NRFPKLLEEYNRLLPIVQINREKLQQLLRAQQELSLEIARGGFEWQALEQPVLG--LQ--
A0A3D1PBA3      NRFPVLLAEYNRLQPLLQINRNKLQQLLQAQQELSLEIARGGFDWQALEEPKQG--QQ--
A0A254WJ87      KRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--LK--
A0A2T1FP73      KRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--LK--
A0A433VMS2      KRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--LK--
K9TYA7          KRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--LK--
A0A2P8QUE1      KRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--LK--
A0A2T1DWE8      RRFPSLLAEYGRLQPNVQIGRNTLQQLLKARQDIALEIARGGFDWQVVEEPKLG--KQ--
A0A1U7I8L3      QRFPGMLSQYNRLEPEVKLNRDTLEQLLKARQELSLEIARGGFDWQMVEEPQLG--LQ--
A0A2T1DJL8      KRFPSLLAEYNRLQPNVQVNRDTLQQLLKARQDLGLEIARGGFDWQVVEQPKVG--QQ--
A0A1Z4J9W0      QRFPSLLAEYNRLQPLVTLNRDTLDELQKARQDLSLEIARGGFDWQMVEQPKLG--RQ--
A0A0N7Z5K9      QRFPTLLAEYNRLLPTVKLQRDTLDQLEKARQGLGLEIARGGFDWQIVEQAKVG--RQ--
A0A0S3TXC5      QRFPTLLAEYNRLLPTVKLQRDTLDQLEKARQELGLEIARGGFDWQVVEQSKVG--RQ--
A0A2T1DNG3      QRFPQLLAQYERLKPDIELNRDTLKQLLKAQQDLGLEIARGGFAWQVVEQAQI---GA--
A0A2P8W9H0      NRLSTVTRQYNALQRELEIATTNLNQFLTKREALRIDAAQRQTPWEVLTPPSQP---R--
A0A3S0Y9N9      DTIPQLELQQRQLEREISATESSYQTLLARYQELQVAENLQVSNARVITPALIP--TV--
A0A433UNK7      NTLPQLELQQRQLEREIAATDLSYQNLLARYQELQVAENLQVSNARIVTPALIP--GV--
B8HNB0          QALPQLQQQYAELQRQLKVNEDVVGRFMERLQELRIAEAQRTTSWRVLEPAYLP--TA--
A0A1Z4LN32      DVIPDLEKRQKELEQKLSIAQKNYENLETRLQEIKVAESQTVGNASIVESAKVS--PS--
A0A2I8A9F5      GAIPDLEKTHGELEQKMLIAQKNYENLLTKYQEIKIVESQTIGNARILEYAEVD--SS--
A0A218Q6R8      SNLPSLEKRQGELERKLSRAEKNYENLLTRFQDIKIVESQTIGNARVLQYAEIG--SN--
A0A0C1XVC4      DVMPNLEKQQGDLERGLSIAQKSYENLLTRQQEIQVAENQTVGNAKVVEYAKVA--PS--
A0A218QGE0      QVMPNLEKQEGDLERRLSIAQKSYENLLTRQLEIEVAKNQTVGNAKVVEYAKVA--FS--
A0A3B8Y8H9      AQLARLTSEYVDLQRKIEIANQSLTSYLVFQQELELERAKTIYPWRLVSEIRTP--EE--
A0A1Z3HMQ0      QAFPALEKRQLELEQRLLAAKTNYETLLVRLQEAQLAENQTVGSAQILEPAAPP--RF--
A0A1E5QP61      NALPRLEQQQRDLQRQLDAAQSAYQILLRNLQEVRIAENQNVGNARVISYATLP--VN--
A0A3M2GIL5      NVLPRLQEGLRELERKVNAAQSTYEILLKNLQEVQIVENQNVGNARVIASASPP--EF--
A0A433NM31      GIIPQLQQKQRELEREVDAAQSTYATLLKKLEEVRIAENQNVGNAQIVDVGRVA--EE--
A0A3M1PML8      SALPRLEQQQRELERRLNAAQTTYEALLLRLQEIQVAENQNIGNVRVVSPAIVP--DD--
A0A352X442      NSLPRLQEKEKELERRVEATQLTYSQLLQKLDETRLIENQNVGNARIVEAAAVP--EK--
A0A0T7BPZ0      NALPKLAQTQRELERRLKASQTTYETLLTRLQEIHVAENQNMGNARIISTALVP--DK--
A0A0M0SHU3      NILPQLEQTQRELERKLKAAQTTYETLLTRLQEINVAENQNIGNARIISPALVP--DE--
A0A1D2PBN3      NVLPKLEQTQRELERKLKAAQTTYETLLTRLQEIQVAENQNVGNARIISPALIP--DK--
A0A0C2LVR7      NVLPKLEQNQRQLERKLKAAQTTYETLLTRLQEIQVAENQNVGNARIISPALIP--DK--
A0A1Z4PQB9      NVLPKLEQNQRQLERKIKAAQTTYETLLTRLQEIQVAENQNVGNARIISPALIP--DK--
A0A1Z4SFN6      NVLPRLEQIQRQLERKLKASQTTYEALLTRLQEVQVAENQNIGNARIISPALVP--DE--
K9PGI8          NGLPKFEQTQRQLERKLKAAQTTYEALLTKLQEVQVAENQNIGNARIISPALIP--DA--
A0A2W1JVB9      EAIPALEKQLRQLLRDVEISQEIYANLVRKLQEIQVLEQQNLGNARILSPALIP--EE--
A0A3M1SVZ4      NVLPQLEQEERRLERQLELAQATYSQLQQKLQEVRLAESQSLGNASLVSPALVP--DK--
K9SSQ0          AQIPQLQQTYIELQRQLKQASTRLSTLSQKLEEAKSQEVQEATAWQILQSPSLP--SY--
A0A2W1JIN9      QQFPILEQWFTQMDRRREALFNSIQLLERKLDEVRVAEAQLLSNFRILDLSEPS--GK--
A0A318AJV1      ARNTRNSADAERLERDAASARAQFDKMSAMSLESTQAAHAAIAQAQIIDRADPP--VS--
A0A254WHG9      NQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RL--
A0A2P8QIL5      NQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RL--
A0A2T1FLY5      NQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RL--
A0A433W447      NQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RL--
K9U1K8          NQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RL--
A0A1U7N2U4      GQIPVLQQPFGTLVRRQDEAIASLKLLQNKLEEARIAETQLVNNIQIIERAKLP--SS--
A0A1D9G1F2      GQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--SS--
F4XV38          GQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--SS--
K9UYB2          NQLPAQQRPLTALTRKREETATSLKFLQDKLEEARIAEAQKVSNILIIDPAKPA--TI--
A0A0C1XJI7      AKLPLQQQPLIALTREREDATASLKSLQSKLEEARITEAQKVSNLRLIEAAKPP--TI--
A0A218QN17      AKLPIQQKPLIALTREREDATASLKSLQSKLEEARITEAQKVSNLRLIEAAKPP--TI--
K9RKN2          AQLPIKQQPLTALVRQREESASTLKFLQGKLEEARLAQAQKVSNIRIIESATVP--ES--
A0A2I8ADV2      AVLPLRQQPLTMLTRQREEAAESLKLLQSKLEEARIAEAQKVSNLRIIELALVP--TD--
A0A1W5CKM3      ALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--EL--
Q3MEW0          ALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--EL--
A0A1Z4KIC7      ALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--EL--
Q8YSM5          ALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--EL--
A0A1Q4S1H4      AQLPIKQEPLTALTRAREEAAESFKGLQRKLEEARIAEAQKVSNIRIIEVANVP--TL--
A0A433VBU6      AQLPIKQEPLTALTRTREQAAESFKALERKLEEARIAEAQKVSNIRVIEVATVP--TV--
A0A1Q4RZJ6      TQLPLQQQPLTALIRKREEAAASLKFLQAKFEEARIAEAQKVSTLQVIQAAKAA--SI--
A0A1Z4SNV3      TQLPLQQQPLTALVRKREEAAASLKFLQAKFEEARIAEAQKVSNLQVIQVAQPP--TE--
A0A2H2XJQ1      TQLPLQQQPLTALVRKREEAAASLKFLQAKFEEARIAEAQKVSNLQVIQVAQPP--TE--
A0A3S5K358      TQLPLQQQPLTALIRKREEAAASLKFLQAKFEEARIAEAQKVSTLQVIQAAKAA--SF--
A0A0T7BPJ4      GKLPLQQQSVAALTRKREEAAESLKTLQRKLEEARIAEAQKVSNLSIIEFAKPG--TS--
A0A0C1QS61      AQLPIQQQNLTPLTRQREEAAETLKLLQGKYEEARIAEAQQVGNLRIIEEAQPP--TS--
A0A139X3R8      EQLPFKQQQLTPLTRQREEAAETLKLLQSKYEEARIAEAQQVGNIRIIEEALPP--TV--
A0A1Z4I7C5      ALIPIRQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEAQKVSNIRILETAVVP--EL--
A0A0C2MDK7      AQLPIKQQQLTILTRKREEAAASLKFLQGKLEEARLTEAQKVSNIRAIENAVAP--SS--
A0A1Y0RCK1      AQLPIKQQTLTVLTRKREEAAASLKFLQSKLEEARLTEAQKVSNIRVIENAVAP--SS--
A0A1Z4PWZ0      AQLPINQQTLMLLTRKREEAAVSLKFLQSKLEEARLTEAQKVSNIRVIENAVPA--SS--
A0A0C2QLT0      AQLPITQQTLTVLTRKREEAAASLKFLQSKLEEARLTEAQKVSNIRVIENAVAP--SS--
A0A1Z4J2K1      SQLPITQQTLTVLTRKREEAAASLKFLQSKLEEARLTEAQKVSNIRVIENAVAP--SS--
A0A3S0ZSX0      AELPIRQQKLTPLIRQREESAASLKLLQSKLEEARIAEAQLVGNIQIIEAAQIP--LK--
A0A2N6K4T3      AQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TK--
A0A370CKT2      AQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQ--
A0A0S3TL97      AQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TK--
A0A2N6M8A0      AQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KK--
A0A2N6M9E1      AQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQ--
A0A2N6KJI4      AQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TK--
A0A2N6MZ77      AQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TK--
A0A2N6KT20      AQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQ--
G6FSN3          AQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQ--
A0A0D6YL98      AQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KK--
A0A328I8B9      AQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KK--
A0A0M0SU69      AQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KE--
A0A1Z4TIZ8      AQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KE--
A0A318BG22      ------SIQYMILQREVDTNRALYDALLQRFKEIGVAGGSGANNVSVIDTARAP--GA--
A0A2T1E9V8      ATLPELQQQQGELERQLLASQSTYETLLKSLQEIKVKENRTVGNVQIVEYAEIP--VV--
A0A0P1C0L3      -----LTIQYGILKREVETNRQIYDALLQRYKELGAAGAGQ-NNIKLIDKADAP--LF--
A0A3M2GQQ6      ENIPQLQQRYAELQREFKVKSEAFNRFLEKLQELQIAEAQETAPWRVLEPPYEP--QL--
K9SGJ5          AQIPQLQQRYTELQRQLELDSAVFTSLSEKLEELRIAEAQEISSWRVLDAALLP--LQ--
L8MYT6          SKIPQIQQRYVEIQRQLDLDTSTYNKLTEKLEELRISEAQEISSWKILEPPLLP--VR--
A0A352JGJ6      SQIPQIQQRYIEIQRKLALDTSTYQKLTEKLEELRISEAQEISSWRILEPPLIP--TR--
A0A1J5GLS2      SGIPQIQQRYVEIQRQLALDTSTYNKLTEKLEELRISEAQEISSWRVLEPPLIP--TR--
A0A2W4W6M5      SKIPQIQQRYVEIQRQLALDTSTYNKLTEKLEELRISEAQEISSWKVLEPPLIP--TR--
A0A2W7AN33      SQIPQIQQKYVEIQRQLAIDSSTYNKLSEKLEELKVSEAQEISPWKILEPPLIP--TR--
A0A256BLV2      SKIPQIQQRYVEIQRQLALDTSTYNKLSEKLEELRISEAQEISSWKILEPPLTP--IK--
A0A2W6ZXF3      SGIPQIQQRYVEIQRQLALDTSTYNKLTEKLEELRISEAQEISSWRILEPPLIP--TR--
A0A2Z5WX66      SQIPQIQQKYIEIQRQLALDTSTYNKLTEKLEELRISEAQEISSWRVLEPPLIP--IR--
K9W1T3          NTLPKLEQQQRELERRLKTAQSTYEILSPKLQEIRVQENQTVGNARIVTPASIP--ER--
A0A0D6YBN8      ------SIQYNIYQQEVDTNRALYDGLLQRFKEIGVAGGVGINNVSVVDPADIP--QK--
A0A318BJ18      ------SIQYNIYQQEVDTNRALYDGLLQRYKEVGVAGGVGVNNISVVDTADAP--RH--
A0A1Q4RTR1      TSLPRLEQNQSQLERDLQVARQTYEQLLRRFQEVQVIENKTVGNARVVSQALVT--DN--
A0A1Z4SQV2      GILPRLEQNQRQLERNLQVARQTYEQLLRRYQEVQVIENKTVGNARIVSEAQVT--NR--
A0A2H2XGN1      GILPRLEQNQRQLERNLQVARQTYEQLLRRYQEVQVIENKTVGNARIVSEAQVT--NR--
A0A433UXH8      KILPSLEQNQRQLERNLQVARQTYEQLLRRLQEVQVIENKTIGNARIVSEAQVT--NR--
A0A1Z4RMB9      KELPSLEKRDRELVRSAEAASKTYQTLLDSLQKAQIAENQQSGNTDIVEYATVP---D--
D5A466          SILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--DE--
K1XF69          RILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--DE--
B5W297          RILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--DE--
H1W7M8          RILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--DE--
B4WP72          STLPALEKTQRELERRLQASQTTYEALLTKLQEVQVAENQNVGNARVVEAAIAP--ES--
A0A318B4H2      -------IEYQILQREVDTNRTLYDGLLQRYKEIGVA-GVGSNNVAIVDAAEVP--GG--
B4WQE3          RNLSTVTRSYNSIQRDLEIAATNLNEFLTKRETLRIEAAQQQTPWEILTPPSAP---Q--
A0A2K3BR24      KILPKLEQRQRELERQLNASQSTYQALLKRLQEVRVAENQNLGNARIIESASIP--TS--
K9YXY1          KILPKLEQRQRELERQLNASQSTYQALLKRLQEVRVAENQNLGNARIIESASMP--TS--
A0A2P8W4F7      QRLADLSRSFQQIDRELTVAESSLNQLLASRQELRLQMARQASPWEIISPLSES--SI--
U5QJM6          QLVPGLAKRYQELNRNAVIASDSLNRLLQRLQELEIKAAQELSPWRVIEPAVLPDKEK--
A0A1U7HGH0      TNLPRLEQQQRELERELSAAQSTYEALLRSLQEIKVIENRTVGNVQIIEYAQVP--SG--
K9XJD3          THLPKLEQQQRELERELSAAQSTYEALLRSLQEIKVIENRTVGNVRIIEYAQVP--SG--
K9SX01          VNIPKLEQQLLVLQRAVEISRTAYEGLLVKQQDIQLTEEQNIGNARILSPAVPS--GV--
A0A1E5QIR9      NALPRLQESQRDLERQVEVAQSTYQTLLTRLQEVRIAEEQNIGNVRVIQAAVFP--ER--
A0A1Z4IBC7      NYLPKLEQNQRELERRLQAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALVP--DF--
A0A1W5CPC7      NYLPKLEQNQRELERRLQAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DF--
Q3MDC6          NYLPKLEQNQRELERRLQAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DF--
A0A1Z4KM73      NYLPKLEQNQRELERKLQAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DF--
Q8YNX7          NYLPKLEQNQRELERKLQAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DF--
A0A367R4K6      NYLPKLEQTQRELERRLKAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DK--
A0A1E2WSV8      NNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDVAQNQKIPNARVISYALIP--DK--
A0A2R5FRT9      NNLPKLEQTQRELERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DK--
A0A2K8T1B6      NNLPKLEQSQRELERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DK--
A0A235I9I0      NNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DK--
A0A2D0HQT8      NNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALTP--DK--
A0A2L2NU95      NNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DK--
A0A367S084      NNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALTP--DK--
A0A0V7ZFJ4      RSLPKLEQTQRQLQRKLEVAQLTYTELLKKLQEVQVVENRSVGNATIISEALVP--EH--
A0A0V7ZNJ9      TVLPKLEQQQRQVERKLQIAQLTYQNLLKKLQEVQVIENQNIGNARIISEALVP--DK--
A0A367RIS1      RTLPKLEQLQLQRQRQLQVAQTTYEQMLKRLQEVQVLENQNVGNARIVSEALLP--KK--
A0A235IXQ2      RSLPKLEQEQLEVKRQLEVAQTTYEQMLKRLQEVQVLENQNVGNATIVSNALVP--KK--
A0A1W5CNX3      RVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--KT--
Q3MEB7          RVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--KT--
A0A1Z4KHN9      RVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--KT--
Q8YT70          RVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--KT--
A0A218Q4C1      RSLPRLEQQQLQLQRQLQVARNTYEQLLGRLQEVQLVENQNVGNARIISEALLP--DK--
A0A166IWU6      RILPKLQQQELQLQRQLQVARITYEQMLRRLQEVQVAENQNVGNARIVSQALLP--EK--
A0A2S0Q8C0      KILPKLEQQQLQLQRQLQVARTTYEQMLRRLQEVQVAENQNVGNARIVSQALLP--EK--
W6FSX4          KILPKLEQQQLQLQRQLQVARTTYEQMLRRLQEVQVAENQNVGNARIVSQALLP--EK--
A0A1B7WTD1      DSLPRLEQQQLQLQRQLMVAQTTYQELLRQFQLVQVMENQNVGNARIISEALVP--EI--
A0A1B7WX82      DSLPRLEQQQLQLQRQLSVAQLTYQEFLKQFQLVAVLENQNVGNSRIISQALVP--ER--
A0A0R0M9H9      DSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--EI--
A0A1S1ZVW2      DSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALIP--EI--
A0A1Z4LRU5      SVLPKLEQQQRQLQRKLQVAQSTYQQLLKQLQEVQVVEKQNVGNAKVIASALVP--NK--
A0A1Z4JVB4      DILPALEQQQLQLERQLKVARITYEQVSKQLQESEIIENQKVGNARVLSEALVP--DK--
K9PIA4          NSLPRLEQQQLQLQRQLQVARVTYEQFLRQLQEIQVLENQNIGNARVISQALVP--NR--
A0A1Z4M597      DSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVA--DK--
A0A1Z4MWT1      DSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVP--DK--
A0A1Z4TX53      DSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVP--DK--
A0A1Z4HVE1      DILPRLEQQQLQLQRQLQVARVTYEQLLKQLQEVEVIENQNIGNARVISQALVP--DK--
A0A252ECZ1      DILPRLEQQQLQLQRQLQVARLTYEQLSKQLQEVEVIENQNIGNARVISEALVP--ER--
A0A1Z4G5Y1      DILPRLEQQQLQLQRQLQVAKITYEQLMKQLQEVEVIENQNIGNSRVISDALVP--EK--
A0A252DNA2      DILPRLEQQQLQLQRQLQVARVTYEQLLKQLQEVEVLENQNIGNSRVISEALVP--DK--
A0A252E1Q4      DILPRLEQQQLQLQRQLQVARVTYEQLLKQLQEVEVLENQNIGNSRVISEALVP--DK--
A0A2A2TNQ5      RQLPKLEQRQRGLERRLEVAQTTYQQVQKQLQEVEVVEQQKVGNARIVSEALVP--EK--
A0A3S1C4K5      TAIPRLEQQQRALERKLQVAQSTYQQVLKQLQEVEVVEQQKVGNARVVSAAEVP--EI--
A0A1X4G3D5      TSLPRLGQQEARLRLRLEIVVTTYKQLQKQLQELEILQGETTGTARVLSSALVP--KR--
D4TNI2          TSLPRLGQQEARLRLRLEIVVTTYKQLQKQLQELEILQGETTGTARVLSSALVP--KR--
A0A1Z4H6Z8      DILPRLEQQQLQLQRQLQVARVTYEQLVKQLQEVEMIENQNVGNARVISDALVP--DK--
A0A1Z4NPM1      AALPKLQQRQRALERKLQVAQSTYQQVLKQLQEVEVAEQQKVGNARIVSPALVP--DK--
A0A3F3KPR9      DSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--EI--
D4TGN7          DSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--EI--
A0A1Z4UZW9      DSLPRLEQQQLQLQRQLTVAQLTYQELLKQFQFIEVLENQNVGNSRIISEALVP--ER--
A0A0K2M5H0      DSLPRLEQQQQQLQRQLTVAQITYQEFLKQFQLVQVLENQNVGNSRIISGALVP--ER--
A0A1B7VSH4      DSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVP--EL--
A0A1B7W126      DSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVP--EL--
A0A3D4C6Q6      DSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVP--EL--
K7W0A4          DSLPRLEQQQLQLQRQLSVAQITYQEFLKQSQLVQVLENQNVGNSRIISEALVP--ER--
A0A1B7UTR1      DSLPRLEQQQLQLQRQLSVAQITYQEFLKQFQLVQVLENQNVGNSRIISEALVP--ER--
A0A1B7UVJ4      DSLPRLEQQQLQLQRQLSVAQLTYQEFLKQFQLVAVLENQNVGNSRIISQALVP--ER--
A0A2T1CIL7      EKLPLLEKQQRELERRVEATQSTYQTLLGQLQDTQVAENQNVGNVRIIADAIVP--EK--
A0A1Z4RPC6      KEVPRLEKEEQALLREVESTRSTYNTLLDNKQEIDILVNQQTGNAEVIELGKVP---D--
A0A2T1CMZ0      KQIPSLEQQEQSLLREVDSARSTYKTLLENKSDLDVLVNQQTGNAQIIESGIVP---E--
L8M4F7          QAIPKLDSKEQELLLELKIADANYKNLLDSLEQVELELLQETSNVEIVEPALVP---I--
L8LZE9          KELPRLEKEEQEAIRKVENIRTTYENLLNTQVELDILQNKQTANARIIEPAIAP---E--
A0A140K2P2      QKLPSLEQKEKDLIRKVKAAQNTYETLLTSLQEVQLAENQQNGNAQIIELAKLP---E--
K9XWX4          QKLPSLEQKEKDLIRKVKAAQTTYETLLTSLQEVQLAENQQNGNAQIIELAKLP---E--
A0A140KB14      RQLPQIEQQQQDLVRQVEAAEKVYQNLLDSQQELQLLQNQKSGNAQIIELAQLP---E--
K9XX88          KQLPQIEQQQQDLLRQVEAAEKVYQNLLDSQQELKLLQNQTTGNAQIIELAQLP---E--
A0A433V7A0      SNIPKLEKDQRELQRKLDAAQSTYQLLLQRLQEVRVAENQNIGNARIIESASIP-RHA--
A0A0C2LBE2      NILPKLEQTQRELERKLKAAQTTYETLLTRLQEVQVAENQNIGNARVISPALVP--DK--
A0A433NN38      NILPKLEETQRELERKVKAAQTTYENLLTRMQEVDVAENQNVGNATIISPALIP--DK--
A0A2N6K0T2      NVLPKLEQTQRELERKLKAAQTTYETLLTRLQEINVAENQNVGNARIISPALVP--DE--
A0A2N6ML72      NILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DE--
G6FQZ6          NILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DE--
A0A2N6MQX9      NILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DE--
A0A2N6KXT6      NILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DE--
A0A2N6KGB9      NILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DE--
A0A2N6L3Y5      NILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DE--
A0A0S3TIS7      NILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DE--
A0A1U7GW28      NILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DE--
A0A2N6LW63      NILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DE--
A0A1Z4TQ63      NIMPRLEQTQRELERKLKAAQTTYETLLTRLQEINVAENQNIGNARIISPALVP--DE--
A0A0D6YFE2      NVLPRLEQTQRELERKLKAAQTTYETLLTRLQEINVAENQSIGNARIISPALVP--DE--
A0A328IH74      NTLPRLEQTQRELERKLKAAQTTYETLLTRLQEINVAENQSIGNARIISPALVP--DE--
A0A1Z4NDS1      NILPRLEQKQRELERKLKAAQTTYENLLNREQEIRIAENQNIGNARIVSYALVP--DT--
K9F4D9          RVIPVLEKQERALDRQLAAAQTTYETLLQNLQQAQVLENQNIGNARIVSPALIP--NE--
U9VXM0          RVIPVLEKQERGLERQLDAAQTTYETLLQNLQQAQVLENQNVGNARIVSPALSP--TE--
A0A2T1FTR8      NALPKLEQQQNALGRKLETTRTNYKTLLSKLQEIEIAENQTLGNSRILTHAELP--QE--
K9UA41          NALPKLEQQQNALGRKLETTRTNYKTLLSKLQEIEIAENQTLGNSRILTHAELP--QE--
A0A1Z4SMD6      SILPNLEKKQGDLERTLSVAQKNYESLVNRSQEIQVAERQTVGNARVIQHARVP--NK--
A0A2H2Y096      SILPNLEKKQGDLERTLSVAQKNYESLVNRSQEIQVAERQTVGNARVIQHARVP--NK--
K9S8M8          NVLPQLEQRQRDLERQLATYQSTYDILSRNLQQVQIIENQNVGNARIVSSASFP--SK--
A0A1Z4NFV0      TIIPNLEKRQGDLERRLGVAQKTYEHLLSRLQEIRVAENQTVGNARIIQAAAPP--PL--
B0CAX4          GIIPKLEQQLIALERDRIVAQTTYEELLKALQQITISENQNIGNVRVIAAALEP--KE--
U5DPF5          SVLPRLEQGQRELERQLNAAQSTYEALLQRLQEVRVTENQNLGNARVVENALVP--IN--
A0A350Y0P6      NILPKLQEGLRDLERQLEASQATYDILLKNYQQIRIAENQNVGNARVITYASIP--EA--
A0A352X940      NLLPRLQEGLRDFERQLGAAQSTYEILLRNYQDVRIAENQNVGNADILARALVP--ED--
B8HTN4          NALPKLEQWLGELERRRVVAQTIYEGLLKTLQSLQISEQQNAGNVRLIQAATLS--DE--
A0A2A2TPF8      NILPNLEKKQGDLERRLTVAQESYKQLLTRLQEVRVAENQNVGSARIVQDAAVS--NQ--
A0A1Z4R0P8      NVLPNLEKKQGDLERRLEVAQESYKNLLTRLQEVRVAENQNVGSARIVQEAVVP--NQ--
A0A0T7BUI3      NAIPNLEKKQSDLERKLSVAKLNHENLNARLQEIQVAEKQTIGNAKIIQPAQIP--ET--
A0A1Z4LP32      AILPNLEKRQQDLERRLSVAQTDYENLITRQQEIELAEKQTIGNSRIIQSARIP--NK--
K9REP9          AILPNLEKQQTELERRLSVAQTDYENLITRLQEIELAEKQTIGNSSIIQKARVP--KK--
A0A1Z4SIJ3      NVIPNLEKNLGDLERRQTLAQTNFQNLQDRLQEIEIAEKQTIGNARIIQPARLP--NK--
A0A2H2XPG4      NVIPNLEKNLGDLERRQTLAQTNFQNLQDRLQEIEIAEKQTIGNARIIQPARLP--NK--
K9V3C7          NIFPNLEKQQGELERSLTIAQKTYEELLTRQQAIRLAENQAMGNARVIQNAIAP--NS--
A0A1Z4T6Y7      EVLPNLEKKQGDLERRLMVAQKSYETLLGRLQEIRVAENQTVGNARVIQNAVVS--PN--
A0A2H2Y561      EVLPNLEKKQGDLERRLMVAQKSYETLLGRLQEIRVAENQTVGNARVIQNAVVS--PN--
A0A1Q4S362      QVLPNLEKKQGDLERRLIVAQKTYETLLGRLQEIRVAENQTIGSARIVQNAVVS--PN--
A0A3S1CIN8      QVLPNLEKKQGDLERRVMVAQKTYETLLGRLQEIRVAENQTIGSARIVQNAVVS--PN--
A0A2A2TC28      SILPNLDKLQTDLERKFNIAQTDYQNLVARLQEIEIVEKQTIGNARVVQPALVP--KI--
A0A0C1NCB0      TVMPNLEKKHGDLERRLDLAQKNYENLTLRLQEIQVAEKQTVGNARIIQPAQLP--QK--
A0A2N6K7Q9      AMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A2N6MXH6      AMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A2N6M5A8      AMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A2N6LL61      AMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A0S3TP66      AMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
G6FP91          AMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A1U7GYR5      AMVPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A2N6KY52      AMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A2N6KMP5      AMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A2N6MA45      AMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A1Z4TLC8      AVMPSLEKQQQGLERKLESAKNGYENLVSRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A0M0SFT2      AVMPSLEKQQQGLERKLESAKNGYENLVSRLQEIQVAEKQTIGNARIVQPAQTP--KK--
A0A0D6Y7R4      AMMPSLEKQQQSLERKLESAKNGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A328IGA1      AMMPSLEKQQQSLERKLESAKNGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK--
A0A0C2LFH0      SALPNLEKKQGDLERRLSIAQKNYENLVTRLQDIEVAEKQTVGNAKEIQLAQVP--KR--
A0A1Z4IYV4      AMMPNLEKKQGDLERKLSISKKNYENLVSTLQEIEVAEKQTVGNAKEIQAAKVP--KK--
A0A1Z4Q0T6      AMMPNLEKKQGDFERKLSISKKNYENLVTRLQEIEVAEKQTVGNAKEIQPAKVP--KK--
A0A0C2PT44      AMMPNLEKKQGDYERKLSISKKNYENLVTRLQEIEVAEKQTVGNAREIQPAKVP--KK--
A0A1D2P6J4      AMMPNLEKKQGDFERKLSISKKNYENLVSRLQEIEVAEKQTVGNAKEIQPAQVP--KK--
A0A3M9ZEU1      STLPKLAQTQGELARRLQAAQSTYETLLTRLQEVQVAENQNVGNARVISSAIVP--EE--
A0A1Z4JK72      AATPTLVKQQSELERKQDLAQKAYENLTSRLQEIQVARNQQVGNARVLQNALVP--TQ--
A0A0N7Z489      ARTPALIQQESELERRQEIALTAYQNLNARKQEIEVAKNQQVGNARVLQSAMVP--TR--
A0A0S3TXS2      AQTPALIQQEGELQRRQEIALTAYQNLNARKQEIEVAKNQQVGNARVLQSAMVP--TR--
A0A1Z4RN12      DNLPQLQEQQRELQRRVDATQSTYKTLLAKLQEAEIIEQRNTGKVRVTAPAAIA--ED--
A0A2T1CMF9      NLSPQLEEQQRQLERKLKSVTENYQTLLSKANEISIRQDYKVDKVRVISVAALA--ED--
Q7NDC5          AALPRLEESQRRLARQVEADQEAYRLLQKKFYEYRILEAQNIGNATLIEPAEVP--EI--
U5QGK3          AAMPRLEETQRQLERQVEADSAAYKLLQTKFHEYRILEAQNIGNAELIEPAVAP--EL--
A0A2W4UY24      QLLPGLEKRNRELERELDAAQTTYETLLASRQQAQVLEKQDVGNARTISLADLP--EE--
A0A254WLE3      NILPKLEQQQRELERQLKAAQSTYEILLQKLQEVKVAENQNMGNARIIESALAP--EK--
A0A433W533      NILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVAENQNMGNARIIESALAP--EK--
A0A2P8QWJ3      NILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVAENQNMGNARIIESALAP--EK--
A0A2T1FKP8      NILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVAENQNMGNARIIESALAP--EK--
K9U6L7          NILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVAENQNMGNARIIESALAP--EK--
A0A2T1GMT4      SVIPKLVQTQRQLERKLEVSQSTYQSLLKKLQELQVARNKSTSNARIISSAAVP--EK--
K9UI51          SVIPKLVQTQRQLERQLEVSQATYQSLLKKVQELQVARNKSTSNARIISSAAIP--EK--
K9TYI2          NIIPQLVQNQQELERRLVVAQSTYQTLLKKVQELQVAENKTTAHARIIAQALVP--EK--
A0A254W5G5      KVISQLVQNQHELEGRLVVAQSTYQTLLKKVQELQVAENKNTAHARVIAQALVP--NK--
A0A2T1FXY4      NIIPQLVQNQHELERRLVVAQSTYQTLLKKVQELQVAENKTTAHARIIAQALVP--NK--
A0A1Z4QL41      KIIPRLAQTQSELERTIEVAQSTYGTLLKKIQALQVAENQNTASARIITEAIIP--KK--
A0A252D4T4      KIIPQLEQQQRELQRRLDVAQSTYQTLLKKVQELQVAENNNTPNARIIAKGLVP--NK--
A0A252DJH5      KIIPQLEQQQRELQRRLDVAQSTYQTLLKKVQELQVAENNNTPNARIIAKGLVP--NK--
A0A252EB80      KIIPQLEQQQRELQRRLEVAQSTYQTLLKKVQELQVAENNNTPNARIIAKGLVP--TK--
A0A1Z4HPW5      RIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSAP--KK--
A0A1Z4MSN1      RIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--NK--
A0A1Z4U1C2      RIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--NK--
A0A0D6KV51      RIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--IK--
A0A1Z4MKF8      RIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--IK--
A0A2C6WC43      QVIPQLIQNQRELERKLEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--TD--
A0A1Z4L5A1      QVIPQLIQNQRELERKLEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--AD--
A0A367QD86      QVIPQLIQNQRELERKLEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALMP--TD--
A0A235IZ96      KLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--KD--
A0A2L2NGP0      KLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--KD--
A0A2K8SM78      KIIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--KD--
A0A2R5FPC0      KIIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENTNTPSSRIIAPAVVP--NK--
K9QM62          QKMPQLEQTLRELQRTLEVAQSTYQNLLRKTQELQVAEHKNTANARIISQALVP--EE--
A0A1Z4FWI3      KVIPQLEQQQRELERRLEVAQSTYQTLLKKIQELQVAENDNTPNARIIARGLVP--TK--
A0A1Z4JYE7      QILPKLAQQQRQLERKVEVAESTYQTLLKKVQELQVAENANTANARIIARGSVP--EE--
A0A140KBA0      SVLPNLEKRQKELERKTKAAQATYQTLLGKLQETQVAEKQNIGTVRVLANAIPP--DE--
K9XSG1          AVLPNLEKRQKELERKTKAAQATYQTLLGKLQETQVAEKQNIGTVRVLANAIPP--DE--
A0A0F5YE28      QNLPQLEQEQQELQRKVQVAQVTYETLLKNLEEVQVAENKSTNNARVIEEAIVP---E--
U7QEH7          QNLPQLEQEQQELQRKVQIAQVTYETLLKNLEEVQVAENKSTNNTRIIEEAMVP---E--
A0A3S1ATK5      KIIPMLVQNQRDLERKVEVAQSTYETILKKAQELQVAQNKNTANARIITQAKIP--EK--
A0A2Z6CPH0      RFIPQLIQTQHELERKVEVDQSTYQNLLKKVQELQLAENRNTANARIIAQALVP--EK--
A0A1Z4GT50      KIIPLLVQNQRELEQKLEVAQSTYQTLLKKVQELQVAANKNTANARIIAQASVP--EE--
A0A1Z4GIX0      KVIPQLAQTQRELERKVDVAESTYQTVLKKVQELQVAENKTTPNARVVAQATVP--EK--
A0A2H6LC24      KIIPQLAQTQRELERKVDVAESTYQTVLKKVQELQVAENKTTPNARVVAQATVP--EK--
B2J6N5          KLIPQLAQNQRELERKAEVAESTYQTLLKKVQELQLVENTNTASSRIIAQAIVP--DK--
A0A367RMI4      KLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENTNAPSSRIIAQALVP--KD--
A0A235HUM0      KLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENTNTPSSRIIAQALVP--KD--
A0A2L2NW47      KLIPQLAQNQRELDRKVEVAESTYQTLLKKVQELQLVENTNTPSSRIIAQALVP--ED--
A0A1E2WUR1      KLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--KD--
A0A235IKU3      KLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--KD--
F4XKF3          NVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KK--
A0A1D9FX10      NVLPRLEQTQQQLEQRLQAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KK--
A0A1D8TNX9      NVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KK--
A0A1U7MYU6      NVLPRLEQTQQQLEQRLQAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KK--
A0A3C0NJ41      SILPKLEKEQRELQRRVEAAQSTYQALLKKQEELKLAENQSIGNARIIEPALVP--ET--
A0A352AG88      TILPKLEKDQRELQRRLDASQSTYEILLKKLQEVRVAENQNIGNARIIEPAEVPLLPS--
A0A350Y374      NTLPKLEKEQRELQRRLDAAQLTYQTLLQKLQELRLAENQNIGNARIVEPAQIP--DS--
A0A355DPX0      NTLPKLEKEQRELQRRLDAAQLTYQTLLQKLQELRLAENQNIGNARIVEPAQIP--DS--
A0A0D8ZUV2      NVFPKLEQNQRELERQLQASQSTYQSLLQKLQELKVAENQNTGNASIVEPALVP--DK--
A0A433VDI0      SILPKLEQEQRELERRLAAAQSTYETLLKKIQEVRVAANQRIGNAQIIEPAPIP--KK--
A0A3D1PG43      NVIPKLEQQQQELERQVKASQATYEILLRKQQEVKVEENRNIGNASIIETALVP--EQ--
A0A2P8QQ72      TVLPQLEQQQRELERQVRAAQATYELMLKKLQELRVEQNRNIGNASIIETALVP--ET--
K9TZQ7          TVLPQLEQQQRELERQVRAAQATYELMLKKLQELRVEQNRNIGNASIIETALVP--ET--
A0A2G7GPR0      NVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--EN--
K9XH68          NVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--EN--
A0A1U7HW70      NVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--EN--
A0A2S6VEJ8      NVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--EN--
                                                                            

K9SLA9          --AIAPNIPL---NLSLGAIL-GLAFAGLVTFILAAIDKSIKTSEQASDISG-YSLLGIV
A0A168TT23      --PVLPDISR---NLSIALLL-GLVVGVGLALLLEFLDSTVHRTEDVEKLVG-RPVLGLI
A0A0M1JWX9      LIPFSPNLLR---NLVLGAML-GLMLGFGAALLVEQLDFVFHNPEDLKQATD-KPLLGLI
A0A2T1M1V6      --PLTASRKL----IALGGLL-ASLFGSLSVLLLLESRNPLFNSKDLQQAG--LPLVLRF
A0A2G7GCS2      --PEEPSKRA----IALGGIL-AGLFGSISLIFFLEKRNPMLRPKDLEQVE--FPVLGRI
K9XBH8          --PEEPSRRV----IALGGIL-AALFGSVSLILFLESRNPMLSPRDLRQVE--FPVLGRI
A0A1Z4LJ30      --PVGPKLRL----MLLGALL-ACGFGSAAIILFSENRDPLLSPKDIVQTN--IPVLANI
K9RI76          --PSGPKLKL----MLLGALL-ASGFGSAAIILFMENRNPLLSPKDIQQAN--IPVLASI
A0A352AE27      --PTDPKKTL----IALNAFV-ASVVGSIALLLLLEARNPLLSPKDLQTLK--FAIVVRI
A0A3B8JH60      --PSSPKKLL----AALNALI-ASIVGSVALVLFLESRNPLLSPKDLQAIK--FPIVVRI
A0A3C0N766      --PSSPKKLL----AALNALI-ASIVGSVALVLFLESRNPLLSPKDLQAIK--FPIVVRI
K9W9J7          --PSGPKRSI----IVLSGLM-ASIIGSIALVLLLESRNPLLSPKDLQATK--FPIVVRI
A0A139WSU3      --PVSPKFLL----MAVNALL-ASIIGSIALVLFLESRNPLLNLKDLQGQK--FAIVQSI
A0A433VN22      --PISPKLFL----MAINALL-ASVIGSIALVLFLESRNPLLSAKDLQEQK--FAIVERI
Q7NF11          --EANPRTLL----IALGGLV-AAVFGSLGLILRKEAINPLLGPKDLQSVE--LPVLARL
A0A1Z4JCS8      --PSSPKKSL----IAINALL-ASVIGSIALILLLEARNPLLTPKDLQALK--FSLVARI
F4XTX2          --PAGPKKLL----IIANGFL-ASAVGSIALVLLLERRNPLLSPKDLQAIK--FPMVVNI
Q7NJN6          --PS-PSGLL----VAVGGLV-AMLSGSIALALWLERRNPMLGVRELDSTG--LPVLGRI
U5QCC3          --PS-PRLFL----IVLGALL-AMIAGSVALALLLERRNPLLAKRDIEVTG--LPVLARL
A0A0S3TYD7      --PTLLTSALGRSLLLAGSGGAGLLLAFAATVLAYLLDRRIRTVQDLKDVFD-YPVLGMI
U5QL42          --PVSPKIDQ---NLLYGFIA-SVFLGLGAAFVPDLIDERIKGVEEAKELTG-LPLLGAI
K9QF04          --PISPNPVR---DLLLGGFA-GLLAGIGTAIAVEKFDNKYHSPEEIQDNTG-LTLLGTI
A0A3C0N2P0      --PISPNVPR---GILLGIVT-GLMAGAGVAFLAEKLDKVFHSPDELKDSTG-LPILGTI
K9TLQ0          --PISPNLSR---SLLLGGIA-GLMAGIGAALLAEKLDTKFHSVEDIKDYMG-FPILGTI
A0A076HBF2      --PIKPSVPR---NLALGTVL-GLVAGAAAGLLRDRMDHVFHHAGEVKDDLG-LPLLGHI
A0A354B169      --PIEPSISR---NLALGAIL-GLVAGAFAGLLRDRLDHVFHTAAEAKADLR-LPLLGHI
G4FMX5          --PIKPSIPR---NLALGTLL-GLVAGAGAGLLRDRKDHVFHSPGEVKAEIGDLPLLGHI
Q0IDT5          --PIKPSIPR---NLALGAML-GLVAGVAAGLIRDRFDHVFHLPAEVKDDLN-LPLLGHI
A0A2D6FCW3      --PIKPSIPR---NLALGAVL-GLVAGAAAGLLRDRMDHVFHHAGEVKMDLG-LPLLGHI
A3ZA21          --PIQPSVPR---NLALGAVL-GLVAGAGAGLLRDRLDHVFHHPGEVKDDLG-LPLLGHI
A0A140K3H3      --PISPNLER---GILLALVA-GSLMGVATAFLLQKLDQRVKQVEEVKQMVR-LPLLGTI
K9XUB8          --PISPNLQR---GIFLALMA-GGFMGVATAFLLQKLDQRVKQVEQVKQIAR-LPLLGTI
Q7NEU3          --PIWPKPLL---TLGGGALL-GLVFGLGIASLLESVDDRVKSISQAKELLN-LPLLGAI
A0A352XE00      --PISPNVPR---GLVLATVA-GLIAGAGAGSLAEKLDKAFHSLDELKDSTG-LPILGTI
B4VS56          --PISPNIPH---GIALGAVA-GLLAGAGAGFLAEKLDKVFHSAEEVKEKTG-LAVLGTI
A0A352AAQ3      --PISPNVPR---GIVLGTVA-GLLAGAGAGMLAEKLDKAFHSPDELKDSTG-LAVLGTI
A0A350Y472      --PISPNIPR---GIALGAIA-GLLAGAGAGMLAEKLDKAFHSTDELKDTTG-LPLLGTI
A0A355DVB4      --PISPNIPR---GIALGAIA-GLLAGAGAGMLAEKLDKAFHSTDELKDSTG-LPLLGTI
A0A2P8VVX1      --IG-PDPVR---PLALGIVA-GLFVGGALAFGVESIDQRVRTSDELKKQVP-LPLLGML
A0A2P8WHY0      --IG-PDPLR---PIALGVVA-GLFVGGGLAFARDSMDKVVRTSDDLKRQVP-LPLLGIL
A0A2T1CMT9      --IA-PNLAK---DLLLSLVV-ASFVGGFAAFVKDFTDETINTSKEIERRTS-LPILGTA
A0A1D8TX52      --TG-PNMTQ---DLLLGAVV-GLFLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMI
A0A1U7N5X9      --TG-PNMTQ---DLLLGAVV-GLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMI
A0A1D9G4T2      --TG-PNMTQ---DLLLGAVV-GLFLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMI
F4XP71          --TG-PNMTQ---DLLLGAVV-GLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMI
A0A2P8QVH5      --MG-TGRIM---LLVSGAVF-GLVLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGIT
A0A2T1FT70      --MG-TGRIM---LLVSGAVF-GLVLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGIT
A0A433W4W4      --MG-TGRIM---LLVSGAVF-GLVLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGIT
K9U5W1          --MG-TGRIM---LLVSGAVF-GLVLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGIT
A0A254WLA7      --MG-TGRIM---LLVSGAVF-GLVLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGIT
A0A2W6ZAV2      --PDKPNLRN---SLMLSILI-GGVAGVGAALLRDRLDHVFHQPQDVEDGLG-LPLLGRL
A0A2G7GMH8      --IS-PSIKR---NLLLGIVV-GLTLGCFAAFIREAVDDAVHSSDELKKQVA-LPLLGLI
K9W742          --TG-PKKAQ---IILLGAVA-GVMLGGIAAFIRETMDDAVRSSDELKQQVA-LPVLGMT
K9SA61          --IA-PNLQR---NLLLGAVA-GLMLGAVAAFVREGVDDAVHTSDDLQKQVP-LPLLGMI
A0A350Y7Z1      --MG-PDTRR---DLMLSVVV-GLFLGGLAAFGREALDDAVHSSEELKRQVA-LPLLGII
A0A352X2A7      --IG-PNTKQ---DIMLAVVV-GLFLGGIAAFGREFIDDGVHTSDQLKRNLT-LPFLGII
K9XPB0          --IA-PNTTK---DILLSLVV-ASFLGGTTAFIKESLDEQLYNSRQIQEKIA-LPLLGST
A0A0D8ZYV0      --VG-PNIKQ---NLLLGLVA-GLMLGGVAAFLREATDDAVHTSDELEKQVS-IPLLGMT
A0A3D1PBA3      --IG-PNLKL---NLLLGLVA-GLMLGGVAAFLREAVDDSVHTSEELEKQVE-LPLLGMT
A0A254WJ87      --VG-PNLKL---NLLLGLVA-GLMLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMT
A0A2T1FP73      --VG-PNLKL---NLLLGLVA-GLMLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMT
A0A433VMS2      --VG-PNLKL---NLLLGLVA-GLMLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMT
K9TYA7          --VG-PNLKL---NLLLGLVA-GLMLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMT
A0A2P8QUE1      --VG-PNLKL---NLLLGLVA-GLMLGSLAAFLRDAVDDSVYSSEDLEKQFE-LPLLGMT
A0A2T1DWE8      --IG-PNVKQ---NILLGAVA-GLMLGSVAAFIRDTMDDAVHNADDL-KQVA-VPLLGMV
A0A1U7I8L3      --IG-PSMKR---NLLLGAVV-GLMLGSIVAFIRDMIDDAVHTSDDLKKQVD-LPLLGII
A0A2T1DJL8      --IG-PNWLR---NLLLGAVG-GLMLGGVAAFLREAADDAVRTSEDFKQQVP-LPLLGMV
A0A1Z4J9W0      --VG-PSWMR---NLLIGAAG-GLMLGCVAAFLRESADKSIRTSEDLTKEAS-IPLIGMV
A0A0N7Z5K9      --VG-PNWLR---NLLIGGAA-GLMLGSVAAFLRESADKSIRTSEDLTKQAS-IPLIGMV
A0A0S3TXC5      --VG-PNWMR---NLMVGAAG-GLLLGCVAAFLRESADKSIRTSEDLTKQAS-IPLIGMV
A0A2T1DNG3      --KTGPNLQK---NLMLGLVV-GILLGGVAAVSREVLDDSVHSSDELKQQTA-VPLLGTI
A0A2P8W9H0      --ASAASAKR---NLLLGTLL-GLLLGAGAAIVVDRFSGKIYTIDELKAAVR-LPVLGNI
A0A3S0Y9N9      --PIKSRQYI---NLLQGFIG-GILLGVATAFILEKMDKTIKTPESARELLG-YNLLGYI
A0A433UNK7      --PIRSRQYI---NLLQGLIG-GIVLGVATAFVLERLDKTIKTSKSAKDILG-YNLLGYI
B8HNB0          --PISPNMSR---AILLGLFA-GVLAGIGLALLIERLDSRIHSVEEVKRASG-LPLLGTV
A0A1Z4LN32      --PQVQKQKF---IVTFGSIFVGLVLSIGSAYFVDLIDRRLKTAKEAEKLFG-YTLLGLI
A0A2I8A9F5      --PKASKKKG---LTLMVSVFGGLLVGIAVAFLLDVIDRRLKTAKEAEELFG-YTLLGLI
A0A218Q6R8      --SSANKKKI---IILLGGGFVGLLLGVAAAFFIDLIDRRVKTAKEAEELFG-YTLLGLI
A0A0C1XVC4      --PAVKRKRF---VITLGSGFVGLLLGVASAFFVDLIDRRLKTTKEAEALFG-YTLLGLI
A0A218QGE0      --PSVKKKKL---VITLGSGFVGLLLGVASAFFVDLIDRRLKTTKEAEALFG-YTLLGLI
A0A3B8Y8H9      --PVSGPLKL---SV-LGTFM-GIVLGMGAGLLAEKLDDTFHNAEELKQETR-LPLLATI
A0A1Z3HMQ0      --PVGTSTKK---YIAAGGAV-GLLLGVAMAFFLDLIDKSIKTVKDGEALLG-YTLLGLI
A0A1E5QP61      --PVAPNKKL---LVAAGVVG-GSMLYVLTAFLLELMDPSIKTAKELRMLFR-YTLLGMI
A0A3M2GIL5      --PVGSGKKL---YLAAGIVA-GGMLYVVTAFLLELIDPSIKTAKEVREVFR-YTVLGMI
A0A433NM31      --PVAPKKLL---NFALGGVA-GIILAVFIALARDAVDTSIKTLREAKEVLG-YTVLGVI
A0A3M1PML8      --PLPSQKKL---FLIAGSLA-GMLLGVATAFGLDLFDRSIKTVKEAKEALG-YTLLGVV
A0A352X442      --PTSSKKKL---IAAGGVVV-GGLLGIAVAFLVDLIDHSVKNVKEAKELFG-YTLLGVV
A0A0T7BPZ0      --PGNSRKLL---ILGGAGFF-GLLVGIIAALALDLLDQSVKNVKQAKEIFG-YTLLGVI
A0A0M0SHU3      --PSGARKAL---VVLGGGVL-GALLGIIAALAADLIDRSIKTVKEAREVFQ-YTLLGVI
A0A1D2PBN3      --PAGSRKIL---MITGGGVL-GILLGVIAAFTLDLIDRSVKTVKEARELFK-YTLLGVI
A0A0C2LVR7      --PAGSQKIL---VITGGGVL-GILLGVIAAFSLDLIDRSVKTVKEARELFK-YTMLGVI
A0A1Z4PQB9      --PAGSRKIL---MITGGGVL-GILLGVIAAFTLDLIDRSVKTVKEARELFK-YTLLGVI
A0A1Z4SFN6      --PTGPRKAL---IIAGGGVL-GILLGIMAAFTLDLIDRSLKTVKEARELFQ-YTLLGVI
K9PGI8          --PAASQKNL---IVLGGGIF-GAMLGLIAALTLDMIDRSVKTVKEARELLQ-YTLLGVI
A0A2W1JVB9      --PIAPRKLL---YIFSGFVL-GSLLAFGVALLLDSRDKSVKTLEDIKALFSDYTMLGVI
A0A3M1SVZ4      --PI-SKKSL---YQAMGIFL-GGLAGVATALLLEVQDRSIKSVGEAKAQLQ-FALLGVI
K9SSQ0          --PSSPNVIL---NLLLAGLA-GILVAAIIITVLENSDDRLQQVSQLQTLSD-LPLLGAV
A0A2W1JIN9      --PSDPNIPV---VLILGTLA-GAVLSIGTVILLEALNRKLYSADEIEELVE-LPVLSTL
A0A318AJV1      --PAPPGKVL---LSGLAMLA-SLGCGLATVIVMEMLQGGLRTIGEVEARLG-LPVLASV
A0A254WHG9      --PTWPNPAI---VLVLATVA-GGTLALGTVLLQEGLDGTLRNATEAGSLVE-VPIMGVL
A0A2P8QIL5      --PTWPNPAI---VLVLATVA-GGTLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVL
A0A2T1FLY5      --PTWPNPAI---VLVLATVA-GGTLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVL
A0A433W447      --PTWPNPAI---VLVLATVA-GGTLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVL
K9U1K8          --PTWPNPAI---VLVLATVA-GGTLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVL
A0A1U7N2U4      --PKEPNPKV---VLLIASAA-GIALAVGMVLLLEVMDNTLHDGSEAEALLK-LPRLGVL
A0A1D9G1F2      --PKEPNPKV---VLVIATAA-GIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVL
F4XV38          --PQEPNPKV---VLVIATAA-GIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVL
K9UYB2          --PASPKIAV---VLALAIAI-GIVSAIALIILLEMLDNKLHDQDETEELLQ-LPLLGVL
A0A0C1XJI7      --ASSPKRSA---VLALATVF-GTVLGTGVMLLLEVLDNTLKDASEAEELLS-LPLLGVL
A0A218QN17      --ASSPKRSA---VLALATVF-GTVLGTGVMLLLEVLDNTLKDASEAEELVS-LPLLGVL
K9RKN2          --PSSPKKPV---VLALATIF-GGILATGVILLLELMDNTLRDARDAEQLLN-LPLLGVL
A0A2I8ADV2      --YAYPKRSV---VLAIAIFF-GSILATGVVLLLELMDNRLYEVAEAEELLK-LPLLGIL
A0A1W5CKM3      --PTSPKRTV---VLVIAGFF-GSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVL
Q3MEW0          --PTSPKRTV---VLVIAGFF-GSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVL
A0A1Z4KIC7      --PTSPKRTV---VLVIAGFF-GSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVL
Q8YSM5          --PTSPKRTV---VLVIAGFF-GSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVL
A0A1Q4S1H4      --PSEPQPAI---ILAIAGAF-GILLSTGMVLLLEMMDNRLHDVAEAE-LLN-IPLLGIL
A0A433VBU6      --PSTPKSTI---ILAIAGAF-GILLSTGMVLLLEMMDNRLHDVAEAE-LLE-LPLLGVL
A0A1Q4RZJ6      --ASSPKPNV---VLALAGAF-GLLLATGVVILLEIMDNTLHDASEAEELLK-LPLLGVL
A0A1Z4SNV3      --ASSPKPKV---VLALAGAF-GLLLATGVVILLELMDNTLRDASEAEELLK-LPLLGVL
A0A2H2XJQ1      --ASSPKPKV---VLALAGAF-GLLLATGVVILLELMDNTLRDASEAEELLK-LPLLGVL
A0A3S5K358      --ASSPKPNV---VLALAGAF-GLLLATGVVILLEVMDNTLHDASEAEELLK-LPLLGVL
A0A0T7BPJ4      --PSSPKIPV---VLVVATVF-GTVLATGIILLLEAMDNTLRSGWEAQDLLK-LQLLGVL
A0A0C1QS61      --ATSPKKPA---VLVLATVL-GTLLATSIVLLLEMMDNTLRDASEAEELLK-LSLLGVL
A0A139X3R8      --ATSPRRSS---VLVLATAL-GTLLATSIVLLLEMMDNTLHDASEAEDLLK-LSLLGVL
A0A1Z4I7C5      --PSSPKRNV---ILVMATFF-GSVLAVGLVLLLELMDNTLRDASEAEELLQ-LPLLGVV
A0A0C2MDK7      --PSQPKQKV---VLALAAAF-GTMLAVGVVLLLEVMDNTLRDATEAEELLQ-LPLLGIL
A0A1Y0RCK1      --PSEPKQKV---ILALASVF-GSVLAVGVVLLLELMDNTLRDATEAEELLQ-LPLLGVL
A0A1Z4PWZ0      --PSDPKPNV---ILALASVF-GSMLAVGVVLLLEIMDNTLRDASEAEELLQ-LPLLGVL
A0A0C2QLT0      --PSEPKPKV---ILALASVF-GTMLAVGIVLLLEVMDNTLRDASEAEELLQ-LPLLGVL
A0A1Z4J2K1      --PSEPKPKV---ILALASVF-GSMLAVGVVLLLEMMDNTLRDASEAEELLQ-LPLLGVL
A0A3S0ZSX0      --PTSPHKKA---VLAIAIVF-GSALATGIVLLLELMDNTLKDASEAEELLD-LPLLGVL
A0A2N6K4T3      --PSLPNKRS---VLAIATLF-GTALATGIVLLLELMDHTLKDASEAEELLR-LPLLGVL
A0A370CKT2      --PSLPNKRT---VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVL
A0A0S3TL97      --PSLPNKRT---VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVL
A0A2N6M8A0      --PSLPNKRS---VLVIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVL
A0A2N6M9E1      --PSLPNKRT---VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVL
A0A2N6KJI4      --PSLPNKRT---VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVL
A0A2N6MZ77      --PSLPNKRT---VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVL
A0A2N6KT20      --PSLPNKRT---VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVL
G6FSN3          --PSLPNKRT---VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVL
A0A0D6YL98      --PSLPNKKA---VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEDLLK-LPLLAVL
A0A328I8B9      --PSLPNKKA---VLAIAIVF-GTALATGIILLLELMDHTLKDASEAEDLLK-LPLLGVL
A0A0M0SU69      --PSLPNKKA---VLAIATVF-GIALATGIVLLLEFMDHTLKDASEAEELLK-LPLLGVL
A0A1Z4TIZ8      --PSLPNKKA---ILAIATVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVL
A0A318BG22      --PASPILWL---NLLLAIGF-GVLAGVGIAFIIEFVDDSIKMPDDVEQKLH-LPLLGIT
A0A2T1E9V8      --ATNASNKS---SMIAASLA-GILVAGAVVYFLELTDKKIKTVKEARELFD-YRLLGTI
A0A0P1C0L3      --PYAPSLLQ---NLLVALIT-GLIGAGALIYGRVVLSQTIKDPQDVTRELG-LSLLGTI
A0A3M2GQQ6      --PISPNVRR---NLLLGLIA-GGLLGVAAAILVERSDQRVKHVDEAKELTG-LPSLGMI
K9SGJ5          --PIEPNVLR---NLVFGGFA-GILFGVAIAMYLERSDERIREVEEVRELTH-VPLLGSI
L8MYT6          --PSSPDIER---SLFISAIA-GLGLGVLIALLLDRLDQRIREVEEVREIID-VPLLASI
A0A352JGJ6      --PSSPDIEK---SLIAGTFI-GLTLGILCALLFNRLDQRIREVEEVKEIID-IPLLASV
A0A1J5GLS2      --PSSPDIER---NLMTGAFV-GAVLGILSALALDRLDQRIREVEEVKEIID-VPLLASI
A0A2W4W6M5      --PSSPDIEK---GLIAGAFF-GLVLGISSALILNRLDQRIREVEEVREIID-IPLLASI
A0A2W7AN33      --PSSPDILM---NLFVGGIS-GLALGVLLALLLNRLDQRIRDVGEVREIID-VPLLASI
A0A256BLV2      --PSSPDIER---SLITGAIS-GIALGILFALLLNRLDQRIREVEEVRELID-IPLLASI
A0A2W6ZXF3      --PSSPDIER---SLITGAFV-GAVLGILSALALDRLDQRIREVEEVKEIID-IPLLASI
A0A2Z5WX66      --PSSPDIEK---SLIIGALG-GLVLGVLFALLLNRLDQRIREVEEVKEIID-IPLLASI
K9W1T3          --AIAPKKAQ---NLAVGGLL-GILLGIAVALALETTDKSIKDPEDAKRILG-YPLLGTI
A0A0D6YBN8      --PSSPRLLI---NLLVSLLA-GMALGVGLAFALEQMDEAIADPEEVERRLG-LSLLGSV
A0A318BJ18      --PSSPKLLI---NLLLSLLA-GLGIGALAAFVLEQMDEAIADPIEVTRRLG-LPLLGSV
A0A1Q4RTR1      --PVSPKIAL---NLALGGFL-GIILAVGAALTLEALDGTVKTIEEAQELLG-YALLGTI
A0A1Z4SQV2      --PVSPKLYL---NLALGGFL-GIILAVGAALMSEALDGSVRTLSEAQELLG-YSLLGTI
A0A2H2XGN1      --PVSPKLYL---NLALGGFL-GIILAVGAALMSEALDGSVRTLSEAQELLG-YSLLGTI
A0A433UXH8      --PVSPKLYL---NLALGGFL-GIILAVGAALTLEALDGTVKTIEEAQELLG-YALLGTI
A0A1Z4RMB9      --KGSAGRVM---LMGLGVIL-GAFLANLSIILLEMQDRSLQSLAEIKKKFA-YNVIGMT
D5A466          --GRTAKIQL----LALGVMG-GLVASTTLLLLMEMGDKSLRTVAETRDLLG-YTLLGII
K1XF69          --GKTAKVPL----LALGVMG-GLVASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGII
B5W297          --GKTAKVPL----LALGVMG-GLVASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGII
H1W7M8          --GKTAKVPL----LALGVMG-GLVASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGII
B4WP72          --PVDSRREL---ILIAGILA-GSLVGISAAFAQDLLDRSIKTLNDCREQFG-YALLGAI
A0A318B4H2      --PSEPNLNK---TLLVSLLI-GLVLAVGLVVLAEEIDQSLRDPADVQRELG-LPLLGTI
B4WQE3          --AFSQTGKS---SLLVGPIL-GLLLGSGIALLVDRVKGKICTVRELKDLTN-VPLLATI
A0A2K3BR24      --PISPRIKL---NLALGGIL-GAMLGIATALALDARDRTVKTVQEVKDRLG-YTVLGSI
K9YXY1          --PISPRIKL---NLALGGIL-GAMLGVATALALDARDRTVKTVQEVKDRLS-YTVLGSI
A0A2P8W4F7      --TQTTNLPR---KLLLSTVI-GLMLGGVAALLRDRMDQAFHSTDELIKTTQ-LPNLTTI
U5QJM6          --PVWPKPLV---TLGVGSIL-SVVFGLLVAVLLETFDDRVKTVERAKELMQ-LPLLGAI
A0A1U7HGH0      --AINASNTS---ALAAGSLA-GLMIAGGIVYLLELTDKKIKTAKEAREIFE-YKLLGTI
K9XJD3          --AINASNTS---ALAAGSLA-GLMIAGAIVYLLELTDKRIKTAKEAREIFE-YKLLGTI
K9SX01          --PISPKISN---NLTTGAVL-GIVAAISVALLLNSRDNLLRSGEDIKRLFG-YPLLGIL
A0A1E5QIR9      --PIAPQKKI---NFGLGGVV-GIFLAVVTALVLDAKDTRIKTVREAREYLG-YTLLGII
A0A1Z4IBC7      --PEGPRKIL---FVIGGGAV-GIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVI
A0A1W5CPC7      --PEGPRKIL---FIIGGGVA-GIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVI
Q3MDC6          --PEGPRKIL---FIIGGGVA-GIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVI
A0A1Z4KM73      --PEGPRKIL---FIIGGGVA-GIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVI
Q8YNX7          --PEGPRKIL---FIIGGGVA-GIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVI
A0A367R4K6      --PEGPRKLL---FIVGGGAI-GFFLGIIAAFSLDLIDRSVKTVKEAKEVLR-YTVLGVI
A0A1E2WSV8      --AEGPRKIL---FIVGGGGI-GLFLGIIIAFGLDLIDRSVKTVKEAKEVLR-YSVLGVI
A0A2R5FRT9      --AEGPRKIL---FIVGGGGI-GLFLGIIVAFGLDLVDRSVKSVKEAKEVMK-YSVLGVI
A0A2K8T1B6      --AEGPRKIL---FIVGGGGV-GLFLGIIVAFGLDLIDRSLKTVKEAKEVLR-YSVLGVI
A0A235I9I0      --AEGPRKML---FIIGGAGV-GFFLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVI
A0A2D0HQT8      --AEGPRKML---FIIGGAGV-GFFLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVI
A0A2L2NU95      --AEGPRKML---FIVGGAGV-GFFLGIIVAFTLDLIDRSVKTVKEAKDVLR-YSVLGVI
A0A367S084      --AEGPRKML---FIIGGAGI-GFFLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVI
A0A0V7ZFJ4      --PISPNITR---NLLLGGIG-GILLGVGTALLLERTDKSLKTVDKIKQLLD-YPLLGTI
A0A0V7ZNJ9      --KISPRIAL---NLLLGGFL-GILLGAGTALILETMDKSLKTVDQAKRLLN-YPVLGTI
A0A367RIS1      --PISPRILL---NLALGGFL-GFFLAIAAALLLEAGDTSVKTTEEAQELLD-YPLLGTI
A0A235IXQ2      --RISPRISL---NLALGGFL-GFFFAIGVALLLEAGDKSVKTAEEAQHFLD-YPLLGKI
A0A1W5CNX3      --PVSPRIVL---NLALGGFL-GFFLAIGAALLLEAGDKSVRTQEEAQQLLD-YPLLGTI
Q3MEB7          --PVSPRIVL---NLALGGFL-GFFLAIGAALLLEAGDKSVRTQEEAQQLLD-YPLLGTI
A0A1Z4KHN9      --PVSPRILL---NLALGGFL-GFFLAIGAALLLEAGDKSVRTLEEAQQLLD-YPLLGTI
Q8YT70          --PVSPRILL---NLALGGFL-GFFLAIGAALLLEAGDKSVRTLEEAQQLLD-YPLLGTI
A0A218Q4C1      --SISPRIKL---NLALGGFL-GILLAFGSALLLDAVDKSVQTAEEAEKLFD-YPLLGKV
A0A166IWU6      --SVSPRINL---NLALGGFL-GILLAVGSALFLDALDKSVQTAAEAEQLLD-YPLLGKI
A0A2S0Q8C0      --SVSPRINL---NLALGGFL-GILLAVGSALLLDALDKSVQTAAEAEQLLD-YPLLGKI
W6FSX4          --SVSPRINL---NLALGGFL-GILLAVGSALLLDALDKSVQTAAEAEQLLD-YPLLGKI
A0A1B7WTD1      --AVSPKKPL---NLALGGFL-ALLLGAGTALLLESMNQTLKNIEEANRLLG-FPLLGTI
A0A1B7WX82      --PVSPKKPL---NLAMGGFL-GILLGAGTALLLESMNQALKNVEEANRLLG-FPLLGMI
A0A0R0M9H9      --PISPRTAL---NIGIGALV-GLVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTI
A0A1S1ZVW2      --PISPRTAL---NIGIGGIV-GLVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTI
A0A1Z4LRU5      --PISPKIAL---NLALGGFL-GILLGVGTALILEAMDKSLKTLDEAKKLLG-YPLLGTI
A0A1Z4JVB4      --PISPIIAI---NLALGGAL-GILLGIGVAILLEAMDSSLKTVEQAQDLLD-YPLLGII
K9PIA4          --PVSPVIHL---NLALGGFL-GILLGLGTALVLESMDNSLKNVEEVKRLLG-YPVLGTI
A0A1Z4M597      --SVSPIIPL---NLALGGIL-GIILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAI
A0A1Z4MWT1      --SVSPIIPL---NLALGGIL-GIILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAI
A0A1Z4TX53      --SVSPIIPL---NLALGGIL-GIILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAI
A0A1Z4HVE1      --AISPIIPL---NLALGGFM-GIMLGLGTALILEAMDNSLKTIEEVKRLLG-YPLLGTI
A0A252ECZ1      --PVSPVIPL---NLALGGFL-GILLGVGTGLLLEAMDTSLKTIEEVKHLLD-YPLLGII
A0A1Z4G5Y1      --PVSPIVPL---NLGLGGVL-AIALGVGAALMLEAADNSLKTIEEVKRLLD-YPLLGTI
A0A252DNA2      --PVSPIVPL---NLGLGGVL-GILLGVGVALMLEATDNSLKTIEEVKRLLD-YPLLGTI
A0A252E1Q4      --PVSPIVPL---NLGLGGVL-GILLGVGVALMLEATDNSLKTIEEVKRLLD-YPLLGTI
A0A2A2TNQ5      --PVAPKIPL---NLALGGFL-GVLLGAGTALLLEALDKSLKNVDEAKRLLG-YPLLGTV
A0A3S1C4K5      --PVSPKIPL---NLALGGVL-GIILGVGAALVLEAMDKSLKSVEEAKRLLG-YPLLGTI
A0A1X4G3D5      --PVSPRIPL---NIGIGAIL-GVILGVGTALVLESLDKSVKNIEEINRLLD-LPLLGSI
D4TNI2          --PVSPRIPL---NIGIGAIL-GVILGVGTALVLESLDKSVKNIEEINRLLD-LPLLGSI
A0A1Z4H6Z8      --AVSPIIPL---NVALGGFL-GILLGVGAALMLEATDNSLKTIEEVKRLLG-YPLLGTI
A0A1Z4NPM1      --PVSPKIML---NLALGGFL-GVLLGAGSALLLEALDKTLRDIDEAKRLLG-LPVLGTI
A0A3F3KPR9      --PISPRTAL---NIGIGALV-GVVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTI
D4TGN7          --PISPRTAL---NIGIGALV-GVVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTI
A0A1Z4UZW9      --PVSPKIPL---NLALGGFL-GIILGAGTALVLESMNQSLKNIEEANRLLG-FPLLGTI
A0A0K2M5H0      --PISPKIPL---NLALGGFL-GVILGAGTALVLESMNQSLKNIEEANRLLG-FPLLGTI
A0A1B7VSH4      --PVSPKIPL---NLALGGFL-GVLLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTI
A0A1B7W126      --PVFPKIPL---NLALGGFL-GVLLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTI
A0A3D4C6Q6      --PVFPKIPL---NLALGGFL-GVLLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTI
K7W0A4          --PVSPKIPL---NLALGGFL-GILLGAGTALLLESMNQSLKNVEEANRLLG-FPLLGAI
A0A1B7UTR1      --PVSPKIPL---NLALGGFL-GILLGVGTALLLESMNQSLKNVEEANRLLG-FPLLGMI
A0A1B7UVJ4      --PVSPKKPL---NLAMGGFL-GILLGAGTALLLESMNQALKNVEEANRLLG-FPLLGMI
A0A2T1CIL7      --PTSSTQKK---LITLIGSAMGVLLATAFAFLLDFKDRSIKNSKEAEEIFG-YPLQGVI
A0A1Z4RPC6      --KGSTGRVF---LIALGVLM-GLFLSNLTVILLEMQDRTLKTIPEVKRKFG-YQVLGIV
A0A2T1CMZ0      --EGSTGRLP---LIVLGVLT-GLFLANLTAILLEMQDHSLKTISEIKQKFA-FQVLGIV
L8M4F7          --KGTSSKMK---LLALGVMG-GLFFSNAAVLLLETRDRSLKTIGEIRKKLP-HTILGII
L8LZE9          --KGSSGQLA---LMALGILS-GLLLSNLTAIILDKQDRSLKNISEVKKKLP-YKVLGII
A0A140K2P2      --KGSSGRMA---FMLVGILL-GLLLSNLSVLLVEMQDRSLKTVAEIKNKFG-YKVLGLV
K9XWX4          --KGSSGRIA---FMLVGILL-GLLLSNLSVILVEMQDRSLKTVAEIKNKFG-YNVLGLV
A0A140KB14      --EGSSGRLA---LMVLGVIL-GLLLSNLSVLLLEMQDRSLKTMSEIKQRFP-YKVLGLI
K9XX88          --KGSSGRLA---LMVLGLIL-GLLLSNLSVLLLEMQDRSLKTIPEIKQRFP-YKVLGLI
A0A433V7A0      --SDFTIKII---ILGLGGLV-GTLLATATIFVLELTDKSIKNIEEARKIFD-YTLLGVI
A0A0C2LBE2      --STGSGKIL---IIGAGGIL-GVLFGAVAAFALDTIDPSLKTVKQAKELFK-YTLLGVI
A0A433NN38      --PSGPRKTL---LIAAGGIL-GILLGVVAAFSLELVDQSVKTLKEAKELFQ-YTLLGVI
A0A2N6K0T2      --PSGVRKAL---IAAGGGVL-GILLGIIAALAADLIDRSIKTVREARELFQ-YTLLGVI
A0A2N6ML72      --PSGTRKAL---IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVI
G6FQZ6          --PSGTRKAL---IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVI
A0A2N6MQX9      --PSGTRKAL---IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVI
A0A2N6KXT6      --PSGTRKAL---IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVI
A0A2N6KGB9      --PSGTRKAL---IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVI
A0A2N6L3Y5      --PSGTRKAL---IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVI
A0A0S3TIS7      --PSGTRKAL---IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVI
A0A1U7GW28      --PSGTRKAL---IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVI
A0A2N6LW63      --PSGTRKAL---IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVI
A0A1Z4TQ63      --PSGTRKAL---IVLGGGVL-GILLGIIAALTSDLIDRSIKTVREARELFQ-YTLLGVI
A0A0D6YFE2      --PSGMRKAL---IVFGGGIL-GILLGIITALASDLIDRSIKTVKEARELFQ-YTLLGVI
A0A328IH74      --PSGMRKAL---IVFGGGVL-GILLGIITALASDLIDRSIKTVKEARELFQ-YTLLGVI
A0A1Z4NDS1      --PAGPKKIL---IIAAGAIA-GFLCGVITAFALDLIDSSLKTVQEARELFR-YTLLGVI
K9F4D9          --PLGPSLKL---FLMTGGFA-GLLLGLITAFMADLLDQSVKTVQEGQELYE-YPLLGII
U9VXM0          --PIGPSLKL---FLLAGGFV-GFLLGLIAAFFADIIDQSITTVQEGQELYE-YPLLGII
A0A2T1FTR8      --ALSPKKGQ---NIAIGGFL-GLFLGAATAFLLDGADKRIKTSEEAKSLLPGYPILGQI
K9UA41          --ALSPKKGQ---NIAIGGFL-GLFLGAATAFLLDGADKRIKTSEEAKNLLPGYPILGQI
A0A1Z4SMD6      --PTLSKSTL---ALAGGGVFGGLLFGVAVAFFIDLIDNSLKTVKEAEVLFD-LTLLGLI
A0A2H2Y096      --PTLSKSTL---ALAGGGVFGGLLFGVAVAFFIDLIDNSLKTVKEAEVLFD-LTLLGLI
K9S8M8          --PVGPNKKV---VLMGGMVV-GGMLYLIVAFVFELIDPTVKTAKEIRNLYQ-YTLLGMI
A0A1Z4NFV0      --PAKSKMSL---LIGVGGVFAGLSLGIAAAFLIDLVDRSIKSVKEAESVFG-YTLLGLI
B0CAX4          --PVSPRKAF---NLAVGFFL-GGLLGLGTALLLEALDTSVKTVQEATGLFD-YTVLGNI
U5DPF5          --PIWPRMQL---ILMAGGIV-GALIGTATAITLDVRDQSLKTVQEAKNRLG-YVMLGSI
A0A350Y0P6      --PVSPKKKL---ILVGGIVA-GSLLYIVTAFVLDLMDPSIKTAKEIRQLFK-YTWLGMI
A0A352X940      --PVSPKKKL---ILGGGIIA-GSLLYIIVAFVLDLMDPSIKTAKEVRQLFR-YTWLGMI
B8HTN4          --PVSPKLLL---NLILGTIL-GSLGAIVVIFILESKDKTLKSLEEIQQYFD-YVTLAMI
A0A2A2TPF8      --PVRSKLTM---YLAAGGVFVGLMFGIAAAFLIDIIDRSIKTIKEAETIFG-YTLLGLI
A0A1Z4R0P8      --PVSSKLTL---YLAAGGIFVGLMLGIAAAFLIDIIDRSIKTTKEAQNIFG-YTLLGLI
A0A0T7BUI3      --PMLSKKSL---MLALGSLFAGSLLGIAGAFFVDLIDRSLKTVKEAENFFG-WTLLGLI
A0A1Z4LP32      --TVLSKMTI---MLAGGGVFVGLLLGIAAAFTVDLIDRSLKTIKEIEEFFG-YTLIGLI
K9REP9          --PSLSKMTL---LLAGGGVFVGLLFGIAAAFTVDLIDRSLKTVKEIEGFFN-YTLVGLI
A0A1Z4SIJ3      --PVLSRLTL---LLAAGSAFAGLLFGVSIAFFVDLIDNSLKTIKETEAFFE-YPLLGLI
A0A2H2XPG4      --PVLSRLTL---LLAAGSAFAGLLFGVSIAFFVDLIDNSLKTIKETEAFFE-YPLLGLI
K9V3C7          --PISSKLTL---LLAVGGVFVGVFLGIAAAFLVDSIDKSIKTIKEAQTLFG-YTPLGLI
A0A1Z4T6Y7      --PARLRMMF---LLGAGGIFIGALLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTMLGLI
A0A2H2Y561      --PARLRMMF---LLGAGGIFIGALLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTMLGLI
A0A1Q4S362      --PARMRMML---LLGAGGIFIGALLGVAAAFVVDVIDKSIKTVKEAQDVFG-YTLLGLI
A0A3S1CIN8      --PARMRMML---LLGAGGIFIGTLLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTLLGLI
A0A2A2TC28      --AAMSKMTL---LLLGGGVFVGLLVGIASAFFIDLIDRSLKTVKESEKFFG-YTMLGFI
A0A0C1NCB0      --PALSKLTL---LLPVGGILGGLLLGVAAAFFVDLVDRSLKTAKEAEEFFK-YTVLGLI
A0A2N6K7Q9      --PVISKTKI---LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
A0A2N6MXH6      --PVISKTKI---LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
A0A2N6M5A8      --PVISKTKI---LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
A0A2N6LL61      --PVISKTKI---LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
A0A0S3TP66      --PVISKTKI---LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
G6FP91          --PVISKTKI---LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
A0A1U7GYR5      --PVISKTKI---LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
A0A2N6KY52      --PVISKTKI---LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
A0A2N6KMP5      --PVISKTKI---LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
A0A2N6MA45      --PVISKTKI---LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
A0A1Z4TLC8      --SVISKTKI---LLATGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
A0A0M0SFT2      --PVISKTKI---LLASGSIFAGVLISIAAAFFVDLIDRSLKTIKETETFFG-YTLLGLI
A0A0D6Y7R4      --PVISKTKI---LLASGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YILLGLI
A0A328IGA1      --PVISKTKI---LLASGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLI
A0A0C2LFH0      --PSVSKITF---LLAGGSVFVGLLLGTAAAFFVDLIDRTLKTVKEAETFFG-YTLLGLI
A0A1Z4IYV4      --PVLSKVVL---LLAGGGVFVGLLLGIAAAFFVDLVDRSLKTVKEAETFFG-YTLLGLI
A0A1Z4Q0T6      --PVLSKLVL---LLVGGGVFVGLLLGVAAAFFVDLVDRSLKTVKEAETFFG-YTMLGLI
A0A0C2PT44      --PVLSKVVL---LLAGGGVFVGLLLGVAAAFFVDLVDRSLKTVKEAETFFG-YTMLGLI
A0A1D2P6J4      --PVISKVVL---LLAGGGVFVGLLVGVAAAFFVDLIDRSLKTVKEAETFFG-YTLLGLI
A0A3M9ZEU1      --PSGLSKKV---YLLAGGIV-GALLAITTAFLLDLCDRSIKTVQEAKALFG-YTLLGLI
A0A1Z4JK72      --PTGRMRLI---LLAAGTMI-GLLLGVAAAFFRDMMDKSLKTVKEAEAQYG-YTMLGLV
A0A0N7Z489      --PAGRMRLI---LLAAGAMV-GLLLGIAAAFLVDTIDKSLKTVKDAEAQYG-YTLLGLV
A0A0S3TXS2      --PAGRMRLI---LLAAGAMV-GLLLGIAAAFLVDSIDKSLKTVKDAEAQYG-YTLLGLV
A0A1Z4RN12      --PVNPDKKV---IVAAGAMM-GALFGMALAFLLDLKDNTIKNTQEVENLFA-YPLHGVV
A0A2T1CMF9      --PVNPDAKV---IVAAGAMM-GLLFGTALAFLLDLKDNTIKNTQEVENMFA-YPLHGVV
Q7NDC5          --PAWPKPLL---NLAAGGVL-ALILAALAAYTREFFDDSLRSVEEARGLLG-TSLLGSV
U5QGK3          --PAWPSPLL---NLGAGALL-GAILAMLVAYGREFFDDSLQTVEEATSLLG-TPLLGTI
A0A2W4UY24      --SISPALKL---YLLAGGVV-GALLGIAIAFLADLLETSVKTVTEGQKLYD-YPLLGVI
A0A254WLE3      --ALLLKPAM---ILAAGILL-SVMLSSGTVAALEVKDTSVKTLKEARELFG-YTFLGAI
A0A433W533      --ALSLKPMI---ILAAGILL-SVVLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAI
A0A2P8QWJ3      --ALLFKPMI---ILAAGILL-SVVLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAI
A0A2T1FKP8      --ALLFKPMI---ILAAGILL-SVVLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAI
K9U6L7          --ALLFKPMI---ILAAGILL-SVVLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAI
A0A2T1GMT4      --PDPGPKLI---IGILGGLV-GALFGTSAIAYLELRDGSLKTVKEIDKVFG-YTLLGMI
K9UI51          --PEPGPKLI---LGILGGLV-GALLGTSAIAYLELRDSSLKTVKEIDKIFG-YTLLGMI
K9TYI2          --PVLEQKLI---ILALGIMI-GALLSTSTVLFLELRDRSLKTLEEIRQRFR-YTLLGVI
A0A254W5G5      --PVLEQKLI---VLALGIMF-GAFLSTSTVLFLELKDRSLKTLEEIRKKFS-YTLLGVI
A0A2T1FXY4      --PVLEQKLI---VLVLGTMF-GALLSTSTVLFLELRDRSLKTLEEIRQRFS-YTLLGVI
A0A1Z4QL41      --SSGGKKLI---VLLLGGTL-GVFLASSTIFILEMRDSSLKTVNEVREIFG-YTLLGMM
A0A252D4T4      --AALGLKPF---VLVLGILL-GAFLATTAVIFLETRDRSLKTLKQIREIFG-YTLLGIV
A0A252DJH5      --AALGLKPF---VLVLGILL-GAFLATTAVIFLETRDRSLKTLKQIREIFG-YTLLGIV
A0A252EB80      --PALGLKPF---VLVLGILL-GAFLATTAVVFLETRDRSLKTLKQIREIFG-YTLLGIV
A0A1Z4HPW5      --PTLGLKPF---ILVLGVLL-GAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIV
A0A1Z4MSN1      --PTLGLKPF---ILVLGVLL-GAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIV
A0A1Z4U1C2      --PTLGLKPF---ILVLGVLL-GAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIV
A0A0D6KV51      --PTLGLKPF---ILVLGVLL-GAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIV
A0A1Z4MKF8      --PTLGLKPF---ILVLGVLL-GAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIV
A0A2C6WC43      --PVAGKKFL---VLLLGIML-GLFLATTTVLFLGMRDRSLKTLREVRDIFR-YTLLGIV
A0A1Z4L5A1      --PVAGKKLI---VLLLGVMF-GLFLATTTVLFLGMRDRSLKTLKEVRDVFG-YTLLGIV
A0A367QD86      --PVAGKKFL---VLLLGVMF-GLFLATTTVLLLGMRDRSLKTLKEVRDVFR-YTLLGII
A0A235IZ96      --PIVVKKII---VLVLGVMF-GLFFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIV
A0A2L2NGP0      --PIVVKKII---VLVLGVMF-GLFFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIV
A0A2K8SM78      --PVVGKKII---ILLLGVMF-GLFLATTTILFLSMRDRSLKTLKEVRDVFR-YTLLGII
A0A2R5FPC0      --PVIGKKII---ILLLGVMF-GLFLATTTVLFLSMRDRSLKTLKEVRDVFR-YTLLGII
K9QM62          --PVLKKKII---VVVLSVMF-GAFLSTTTVLLLEMRDRSLKTLQEIRQVFE-YTLLGII
A0A1Z4FWI3      --PGLGLKPI---VWLLGILL-GAFLSTTAVVFLETRDRSLKTLNEIREIFGRYTLLGIV
A0A1Z4JYE7      --PLAAKKML---VLVIGAMF-GLFLATSTILLLEIKDKSLKTLDKVKEAFNGYTLLGII
A0A140KBA0      --PTGPSKKL---IVAAGGLL-GGLLGIAVAFLLDLKDNSLKNSQEIEEIFG-YPLQGVI
K9XSG1          --PSGPSKKL---IVAAGGLL-GGLLGIAVAFLLDLKDNSLKNSKEIEEIFG-YPLQGVI
A0A0F5YE28      --EGSTAKTK---LIALGIML-GLVGATTSVLILAMGDQNIRTVEEAKKTFG-YTLLGII
U7QEH7          --EGSTAKIQ---LLALGIML-GLVAATTSVLLLEMGDKYIRSVEETKKIFG-YTLLGII
A0A3S1ATK5      --PASGKKPI---VVAIGVLL-GAFFGTTTILLLEMRDRSLKTLQEVRDIFG-YTLLGIL
A0A2Z6CPH0      --PTSGKKLI---ILVMGVMF-GAFLSTTTVLFLEMRDKSLKTLKEIREVFE-YPLLGVI
A0A1Z4GT50      --AVLGKKPI---VLSLGVLL-GLFLSTSAVAALETRDRSLKTLKEVKEIFG-YTLLGML
A0A1Z4GIX0      --PESGKKLI---FIALGLTF-GAFLSTSAVLFLEMRDKSLKTLKEIREVFG-YTLLGGI
A0A2H6LC24      --PESGKKLI---FIALGLTF-GAFLSTSAVLFLEMRDKSLKTLKEIREVFG-YTLLGGI
B2J6N5          --PVESKKII---VLVLGVMF-GLFLATTTVLVLGMRDRSLKTLQEIRDIFR-YTLLGIV
A0A367RMI4      --PTLTKTII---VLVLGVMF-GLFFATTTVLFLAMRDRSLKTLKEIRDVFR-YTLLGIV
A0A235HUM0      --PTLGKKII---VLVLGVMF-GLFFATTTILFLAMRDRSLKTLKEIRDVFG-YTLLGIV
A0A2L2NW47      --PTLTKTII---VLVLGVMF-GLFFATTTVLFLAMRDRSLKTLKEIRDVFG-YTLLGIV
A0A1E2WUR1      --PVAGKKII---VLVLGVMF-GLFFATTTILLLAMRDRSLKTLKEVRDIFG-YTLLGIV
A0A235IKU3      --PILVKKII---VLVLGVMF-GLFFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIV
F4XKF3          --PLGDKKIK---VLALGVML-GVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVI
A0A1D9FX10      --PLGDKKIK---VLALGVML-GVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVI
A0A1D8TNX9      --PLGDKKLK---VLALGVML-GVTLATTAILLLEMRDRSIKTLKEVKQLLR-YPVLGVI
A0A1U7MYU6      --PLGDKKIK---VLALGVML-GVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVI
A0A3C0NJ41      --RSPINAII---TLLFGGTA-GTLLGMATIILLEVRDVSLKTLKEVREQFG-YTLLATI
A0A352AG88      --SQMVQTVL---PVVGGGAL-GILLAIVTIITLEVRDTSIKTLREVRELFG-YTLLGVI
A0A350Y374      --RSSGKSVL---ILLLGAMA-GTLLAMATIIILEVRDNSIKTLKEVKDLFG-YTLLATI
A0A355DPX0      --RSSGKSVL---ILLLGAMA-GTLLAMATIIILEVRDNSIKTLKEIKDLFG-YTLLATI
A0A0D8ZUV2      --ASIKLRVM---ILGLGVIV-SALLAGATIIILEVRDTSVKTLKEAQELFG-YTFLGTI
A0A433VDI0      --PSLLKPAI---ILALGNML-GILLAAATIVILEVKDTSIKTLEEALELFG-YTLLGVI
A0A3D1PG43      --PTGGKKLI---ILGLGSVL-ATLLATGTILILEISDRTIKTLREVRDAFG-YTVIACI
A0A2P8QQ72      --PLLGKRVM---TLGLGGIA-AILLAIATITLLELSDASIKTLREVKQLFG-YTLIGSI
K9TZQ7          --PLLGKRVM---TLGLGGIA-AILLAIATITLLELSDASIKTLREIKQLFG-YTLIGSI
A0A2G7GPR0      --SSVRKRAM---ILALGNVL-ALILAILTICILELSDRSVKTLREARERLD-YTLLGTI
K9XH68          --ASVRKKAM---ILALGNIL-ALILAILTICILELSDRSVKTLREARERLD-YTLLGTI
A0A1U7HW70      --ASVRKKAM---ILALGNIL-ALILAILTICILELSDRSVKTLREARERLD-YTLLGTI
A0A2S6VEJ8      --ASVRKKAM---ILALGNVL-ALILAILTICILELSDRSVKTLREARERLD-YTLLGTI
                                      .                                     

K9SLA9          P----------------------------------DFGYVAKHDQMMRKSAKLAKGSV--
A0A168TT23      P----------------------------------IVKLSEQRKKSGTTTRAEDRAVS--
A0A0M1JWX9      P----------------------------------ISDRAKQLASSSW------------
A0A2T1M1V6      P----------------------------------RLRSLSLEKGLDEKSEVE-------
A0A2G7GCS2      S----------------------------------RLKRTDMERNLSGEVAIE-------
K9XBH8          S----------------------------------RLKRPDMERALSAEVPID-------
A0A1Z4LJ30      P----------------------------------YIKNIHGKLEQKLGGEIE-------
K9RI76          P----------------------------------YVRHINAKADRKLGGEIE-------
A0A352AE27      P----------------------------------RLKQSVVGLGLTTETEVE-------
A0A3B8JH60      P----------------------------------RFKQSDRALKLGTDTEVE-------
A0A3C0N766      P----------------------------------RFKQSDRALKLGTDTEVE-------
K9W9J7          P----------------------------------RLRHSNLSWQVGTETEVE-------
A0A139WSU3      P----------------------------------RIKHSDPKIEMTSVSEVE-------
A0A433VN22      P----------------------------------RIKHSGVISELAIETEVE-------
Q7NF11          P----------------------------------RTKGL---LPSGDPPRLE-------
A0A1Z4JCS8      P----------------------------------KLKRLAIEPNSSFEGEIE-------
F4XTX2          P----------------------------------HLRHAGMGLELGTETDVE-------
Q7NJN6          P----------------------------------KLKDA----ALSAAEAEE-------
U5QCC3          P----------------------------------KFKDN----EL-IATAEE-------
A0A0S3TYD7      P----------------------------------SFTDSGLSQVMESLTKNLQKLGN--
U5QL42          PKTEN------------------------------LTETLVAPSRDGVVIGDR-------
K9QF04          P----------------------------------FQKELKAATNQLTHYG---------
A0A3C0N2P0      PFTKKL---KEDIG---------------------SLSDGSMIDPENLEFQLS-------
K9TLQ0          P----------------------------------FEKDLKESLTVSDGENLV-------
A0A076HBF2      PHVEFFKGVREDKRFLL------------------QELD--RSVTGEDDPE-A-------
A0A354B169      PHVNFFQGVREGKRFQL------------------QELD---QLVANPASE-A-------
G4FMX5          PYVDFFKGVREDKRFPL------------------KELD--SETQADVGET-E-------
Q0IDT5          PHVAFFKGVREDKRFLL------------------NELDQSSNNNATNAPE-S-------
A0A2D6FCW3      PHVDLFKGVREDKRFLL------------------QELD--INNPSEEDQN-T-------
A3ZA21          PHVSFFQGVREDKRFLL------------------QELD---QSVSGGDAD-D-------
A0A140K3H3      P--------------KV------------------EKPLIQVNGETNTKAH---------
K9XUB8          P--------------KV------------------EEPVIQINGETHSRAH---------
Q7NEU3          PFTEEE---DLQAS---------------------SQPQFSKERQKPDLPK---------
A0A352XE00      PFDKVVKNSKKQIKTNS------------------KVYQNSQVNREVLELAFS-------
B4VS56          PFHKPLKKPSKSAKTAG------------------K------LETPLLASPIS-------
A0A352AAQ3      PFGKELKKGIARPVPAA------------------T------PEGQQLESEFN-------
A0A350Y472      PFSKELKKNITRSATPS------------------K------SHSEPLELELR-------
A0A355DVB4      PFSKELKKTITRPATPP------------------K------SHSEPLELELR-------
A0A2P8VVX1      P----RRPSSLPPL---------------------RRSEPDARGLHPELAD-S-------
A0A2P8WHY0      PVQPIRKGFSLPGR---------------------QDGGPPI--LHPELAD-S-------
A0A2T1CMT9      P--------GLSIS-SS------------------NNLLTRLPFRSISSDT-S-------
A0A1D8TX52      P--------ELPEG-KI------------------SKPVLNLSLSQSERAL---------
A0A1U7N5X9      P--------ELPEG-KI------------------SKPVLNLSLSQSEKAL---------
A0A1D9G4T2      P--------ELPEG-KI------------------SKPVLNLSLSQSEKTL---------
F4XP71          P--------QLPEG-KI------------------SKPVLNLGLSQSERTL---------
A0A2P8QVH5      P--------KLPNF-EL------------------KKPSIALPFFKQQSLT-S-------
A0A2T1FT70      P--------KLPNF-EL------------------KKPSIALPFFKQQSLT-S-------
A0A433W4W4      P--------KLPNF-EL------------------KKPSIALPFFKQQSLT-S-------
K9U5W1          P--------KLPNF-EL------------------KKPSIALPFFKQQSLT-S-------
A0A254WLA7      P--------KLPNF-EL------------------KKPSIALPFFKQQSLT-S-------
A0A2W6ZAV2      P--------FLPVQDGL------------------SITEVVEGMEPEARFG---------
A0A2G7GMH8      P--------ELPP----------------------AKPNGLIKLNKQQ----T-------
K9W742          P--------VLPKAKKSEPRMLLPFGKSQALEPVGNQPIIKLPFGKPKVLA-P-------
K9SA61          P--------ELPRSVSV------------------AEPTIKLPLRRSETFT-T-------
A0A350Y7Z1      P--------ELPRT-GG------------------SGLLVHLPFRRTQVAA-A-------
A0A352X2A7      P--------ELPKT-RS------------------SSIFVNLPFRKSSVTE-I-------
K9XPB0          P--------GLPLA-KH------------------DQFVVKLPFLSPKESS---------
A0A0D8ZYV0      P--------EMPQT-KA------------------SEPVVSLPFGKPNVLA-P-------
A0A3D1PBA3      P--------ELPKN-KL------------------AKPQISLPFGKPHLLA-P-------
A0A254WJ87      P--------ELPRG-RV------------------AQPEVSLPFGKPLHLS-P-------
A0A2T1FP73      P--------ELPRG-RV------------------AQPEVSLPFGKPLHLS-P-------
A0A433VMS2      P--------ELPRG-RV------------------AQPEVSLPFGKPLHLS-P-------
K9TYA7          P--------ELPRG-RV------------------AQPEVSLPFGKPLHLS-P-------
A0A2P8QUE1      P--------ELPRG-RV------------------AQPEVSLPFGKPLHLS-P-------
A0A2T1DWE8      P--------ALQYE-GG------------------LAALVPF---REVGVPAP-------
A0A1U7I8L3      P--------QLNPQ-TR------------------TEPIIHLPFRQQPILT-S-------
A0A2T1DJL8      P--------EVPLG-EI------------------NPRSIAMPFQKAENLA-P-------
A0A1Z4J9W0      P--------ELPMS-EL------------------MPTTPNFAFSRNAFEENS-------
A0A0N7Z5K9      P--------ELPMS-EL------------------MPTT-NFAFGRST--GDT-------
A0A0S3TXC5      P--------ELPLS-EL------------------MPTT-NFAFGRSTNAGDT-------
A0A2T1DNG3      P----------------------------------ELSLGAMSGKPSLRLSGQ-------
A0A2P8W9H0      P----------------------------------ISSLLNSGGSVLFAVREINSI----
A0A3S0Y9N9      P----------------------------------PFTNN--------------------
A0A433UNK7      P----------------------------------PFPNG--------------------
B8HNB0          P----------------------------------RSRSSEPHKDTDS------------
A0A1Z4LN32      P----------------------------------KFDTNNAKSNHNIPVGKDKIA----
A0A2I8A9F5      P----------------------------------KFSNNFNTT--QLEDSA--LA----
A0A218Q6R8      P----------------------------------VFETKNISN--TLDTEEPIVE----
A0A0C1XVC4      P----------------------------------KFENNNTST--PLDSS---LE----
A0A218QGE0      P----------------------------------KYE-KNTST--FLDRS---LE----
A0A3B8Y8H9      P----------------------------------QLPRKLLQNKTD-------------
A0A1Z3HMQ0      P----------------------------------KFGLLGNDGPDLELPAGEGISPR--
A0A1E5QP61      P----------------------------------ATKK--RFGFLGFSSRRE--IPL--
A0A3M2GIL5      P----------------------------------KYRK--KGFFFQNKIDQI--TPD--
A0A433NM31      P----------------------------------NFDKIDKLNSRNENPEQT--LPK--
A0A3M1PML8      P----------------------------------AFSRNAKSNVPLGALDYP--APR--
A0A352X442      P----------------------------------AFGKLGNRGFSFKKSEAK--DVR--
A0A0T7BPZ0      P----------------------------------QMNRSSKSSSGTTEIDRQ--IPR--
A0A0M0SHU3      P----------------------------------SVSRTGKSGYSVEGLDRP--VPR--
A0A1D2PBN3      P----------------------------------SINSNSKKSSFLPGVDQP--IPR--
A0A0C2LVR7      P----------------------------------SINSNSKKSSFLPGVDQP--IPR--
A0A1Z4PQB9      P----------------------------------SISSNSTKSSFLRGVDQP--IPR--
A0A1Z4SFN6      P----------------------------------LVGGNGKKSYYLPGADQQ--IPR--
K9PGI8          P----------------------------------LVGRNTKNSSLLPGGEQPFAIPR--
A0A2W1JVB9      P----------------------------------AIEGVQTKIKEKGASVAA--DVKRD
A0A3M1SVZ4      P----------------------------------QVRKSNRLLGHR-------------
K9SSQ0          P----------------------------------YLATNAKLLSPSLELISE--R----
A0A2W1JIN9      P----------------------------------RLSKNTLNLGEPASFYEN--S----
A0A318AJV1      P----------------------------------A--------EGGRRWFRS--R----
A0A254WHG9      P----------------------------------VISPEVRGKEYADALMQE--P----
A0A2P8QIL5      P----------------------------------VISPEVRGKEYADALMQE--P----
A0A2T1FLY5      P----------------------------------VISPEVRGKEYADALMQE--P----
A0A433W447      P----------------------------------VISPEVRGKEYADALMQE--P----
K9U1K8          P----------------------------------VISPEVRGKEYADALMQE--P----
A0A1U7N2U4      P----------------------------------TIPAQALSVEQPKGFLED--M----
A0A1D9G1F2      P----------------------------------KIPAQALSLEQPNRFLED--M----
F4XV38          P----------------------------------KIPAQALSLEQPNRFLED--M----
K9UYB2          P----------------------------------RLPAKATILQPANFFFNE--I----
A0A0C1XJI7      P----------------------------------RLPAKTLVLEPADRFLDD--I----
A0A218QN17      P----------------------------------RLPAKTLVLEPAERFLDN--I----
K9RKN2          P----------------------------------RLPGKTLVLEPSDRFLDQ--V----
A0A2I8ADV2      P----------------------------------RLPATKLTLEPAEKFLDD--V----
A0A1W5CKM3      P----------------------------------RLPATKLSLEPAEQFLDD--L----
Q3MEW0          P----------------------------------RLPATKLSLEPAEQFLDD--L----
A0A1Z4KIC7      P----------------------------------RLPATKLSLEPAEQFLDD--L----
Q8YSM5          P----------------------------------RLPATKLSLEPAEQFLDD--L----
A0A1Q4S1H4      P----------------------------------RLSKSNLALAEADLFLDD--M----
A0A433VBU6      P----------------------------------RLSKSNLALAEADLFLDD--M----
A0A1Q4RZJ6      P----------------------------------RLPAKTLALEPADGFLDN--V----
A0A1Z4SNV3      P----------------------------------RLPDRTLVLNPANRFLDN--V----
A0A2H2XJQ1      P----------------------------------RLPDRTLVLNPANRFLDN--V----
A0A3S5K358      P----------------------------------RLPAKTLALEPADGFLDN--V----
A0A0T7BPJ4      P----------------------------------RLPGSTLKLQSADTFLDD--I----
A0A0C1QS61      P----------------------------------RLPSKTLVLEPSQRFLDN--M----
A0A139X3R8      P----------------------------------RLPSKTLVLEPSHRFLDN--V----
A0A1Z4I7C5      P----------------------------------RLPATKLSLEPAEQFLDD--L----
A0A0C2MDK7      P----------------------------------RLPAKTLVLEPANQFLDN--M----
A0A1Y0RCK1      P----------------------------------RLPAKTLVLKPANQFLDN--I----
A0A1Z4PWZ0      P----------------------------------RLSAKTLVLEPANRFLDN--I----
A0A0C2QLT0      P----------------------------------RLPGKTLVLKPANRFLDN--I----
A0A1Z4J2K1      P----------------------------------RLPAKTLVLEPANRFLDN--I----
A0A3S0ZSX0      P----------------------------------RLPAKTLMLEPSERFLDN--S----
A0A2N6K4T3      P----------------------------------CLPSRAIALEPSVRFLDH--V----
A0A370CKT2      P----------------------------------RLPGHAIALEPSAQFLDH--V----
A0A0S3TL97      P----------------------------------RLPGHAIALEPSAQFLDH--V----
A0A2N6M8A0      P----------------------------------RLPGHAIALEPSAQFLDH--V----
A0A2N6M9E1      P----------------------------------RLPGHAIALEPSAQFLDH--V----
A0A2N6KJI4      P----------------------------------RLPGHAIALEPSAQFLDH--V----
A0A2N6MZ77      P----------------------------------RLPGHAIALEPSAQFLDH--V----
A0A2N6KT20      P----------------------------------RLPGHAIALEPSAQFLDH--V----
G6FSN3          P----------------------------------RLPGHAIALEPSAQFLDH--V----
A0A0D6YL98      P----------------------------------SLPADAIALEPSGQFLDH--L----
A0A328I8B9      P----------------------------------SLPAHAIALEPSGQFLDH--V----
A0A0M0SU69      P----------------------------------RLPADAIALEPSGRFLDH--V----
A0A1Z4TIZ8      P----------------------------------RLPTHAIALESSGRFLDH--V----
A0A318BG22      P----------------------------------TVEGAEI------------------
A0A2T1E9V8      P----------------------------------IFNKI--------------------
A0A0P1C0L3      P----------------------------------KSDAADV------------------
A0A3M2GQQ6      P----------------------------------KVSCPLVSQRKGEGRSLP-------
K9SGJ5          P----------------------------------RTD-------------ML--ELS--
L8MYT6          P----------------------------------MTE-------------VA--SLA--
A0A352JGJ6      P----------------------------------LTE-------------VA--SLS--
A0A1J5GLS2      P----------------------------------ITE-------------VT--SLS--
A0A2W4W6M5      P----------------------------------MTE-------------VA--SLS--
A0A2W7AN33      P----------------------------------FTD-------------PV--ALI--
A0A256BLV2      P----------------------------------MTE-------------VS--SLS--
A0A2W6ZXF3      P----------------------------------MTE-------------VA--SLS--
A0A2Z5WX66      P----------------------------------MTE-------------VA--SLG--
K9W1T3          P----------------------------------IIEHMDSSTTIRFGNQQ--------
A0A0D6YBN8      P----------------------------------R-V-------------------E--
A0A318BJ18      P----------------------------------KTA-------------------E--
A0A1Q4RTR1      P----------------------------------RLSVSRHYRN---------------
A0A1Z4SQV2      P----------------------------------RLSITRPHRN---------------
A0A2H2XGN1      P----------------------------------RLSITRPHRN---------------
A0A433UXH8      P----------------------------------RLSVSRHYRN---------------
A0A1Z4RMB9      P----------------------------------LEPP---------------------
D5A466          P----------------------------------SFADPPFYRY------FT--GGD--
K1XF69          P----------------------------------SFAAPPFYRY------LT--GGD--
B5W297          P----------------------------------SFAAPPFYRY------LT--GGD--
H1W7M8          P----------------------------------SFAAPPFYRY------LT--GGD--
B4WP72          P----------------------------------LFNETSNLHRSKSHSKQL--ASSV-
A0A318B4H2      P----------------------------------KVEDK--------------------
B4WQE3          P----------------------------------YNHLLEGSKASILPRYEA--TRQPI
A0A2K3BR24      P----------------------------------LVKTKM----------------D--
K9YXY1          P----------------------------------LVKTKM----------------D--
A0A2P8W4F7      P----------------------------------NAPALQKQPLLIEPNLAV--TMA--
U5QJM6          P----------------------------------YNDELNTTAKSEKQSKEI--AKISK
A0A1U7HGH0      P----------------------------------LFHNESQTEREQW------------
K9XJD3          P----------------------------------LFHNDSQTEREEW------------
K9SX01          P----------------------------------NFATRKLENLPAF---VL--RNPES
A0A1E5QIR9      P----------------------------------NFE-----KIDKGLSYGK--DGE--
A0A1Z4IBC7      P----------------------------------TLG-----RNSKDESPIP--GLD--
A0A1W5CPC7      P----------------------------------TLG-----RNTKDDIPIP--GLD--
Q3MDC6          P----------------------------------TLG-----RNTKDDIPIP--GLD--
A0A1Z4KM73      P----------------------------------TLG-----RNGKDDTPIP--GLD--
Q8YNX7          P----------------------------------TLG-----RNGKDDTPIP--GLD--
A0A367R4K6      P----------------------------------TLG-----RNGKEHSSIA--GLD--
A0A1E2WSV8      P----------------------------------TQG-----RNGKESSSIA--GLD--
A0A2R5FRT9      P----------------------------------TQS-----KNGKDNPSIA--GLD--
A0A2K8T1B6      P----------------------------------TQS-----RNGRDHSSIA--GLD--
A0A235I9I0      P----------------------------------TQG-----RNGKDHSSIP--GLD--
A0A2D0HQT8      P----------------------------------TQG-----RNGKDHSSIP--GLD--
A0A2L2NU95      P----------------------------------TQA-----RNGKDHSSIA--GLD--
A0A367S084      P----------------------------------AQG-----RNGKDHSSIP--GLD--
A0A0V7ZFJ4      P----------------------------------KTPKTTKGST------------D--
A0A0V7ZNJ9      P----------------------------------QFEGKG----------------F--
A0A367RIS1      P----------------------------------VFEQKDKLAR------------G--
A0A235IXQ2      P----------------------------------VFDQKARLAR------------G--
A0A1W5CNX3      P----------------------------------AFDQKARLAR------------G--
Q3MEB7          P----------------------------------AFDQKARLAR------------G--
A0A1Z4KHN9      P----------------------------------VFDQKVRLAR------------G--
Q8YT70          P----------------------------------VFDQKVRLAR------------G--
A0A218Q4C1      P----------------------------------------KLLR------------D--
A0A166IWU6      P----------------------------------------KMIR------------D--
A0A2S0Q8C0      P----------------------------------------KMIR------------D--
W6FSX4          P----------------------------------------KMIR------------D--
A0A1B7WTD1      P----------------------------------LYGEKK---TKNP---------V--
A0A1B7WX82      P----------------------------------LYGGKN---PKNQ---------E--
A0A0R0M9H9      P----------------------------------QYENTKRRKNQEQ---------E--
A0A1S1ZVW2      P----------------------------------QYENTKRRKNQEQ---------E--
A0A1Z4LRU5      P----------------------------------RVDE--------K---------D--
A0A1Z4JVB4      P----------------------------------KVETAK----GNH---------D--
K9PIA4          P----------------------------------LAEKVK----GSD---------G--
A0A1Z4M597      P----------------------------------QAEKAK----GSE---------G--
A0A1Z4MWT1      P----------------------------------LAEKAK----GSE---------A--
A0A1Z4TX53      P----------------------------------LAEKAK----GSE---------A--
A0A1Z4HVE1      P----------------------------------LAEKVK----DSD---------G--
A0A252ECZ1      P----------------------------------LAEKAK----GSD---------G--
A0A1Z4G5Y1      P----------------------------------LAEKPK----GVD---------G--
A0A252DNA2      P----------------------------------LAEKPK----GSD---------G--
A0A252E1Q4      P----------------------------------LAEKPK----GSD---------G--
A0A2A2TNQ5      P----------------------------------NLAEK-----------------G--
A0A3S1C4K5      P----------------------------------QLGGS-----------------K--
A0A1X4G3D5      P----------------------------------NFETKKRKNKGE----------W--
D4TNI2          P----------------------------------NFETKKRKNKGE----------W--
A0A1Z4H6Z8      P----------------------------------LAEKPKGSN-------------S--
A0A1Z4NPM1      P----------------------------------QLMDKKGK--------------K--
A0A3F3KPR9      P----------------------------------QYENTKRQKNAGG---------E--
D4TGN7          P----------------------------------QYENTKRQKNAGG---------E--
A0A1Z4UZW9      P----------------------------------LYIGKNPKNP------------Q--
A0A0K2M5H0      P----------------------------------QYGEKNPKNR------------Q--
A0A1B7VSH4      P----------------------------------QHGEKNPKNP------------Q--
A0A1B7W126      P----------------------------------QHGEKNPKNR------------Q--
A0A3D4C6Q6      P----------------------------------QHGEKNPKNR------------Q--
K7W0A4          P----------------------------------QYGEKNPKHR------------Q--
A0A1B7UTR1      P----------------------------------LYGGKNPKNQ------------E--
A0A1B7UVJ4      P----------------------------------LYGGKNPKNQ------------E--
A0A2T1CIL7      P----------------------------------DSGYSAETTVSRGMQELS--FATSR
A0A1Z4RPC6      P----------------------------------FDSFQ--------------------
A0A2T1CMZ0      P----------------------------------LDTLQ--------------------
L8M4F7          P----------------------------------IDDDA--------------------
L8LZE9          P----------------------------------ENKFA--------------------
A0A140K2P2      P----------------------------------KHA-A--------------------
K9XWX4          P----------------------------------KHE-A--------------------
A0A140KB14      P----------------------------------QYS-D--------------------
K9XX88          P----------------------------------QYT-D--------------------
A0A433V7A0      P----------------------------------YYG-----SFEKHSSRHK--EIE--
A0A0C2LBE2      P----------------------------------LTG-----RNQKKSLRVP--EVD--
A0A433NN38      P----------------------------------NLS-----RYGKT--LTG--RLD--
A0A2N6K0T2      P----------------------------------SVS-----KTSKNNYSVQ--GLD--
A0A2N6ML72      P----------------------------------NVS-----RNNKNSYSVQ--GLD--
G6FQZ6          P----------------------------------NVS-----RNNKNSYSVQ--GLD--
A0A2N6MQX9      P----------------------------------NVS-----RNNKNSYSVQ--GLD--
A0A2N6KXT6      P----------------------------------NVS-----RNNKNSYSVQ--GLD--
A0A2N6KGB9      P----------------------------------NVS-----RNNKNSYSVQ--GLD--
A0A2N6L3Y5      P----------------------------------NVS-----RNNKNSYSVQ--GLD--
A0A0S3TIS7      P----------------------------------NVS-----RNTKNSYSVQ--GLD--
A0A1U7GW28      P----------------------------------NVS-----RNTKNSYSVQ--GLD--
A0A2N6LW63      P----------------------------------NVS-----RNTKNSYSVQ--GLD--
A0A1Z4TQ63      P----------------------------------SVS-----RSGKSSYSVE--GLD--
A0A0D6YFE2      P----------------------------------SVS-----RSGKSSYSVE--GLD--
A0A328IH74      P----------------------------------SVS-----RSGKNSYSVE--GLD--
A0A1Z4NDS1      P----------------------------------QIPRNSKRKSEQP---------E--
K9F4D9          P----------------------------------AWKRGN----------AK--G----
U9VXM0          P----------------------------------AWKRNN----------AK--G----
A0A2T1FTR8      P----------------------------------VFEKSRQLPKLSK---GA--A----
K9UA41          P----------------------------------VFEKSRQLPKLSK---GA--A----
A0A1Z4SMD6      P----------------------------------KFEPSPSTVPSIK------------
A0A2H2Y096      P----------------------------------KFEPSPSTVPSIK------------
K9S8M8          P----------------------------------RSKKKRWWFGSGS---------N--
A0A1Z4NFV0      P----------------------------------RFDSSV--SSNRS---EE--LFA--
B0CAX4          P----------------------------------LLKDAEKMTRKGL---------D--
U5DPF5          P----------------------------------LFGRFN----------RP--VDG--
A0A350Y0P6      P----------------------------------ESRKKGFFWRQKL---------N--
A0A352X940      P----------------------------------NLRKKGLLSRRKS---------D--
B8HTN4          P----------------------------------FDKAAA--TANKAFKPTQ--GLE--
A0A2A2TPF8      P----------------------------------KFETN-----------NN--AIAQT
A0A1Z4R0P8      P----------------------------------KFSTN-----------NA--AIEQI
A0A0T7BUI3      P----------------------------------RFEAN-----------HK--SVAAN
A0A1Z4LP32      P----------------------------------KFEPN-----------SK--SLDSN
K9REP9          P----------------------------------KFEPD-----------SK--STDSN
A0A1Z4SIJ3      P----------------------------------KFESN------NQ---DS--SKETR
A0A2H2XPG4      P----------------------------------KFESN------NQ---DS--SKETR
K9V3C7          P----------------------------------KFDAN-----------ST--SLIEE
A0A1Z4T6Y7      P----------------------------------KFE-N-----------AP--TIEQT
A0A2H2Y561      P----------------------------------KFE-N-----------AP--TIEQT
A0A1Q4S362      P----------------------------------KFDTN-----------SA--SIQQT
A0A3S1CIN8      P----------------------------------KFDTN-----------SA--SIEQT
A0A2A2TC28      P----------------------------------KFEPN------NT---HS--SLHQ-
A0A0C1NCB0      P----------------------------------TFESSTKSSSESS---TK--SSSDR
A0A2N6K7Q9      P----------------------------------KYKPN------NS---VS--GVQ--
A0A2N6MXH6      P----------------------------------KYKLN------NS---VS--GVQ--
A0A2N6M5A8      P----------------------------------KYKLN------NS---VS--GVQ--
A0A2N6LL61      P----------------------------------KYKLN------NS---VS--GVQ--
A0A0S3TP66      P----------------------------------KYKLN------NS---VS--GVQ--
G6FP91          P----------------------------------KYKLN------NS---VS--GVQ--
A0A1U7GYR5      P----------------------------------KYKLN------NS---VS--GVQ--
A0A2N6KY52      P----------------------------------KYKLN------NS---VS--GVQ--
A0A2N6KMP5      P----------------------------------KYKLN------NS---VS--GVQ--
A0A2N6MA45      P----------------------------------KYKLN------NS---VS--GVQ--
A0A1Z4TLC8      P----------------------------------KYKPN------NF---VN--AVQDV
A0A0M0SFT2      P----------------------------------KYKPN------NF---VN--AVQ--
A0A0D6Y7R4      P----------------------------------KYKPN------NF---VS--AVQ--
A0A328IGA1      P----------------------------------KYKPN------NF---VS--AVQ--
A0A0C2LFH0      P----------------------------------KFESK------KT---SA--PVN--
A0A1Z4IYV4      P----------------------------------KFESN------TT---ST--PDK--
A0A1Z4Q0T6      P----------------------------------KFESN------ST---SA--PTK--
A0A0C2PT44      P----------------------------------KFESN------ST---SA--ATK--
A0A1D2P6J4      P----------------------------------KFESN------ST---SA--PAE--
A0A3M9ZEU1      P----------------------------------DYT-----KLGASG--RK--SAE--
A0A1Z4JK72      P----------------------------------KFE-----TSDTPTIVSP--SAD--
A0A0N7Z489      P----------------------------------RFE-----TSDTPTILSP--GAD--
A0A0S3TXS2      P----------------------------------RFE-----TSDTPTILSP--GAD--
A0A1Z4RN12      P----------------------------------NLNLTG--ERKQLQLPGN--S-T--
A0A2T1CMF9      P----------------------------------DLSLGG--NNQQFQLPGS--E-K--
Q7NDC5          P----------------------------------RWN-AQ----------------S--
U5QGK3          P----------------------------------RWT-GA----------------E--
A0A2W4UY24      P----------------------------------DWR-KR--TARNR---------E--
A0A254WLE3      P----------------------------------SLT-KK--AAADG---KN--G-E--
A0A433W533      P----------------------------------SLT-KK--AAADG---KN--A-E--
A0A2P8QWJ3      P----------------------------------SLT-KK--AAADG---KS--A-E--
A0A2T1FKP8      P----------------------------------SLT-KK--AAADG---KN--A-E--
K9U6L7          P----------------------------------SLT-KK--AAADG---KN--A-E--
A0A2T1GMT4      P----------------------------------ATQRKK--NRARA---TT--P-E--
K9UI51          P----------------------------------ATQKKK--IRSRA---TT--P-E--
K9TYI2          P----------------------------------LVA-NK--VRSND---GY--V-E--
A0A254W5G5      P----------------------------------LVG-NK--FRSND---WD--V-E--
A0A2T1FXY4      P----------------------------------LVG-NK--VRSND---WD--V-E--
A0A1Z4QL41      P----------------------------------LLA-KK--VPFRH---QK--A-Q--
A0A252D4T4      P----------------------------------SST-KK--LRSRN---RE--T-D--
A0A252DJH5      P----------------------------------SST-KK--LRSRN---RE--T-D--
A0A252EB80      P----------------------------------SST-KK--LRSRN---RE--T-D--
A0A1Z4HPW5      P----------------------------------SST-KK--IRSRY---RE--T-E--
A0A1Z4MSN1      P----------------------------------SST-KK--IRSRY---RE--T-E--
A0A1Z4U1C2      P----------------------------------SST-KK--IRSRY---RE--T-E--
A0A0D6KV51      P----------------------------------SST-KK--IRSRY---RE--T-E--
A0A1Z4MKF8      P----------------------------------SST-KK--IRSRY---RE--T-E--
A0A2C6WC43      P----------------------------------LSV-KK--VRSRF---SS--A-E--
A0A1Z4L5A1      P----------------------------------LSV-KK--VRSRF---SS--A-E--
A0A367QD86      P----------------------------------LSV-KK--VRSRF---SS--A-E--
A0A235IZ96      P----------------------------------LSV-KK--VRSRY---SN--L-E--
A0A2L2NGP0      P----------------------------------LSV-KK--VRSRY---SN--L-E--
A0A2K8SM78      P----------------------------------LSV-KK--VRSRY---SN--L-E--
A0A2R5FPC0      P----------------------------------LSV-KK--VRRD----------S--
K9QM62          P----------------------------------TSP-VS--HKTMSFYLQD--T-E--
A0A1Z4FWI3      P----------------------------------SST-KK--LRSRN---RE--A-E--
A0A1Z4JYE7      P----------------------------------LLP-QK--TISRK---RE--G-E--
A0A140KBA0      P----------------------------------DLA-KEGSPNLLV---GD--V-V--
K9XSG1          P----------------------------------DLE-KEGSPHLLV---GD--V-V--
A0A0F5YE28      P----------------------------------MFK-NK--RFSDY---FQ--G-E--
U7QEH7          P----------------------------------MFK-NK--RLSSY---FQ--G-E--
A0A3S1ATK5      P----------------------------------SLS-KK--SLFWH---QN--A-D--
A0A2Z6CPH0      P----------------------------------LSA-HK--THSRK---LD--TKK--
A0A1Z4GT50      P----------------------------------LST-KK--GRSRN---RD--A-E--
A0A1Z4GIX0      P----------------------------------LST-NK--MRSRE---SD--G-E--
A0A2H6LC24      P----------------------------------LST-NK--MRSRE---SD--G-E--
B2J6N5          P----------------------------------LSV-KK--IHSRY---SN--T-E--
A0A367RMI4      P----------------------------------LSV-KK--LRSRY---SN--A-E--
A0A235HUM0      P----------------------------------LSV-KK--LRSRD---SN--A-E--
A0A2L2NW47      P----------------------------------LSV-KK--LRSRY---SN--A-E--
A0A1E2WUR1      P----------------------------------LSV-KK--LRSRY---SD--T-E--
A0A235IKU3      P----------------------------------LSV-KK--VRSRY---SN--L-E--
F4XKF3          P----------------------------------VFK-HK--KLSRR---RD--D-L--
A0A1D9FX10      P----------------------------------VFK-HK--KLSRR---RD--D-L--
A0A1D8TNX9      P----------------------------------VFK-HK--KLSRR---RD--D-L--
A0A1U7MYU6      P----------------------------------VFK-HK--KLSRR---RD--D-L--
A0A3C0NJ41      P----------------------------------LLG-KK--PRRRT---KH--Q-E--
A0A352AG88      P----------------------------------SLT-KK--GISRS---RD--L-E--
A0A350Y374      P----------------------------------TFG-KK--TVSRF---TA--Q-E--
A0A355DPX0      P----------------------------------TFG-KK--TVPRL---KA--Q-E--
A0A0D8ZUV2      P----------------------------------MLG-KK--ANSRG---KD--A-E--
A0A433VDI0      P----------------------------------ALN-KK--AIPRG---RD--K-E--
A0A3D1PG43      P----------------------------------HV--GKKVGFRNQ---K---Q-E--
A0A2P8QQ72      P----------------------------------QL--GKFIKLKPG---RQ--E-D--
K9TZQ7          P----------------------------------QL--GKFIKLKPE---RQ--Q-D--
A0A2G7GPR0      P----------------------------------YF--GK--RYANR---RN--Q-E--
K9XH68          P----------------------------------YF--GK--RYANR---RN--Q-E--
A0A1U7HW70      P----------------------------------YF--GK--RYANR---RN--Q-E--
A0A2S6VEJ8      P----------------------------------YFG-GK--RFANR---RN--Q-E--
                .                                                           

K9SLA9          ---------------------------------------------LITRDMPQS------
A0A168TT23      ---------------------------------------------HYSELHPKS------
A0A0M1JWX9      ---------------------------------------------IADSNGRERLQDDRD
A0A2T1M1V6      ------------------------------------------------------------
A0A2G7GCS2      ------------------------------------------------------------
K9XBH8          ------------------------------------------------------------
A0A1Z4LJ30      ------------------------------------------------------------
K9RI76          ------------------------------------------------------------
A0A352AE27      ------------------------------------------------------------
A0A3B8JH60      ------------------------------------------------------------
A0A3C0N766      ------------------------------------------------------------
K9W9J7          ------------------------------------------------------------
A0A139WSU3      ------------------------------------------------------------
A0A433VN22      ------------------------------------------------------------
Q7NF11          ------------------------------------------------------------
A0A1Z4JCS8      ------------------------------------------------------------
F4XTX2          ------------------------------------------------------------
Q7NJN6          ------------------------------------------------------------
U5QCC3          ------------------------------------------------------------
A0A0S3TYD7      --------------------------------------LNVVDTELVVRDAPRS------
U5QL42          ---------------------------------------------LVTRQYTRS------
K9QF04          -------------------------------------------------NYTLS------
A0A3C0N2P0      ---------------------------------------------AQSYGYNAS------
K9TLQ0          ---------------------------------------------QASGGYLFS------
A0A076HBF2      ---------------------------------------------AKQRRYQRF------
A0A354B169      ---------------------------------------------FEKYRSQLF------
G4FMX5          ---------------------------------------------RKAARYQRF------
Q0IDT5          ---------------------------------------------RKQDRYQRF------
A0A2D6FCW3      ---------------------------------------------KQKAKYQRF------
A3ZA21          ---------------------------------------------RREQRYQRF------
A0A140K3H3      -------------------------------------------------YYNYS------
K9XUB8          -------------------------------------------------YYNYS------
Q7NEU3          ------------------------------------------------SSLEKS------
A0A352XE00      ---------------------------------------------GYS-RYRPS------
B4VS56          ---------------------------------------------QSTYRYHAS------
A0A352AAQ3      ---------------------------------------------QRSYRYTAS------
A0A350Y472      ---------------------------------------------RRSSRYNAS------
A0A355DVB4      ---------------------------------------------RRSSRYNAS------
A0A2P8VVX1      ---------------------------------------------DLMKTVMWP------
A0A2P8WHY0      ---------------------------------------------DLMQIVQWP------
A0A2T1CMT9      ---------------------------------------------SIQNVIQWQ------
A0A1D8TX52      ---------------------------------------------PMMELLGWR------
A0A1U7N5X9      ---------------------------------------------PMMELLGWR------
A0A1D9G4T2      ---------------------------------------------PMMELLGWR------
F4XP71          ---------------------------------------------PMMELLGWR------
A0A2P8QVH5      ---------------------------------------------QRIQALNWF------
A0A2T1FT70      ---------------------------------------------QRIQALNWF------
A0A433W4W4      ---------------------------------------------QRIQALNWF------
K9U5W1          ---------------------------------------------QRIQALNWF------
A0A254WLA7      ---------------------------------------------QRIQALNWF------
A0A2W6ZAV2      ------------------------------------------------------------
A0A2G7GMH8      ---------------------------------------------QVLPMLCLQ------
K9W742          ---------------------------------------------WTVEVLHWS------
K9SA61          ---------------------------------------------ASLEVIHWP------
A0A350Y7Z1      ---------------------------------------------STLPMVYWL------
A0A352X2A7      ---------------------------------------------STSHLAYSS------
K9XPB0          ----------------------------------------------VQEIINWQ------
A0A0D8ZYV0      ---------------------------------------------WTVQVSNWP------
A0A3D1PBA3      ---------------------------------------------WTVQVSNWP------
A0A254WJ87      ---------------------------------------------WTVQVRNWP------
A0A2T1FP73      ---------------------------------------------WTVQVRNWP------
A0A433VMS2      ---------------------------------------------WTVQVRNWP------
K9TYA7          ---------------------------------------------WTVQVRNWP------
A0A2P8QUE1      ---------------------------------------------WTVQVRNWP------
A0A2T1DWE8      ---------------------------------------------PIMQVIHWQ------
A0A1U7I8L3      ---------------------------------------------STIELISWQ------
A0A2T1DJL8      ---------------------------------------------SMMQVIHWA------
A0A1Z4J9W0      ---------------------------------------------SMLQVLHWA------
A0A0N7Z5K9      ---------------------------------------------SMLQVLHWA------
A0A0S3TXC5      ---------------------------------------------SMLQVLHWA------
A0A2T1DNG3      ---------------------------------------------TQALLPPITQLTKWR
A0A2P8W9H0      --------------------------------------GLTSDFSLPPLSYELRTDQVAM
A0A3S0Y9N9      --------------------------------------SPIPE--VVVKNKPDS------
A0A433UNK7      --------------------------------------NFIPE--VIVKNQPDS------
B8HNB0          ------------------------------------------------------------
A0A1Z4LN32      --------------------------------------GVSER--VIVATSPRT------
A0A2I8A9F5      --------------------------------------EPARR--VIVETTPRS------
A0A218Q6R8      --------------------------------------QFSPR--IVVETSPRS------
A0A0C1XVC4      --------------------------------------KVSQR--IIVATSPRT------
A0A218QGE0      --------------------------------------KVSER--IIVATSPRT------
A0A3B8Y8H9      ---------------------------------------------FPGSNPNFS------
A0A1Z3HMQ0      ---------------------------------------------VIAFSQTQP------
A0A1E5QP61      ---------------------------------------------LPTRDQPTT------
A0A3M2GIL5      ---------------------------------------------LPVRDRPHW------
A0A433NM31      ---------------------------------------------IPVKCTPRS------
A0A3M1PML8      ---------------------------------------------VVVRDMPQS------
A0A352X442      ---------------------------------------------LVARDTPGS------
A0A0T7BPZ0      ---------------------------------------------VIGRDVPSF------
A0A0M0SHU3      ---------------------------------------------VIGRDVPHF------
A0A1D2PBN3      ---------------------------------------------VIGTDIPQF------
A0A0C2LVR7      ---------------------------------------------VIGTDIPQF------
A0A1Z4PQB9      ---------------------------------------------VIGTDIPQF------
A0A1Z4SFN6      ---------------------------------------------VIGRDIPHF------
K9PGI8          ---------------------------------------------LIGRDIPHY------
A0A2W1JVB9      ---------------------------------------------LYVRDTPNS------
A0A3M1SVZ4      --------------------------------------RSIPQ--IIVRDNPRS------
K9SSQ0          ------------------------------------------------------------
A0A2W1JIN9      ------------------------------------------------------------
A0A318AJV1      ------------------------------------------------------------
A0A254WHG9      ------------------------------------------------------------
A0A2P8QIL5      ------------------------------------------------------------
A0A2T1FLY5      ------------------------------------------------------------
A0A433W447      ------------------------------------------------------------
K9U1K8          ------------------------------------------------------------
A0A1U7N2U4      ------------------------------------------------------------
A0A1D9G1F2      ------------------------------------------------------------
F4XV38          ------------------------------------------------------------
K9UYB2          ------------------------------------------------------------
A0A0C1XJI7      ------------------------------------------------------------
A0A218QN17      ------------------------------------------------------------
K9RKN2          ------------------------------------------------------------
A0A2I8ADV2      ------------------------------------------------------------
A0A1W5CKM3      ------------------------------------------------------------
Q3MEW0          ------------------------------------------------------------
A0A1Z4KIC7      ------------------------------------------------------------
Q8YSM5          ------------------------------------------------------------
A0A1Q4S1H4      ------------------------------------------------------------
A0A433VBU6      ------------------------------------------------------------
A0A1Q4RZJ6      ------------------------------------------------------------
A0A1Z4SNV3      ------------------------------------------------------------
A0A2H2XJQ1      ------------------------------------------------------------
A0A3S5K358      ------------------------------------------------------------
A0A0T7BPJ4      ------------------------------------------------------------
A0A0C1QS61      ------------------------------------------------------------
A0A139X3R8      ------------------------------------------------------------
A0A1Z4I7C5      ------------------------------------------------------------
A0A0C2MDK7      ------------------------------------------------------------
A0A1Y0RCK1      ------------------------------------------------------------
A0A1Z4PWZ0      ------------------------------------------------------------
A0A0C2QLT0      ------------------------------------------------------------
A0A1Z4J2K1      ------------------------------------------------------------
A0A3S0ZSX0      ------------------------------------------------------------
A0A2N6K4T3      ------------------------------------------------------------
A0A370CKT2      ------------------------------------------------------------
A0A0S3TL97      ------------------------------------------------------------
A0A2N6M8A0      ------------------------------------------------------------
A0A2N6M9E1      ------------------------------------------------------------
A0A2N6KJI4      ------------------------------------------------------------
A0A2N6MZ77      ------------------------------------------------------------
A0A2N6KT20      ------------------------------------------------------------
G6FSN3          ------------------------------------------------------------
A0A0D6YL98      ------------------------------------------------------------
A0A328I8B9      ------------------------------------------------------------
A0A0M0SU69      ------------------------------------------------------------
A0A1Z4TIZ8      ------------------------------------------------------------
A0A318BG22      ---------------------------------------------PALLANKRS------
A0A2T1E9V8      --------------------------------------AEIGSGAVPVIEDPRA------
A0A0P1C0L3      ---------------------------------------------LKDLINSAS------
A0A3M2GQQ6      --------------------------------------SYYTE-----------------
K9SGJ5          --------------------------------------PVVEKETALAPSMMHS------
L8MYT6          --------------------------------------PLLSQ--GILPTSSYY------
A0A352JGJ6      --------------------------------------AMVSQ--GILPTSSYY------
A0A1J5GLS2      --------------------------------------AMVGQ--SILPSSSYY------
A0A2W4W6M5      --------------------------------------AMISH--GILPTSSYY------
A0A2W7AN33      --------------------------------------SM-AK--GQFPNNNYH------
A0A256BLV2      --------------------------------------AATNQ--GILPSSSYY------
A0A2W6ZXF3      --------------------------------------AMISQ--GILPSSSYY------
A0A2Z5WX66      --------------------------------------AMLSQ--GILPTSSYY------
K9W1T3          --------------------------------------RIVPS--IVVTNTAGS------
A0A0D6YBN8      --------------------------------------GIEPR--EALLDRKSD------
A0A318BJ18      --------------------------------------GTTPR--EQLLDRKSN------
A0A1Q4RTR1      --------------------------------------RHIST--LPIRDNPWS------
A0A1Z4SQV2      --------------------------------------RDIST--LPIRDNPWS------
A0A2H2XGN1      --------------------------------------RDIST--LPIRDNPWS------
A0A433UXH8      --------------------------------------RDIST--LPIRDNPWS------
A0A1Z4RMB9      --------------------------------------SYQGR--IITREEPDS------
D5A466          --------------------------------------RSSVQ--VPVVDTPGS------
K1XF69          --------------------------------------RSSVQ--VPVVDTPGS------
B5W297          --------------------------------------RSSVQ--VPVVDTPGS------
H1W7M8          --------------------------------------RSSVQ--VPVVDTPGS------
B4WP72          --------------------------------------FSNVR--TRSRNVHAS------
A0A318B4H2      --------------------------------------DVAEE--LQNKKT---------
B4WQE3          --------------------------------------YFNEG--VQHLDRTTG------
A0A2K3BR24      --------------------------------------NTSSF--LPLRDLPQS------
K9YXY1          --------------------------------------DTSSF--LPLRDLPQS------
A0A2P8W4F7      --------------------------------------DVLTQ--SQSPEKLYTSF----
U5QJM6          --------------------------------------KAKSN--GRVQNPPYTRS----
A0A1U7HGH0      ------------------------------------------R--VPVLAEPRS------
K9XJD3          ------------------------------------------Q--VPVLAEPRS------
K9SX01          VLSKLYLKIRKSKAYRSFASSLESFKISILNAVSEPENTTALT--VFVRDNPRA------
A0A1E5QIR9      --------------------------------------RVKAK--LPVKDAPRS------
A0A1Z4IBC7      --------------------------------------RPVPK--IIGRDIPYF------
A0A1W5CPC7      --------------------------------------RAVPK--IIGRDIPYF------
Q3MDC6          --------------------------------------RAVPK--IIGRDIPYF------
A0A1Z4KM73      --------------------------------------RAVPK--IIGRDIPYF------
Q8YNX7          --------------------------------------RAVPK--IIGRDIPYF------
A0A367R4K6      --------------------------------------RPIPK--IIGRDIPYF------
A0A1E2WSV8      --------------------------------------RAIPK--IIGRDIPYF------
A0A2R5FRT9      --------------------------------------RAIPK--IIGRDIPYF------
A0A2K8T1B6      --------------------------------------RPIPK--IIGRDIPYF------
A0A235I9I0      --------------------------------------RAIPK--IIGRDIPYF------
A0A2D0HQT8      --------------------------------------RPIPK--IIGRDIPYF------
A0A2L2NU95      --------------------------------------RPIPK--IIGRDIPYF------
A0A367S084      --------------------------------------RPIPK--IIGRDIPYF------
A0A0V7ZFJ4      --------------------------------------NQEIE--LPVLDNPYS------
A0A0V7ZNJ9      --------------------------------------DGNPE--LPTLNNPYS------
A0A367RIS1      --------------------------------------ESITE--LPVLNNPYS------
A0A235IXQ2      --------------------------------------ENITE--LPVLNNPYS------
A0A1W5CNX3      --------------------------------------ESITE--LPVLNNPYS------
Q3MEB7          --------------------------------------ESITE--LPVLNNPYS------
A0A1Z4KHN9      --------------------------------------ESITE--LPVLNNPYS------
Q8YT70          --------------------------------------ESITE--LPVLNNPYS------
A0A218Q4C1      --------------------------------------EHTTE--LPLLDNPYS------
A0A166IWU6      --------------------------------------DNTSE--LPLLNNPYS------
A0A2S0Q8C0      --------------------------------------DNTSE--LPLLNNPYS------
W6FSX4          --------------------------------------DNTSE--LPLLNNPYS------
A0A1B7WTD1      --------------------------------------EGLLE--VPLLDQPYS------
A0A1B7WX82      --------------------------------------ESRRE--LPLLDNIYS------
A0A0R0M9H9      --------------------------------------ENQRE--LPVLDNPYS------
A0A1S1ZVW2      --------------------------------------ENQRE--LPVLDNPYS------
A0A1Z4LRU5      --------------------------------------KDRQE--LPVLNNPYS------
A0A1Z4JVB4      --------------------------------------ERTAA--LPVLHNPYS------
K9PIA4          --------------------------------------EGGAE--LPVLNNPYS------
A0A1Z4M597      --------------------------------------VGEVE--LPVLNNPYS------
A0A1Z4MWT1      --------------------------------------ASEQE--LPVLNNPYS------
A0A1Z4TX53      --------------------------------------ASEQE--LPVLNNPYS------
A0A1Z4HVE1      --------------------------------------EEGAE--LPVLNNPYS------
A0A252ECZ1      --------------------------------------EGSTE--LPVLNNPYS------
A0A1Z4G5Y1      --------------------------------------EGSAE--LPVLHNPYS------
A0A252DNA2      --------------------------------------EGSAE--LPTLHNPYS------
A0A252E1Q4      --------------------------------------EGSAE--LPTLHNPYS------
A0A2A2TNQ5      --------------------------------------KMATE--IPARDNPYS------
A0A3S1C4K5      --------------------------------------GNGDD--LPVLKDPYS------
A0A1X4G3D5      --------------------------------------EGEGD--LPLFDQPYS------
D4TNI2          --------------------------------------EGEGD--LPLFDQPYS------
A0A1Z4H6Z8      --------------------------------------EAGSE--LPVLNNPYS------
A0A1Z4NPM1      --------------------------------------AGDEE--LPVLNNPYS------
A0A3F3KPR9      --------------------------------------ESQRE--LPILDNPYS------
D4TGN7          --------------------------------------ESQRE--LPILDNPYS------
A0A1Z4UZW9      --------------------------------------EGRQE--LPVLNNPYS------
A0A0K2M5H0      --------------------------------------EGRQE--LPLLDDPYS------
A0A1B7VSH4      --------------------------------------EGRQE--LPLLDDPYS------
A0A1B7W126      --------------------------------------EGRQE--LPLLDDPYS------
A0A3D4C6Q6      --------------------------------------EGRQE--LPLLDDPYS------
K7W0A4          --------------------------------------EGRQE--LPLLDNPYS------
A0A1B7UTR1      --------------------------------------ESRGE--LPLLDNIYS------
A0A1B7UVJ4      --------------------------------------ESRGE--LPLLDNIYS------
A0A2T1CIL7      DN------------------------------------NSSLS--IPDLNLAAV------
A0A1Z4RPC6      --------------------------------------DSHGS--IIVQREPDS------
A0A2T1CMZ0      --------------------------------------NNRGG--LVVQREPDS------
L8M4F7          --------------------------------------RSKRR--VVVEQSPDS------
L8LZE9          --------------------------------------KREDG--IMVQQDPDS------
A0A140K2P2      --------------------------------------EENQG--IIVQKQPDS------
K9XWX4          --------------------------------------EDNQG--IIVHKQPDS------
A0A140KB14      --------------------------------------DEPNG--IVVQREPDS------
K9XX88          --------------------------------------DEPNG--IVVQREPDS------
A0A433V7A0      --------------------------------------QTALN--VHVRDNSRS------
A0A0C2LBE2      --------------------------------------QSIPK--VIGRDIPHF------
A0A433NN38      --------------------------------------RPTPR--VIGRDIHLF------
A0A2N6K0T2      --------------------------------------RPIPR--VVGRDIPHF------
A0A2N6ML72      --------------------------------------RPIPR--VVGRDIPHF------
G6FQZ6          --------------------------------------RPIPR--VVGRDIPHF------
A0A2N6MQX9      --------------------------------------RPIPR--VVGRDIPHF------
A0A2N6KXT6      --------------------------------------RPIPR--VVGRDIPHF------
A0A2N6KGB9      --------------------------------------RPIPR--VVGRDIPHF------
A0A2N6L3Y5      --------------------------------------RPIPR--VVGRDIPHF------
A0A0S3TIS7      --------------------------------------RPIPR--VVGRDIPHF------
A0A1U7GW28      --------------------------------------RPIPR--VVGRDIPHF------
A0A2N6LW63      --------------------------------------RPIPR--VVGRDIPHF------
A0A1Z4TQ63      --------------------------------------RPVPR--VVGRDIPHF------
A0A0D6YFE2      --------------------------------------RPVPR--VVGRDVPYF------
A0A328IH74      --------------------------------------RPVPR--VIGRDVPHF------
A0A1Z4NDS1      --------------------------------------RNLPQ--IVGRDTPQF------
K9F4D9          --------------------------------------SDVPS--ILVKNSEYS------
U9VXM0          --------------------------------------TDVPS--ILVRNTEYS------
A0A2T1FTR8      --------------------------------------RAPGQ--LVLTGMTTG------
K9UA41          --------------------------------------RAPGQ--LVLTGMTTG------
A0A1Z4SMD6      --------------------------------------GISPR--IVIGTYPHT------
A0A2H2Y096      --------------------------------------GISPR--IVIGTYPHT------
K9S8M8          --------------------------------------TSVPK--VVVQEAPHS------
A0A1Z4NFV0      --------------------------------------GVSPR--VIVATTPRS------
B0CAX4          --------------------------------------RPTPD--LVVRDSPRS------
U5DPF5          --------------------------------------TRPVT--LPVRDYPRS------
A0A350Y0P6      --------------------------------------GNVPQ--LVVRDVPHG------
A0A352X940      --------------------------------------GDIPQ--LPVRDAPHA------
B8HTN4          --------------------------------------RATPQ--LYLRDQPNS------
A0A2A2TPF8      FIE-----------------------------------AASPR--IIVATLPRS------
A0A1Z4R0P8      SIE-----------------------------------GASPR--VIVGTLPRS------
A0A0T7BUI3      ITDD----------------------------------GISER--VIVNSSPRT------
A0A1Z4LP32      FIDD----------------------------------NISPR--IIVASSPRT------
K9REP9          PIVD----------------------------------TISPR--IIVASSPRT------
A0A1Z4SIJ3      LLGRINGLLAKYQQKNQIVSLPSTNFDSKLLPIRLVGLEVSNR--IIVASAPHT------
A0A2H2XPG4      LLGRINGLLAKYQQKNQIVSLPSTNFDSKLLPIRLVGLEVSNR--IIVASAPHT------
K9V3C7          MSGD----------------------------------GVSPR--IIVATSPRT------
A0A1Z4T6Y7      I--E----------------------------------GASPR--IVVGTLPRS------
A0A2H2Y561      I--E----------------------------------GASPR--IVVGTLPRS------
A0A1Q4S362      M--E----------------------------------GASPR--VIVGTLPRS------
A0A3S1CIN8      M--E----------------------------------GASPR--VVVGTLPRS------
A0A2A2TC28      IMGD----------------------------------NVSPR--VIVASSPRT------
A0A0C1NCB0      LMGE----------------------------------ATSPR--VIVATSPRT------
A0A2N6K7Q9      EIEA----------------------------------GVYPQ--VIATTSPRT------
A0A2N6MXH6      EIEA----------------------------------GVYPQ--VITTTSPRT------
A0A2N6M5A8      EIEA----------------------------------GVYPQ--VITTTSPRT------
A0A2N6LL61      EIEA----------------------------------GVYPQ--VITTTSPRT------
A0A0S3TP66      EIEA----------------------------------GVYPQ--VITTTSPRT------
G6FP91          EIET----------------------------------GVYPQ--VITTTSPRT------
A0A1U7GYR5      EIEA----------------------------------GVYPQ--VITTTSPRT------
A0A2N6KY52      EIET----------------------------------GVYPQ--VITTTSPRT------
A0A2N6KMP5      QIET----------------------------------GVYPQ--VITTTSPRT------
A0A2N6MA45      QIEA----------------------------------GVYPQ--VITTTSPRT------
A0A1Z4TLC8      DVED----------------------------------GVYPQ--VITTTSPRT------
A0A0M0SFT2      DIED----------------------------------GVYPQ--VITTTSPRT------
A0A0D6Y7R4      DIED----------------------------------GVYPQ--VITTTSPRT------
A0A328IGA1      DIED----------------------------------GVYPQ--VITTTSPRT------
A0A0C2LFH0      LMSD----------------------------------KASAR--IIVATSPRS------
A0A1Z4IYV4      LMSE----------------------------------GVSAR--VIVATSPRS------
A0A1Z4Q0T6      LMSE----------------------------------GVSAR--VIVATSPRS------
A0A0C2PT44      LMSE----------------------------------GVSAR--VIVATSPRS------
A0A1D2P6J4      LMSE----------------------------------GVSGR--VIVATSPRS------
A0A3M9ZEU1      --------------------------------------PATLR--IFPRDLPRS------
A0A1Z4JK72      --------------------------------------DISPR--VIAMTSPRS------
A0A0N7Z489      --------------------------------------DISPR--VIAMSTPRS------
A0A0S3TXS2      --------------------------------------DISPR--VIAMTSPRS------
A0A1Z4RN12      --------------------------------------ANLPE--QVTTDASML------
A0A2T1CMF9      --------------------------------------ANLPE--QIVSEVSMM------
Q7NDC5          --------------------------------------VRGPL--MALRD-PLS------
U5QGK3          --------------------------------------GPG-L--VAQSD-PLS------
A0A2W4UY24      --------------------------------------LDAPR--IIVKQRHRV------
A0A254WLE3      --------------------------------------TTAIA--LPVRDTPRA------
A0A433W533      --------------------------------------ATTIA--LPVRDTPRA------
A0A2P8QWJ3      --------------------------------------ATTIA--LPVRDTPRA------
A0A2T1FKP8      --------------------------------------ATTIA--LPVRDTPRA------
K9U6L7          --------------------------------------ATTIA--LPVRDTPRA------
A0A2T1GMT4      --------------------------------------QTTLE--IAVRDTPQS------
K9UI51          --------------------------------------QTTLE--IAVRDTPQS------
K9TYI2          --------------------------------------STIPE--ISVRDKPHS------
A0A254W5G5      --------------------------------------STNLE--IAVRDKPHS------
A0A2T1FXY4      --------------------------------------STNPE--IAVRDKPHS------
A0A1Z4QL41      --------------------------------------TNTQN--IVVRDQPYS------
A0A252D4T4      --------------------------------------LINPE--IAVIDTPHS------
A0A252DJH5      --------------------------------------LINPE--IAVIDTPHS------
A0A252EB80      --------------------------------------LINPE--IAVIDTPHS------
A0A1Z4HPW5      --------------------------------------IATQE--IAVIDSPSS------
A0A1Z4MSN1      --------------------------------------IATQE--IAVIDSPTS------
A0A1Z4U1C2      --------------------------------------IATQE--IAVIDSPTS------
A0A0D6KV51      --------------------------------------IATQE--IAVIDSPSS------
A0A1Z4MKF8      --------------------------------------IATQE--IAVIDSPSS------
A0A2C6WC43      --------------------------------------SITQK--VAVRDMPYS------
A0A1Z4L5A1      --------------------------------------SITQK--VAVRDMPHS------
A0A367QD86      --------------------------------------SITQK--VAVRDMPHS------
A0A235IZ96      --------------------------------------LPTQT--VAVRDTPYS------
A0A2L2NGP0      --------------------------------------LPTQT--VAVRDTPYS------
A0A2K8SM78      --------------------------------------SITQK--IAVRDTPYS------
A0A2R5FPC0      --------------------------------------NVEPK--IAVRDTPYS------
K9QM62          --------------------------------------SITPS--IAVRDRPYS------
A0A1Z4FWI3      --------------------------------------LAPPE--IAVIDTPQS------
A0A1Z4JYE7      --------------------------------------YQIPR--IAVRDTPDS------
A0A140KBA0      --------------------------------------DTLPQ--LPAGQNDSSHHRHAL
K9XSG1          --------------------------------------DTLPQ--LPASQNAHSNNRHVF
A0A0F5YE28      --------------------------------------RASQQ--IPVVEASDS------
U7QEH7          --------------------------------------KATPD--IPVIEASDS------
A0A3S1ATK5      --------------------------------------YITPE--IASKDAPQS------
A0A2Z6CPH0      --------------------------------------LTTPE--IAVRDMPHS------
A0A1Z4GT50      --------------------------------------SITPE--VPVRDTPNS------
A0A1Z4GIX0      --------------------------------------LASPE--IAVRDMPHS------
A0A2H6LC24      --------------------------------------LASPE--IAVRDMPHS------
B2J6N5          --------------------------------------SINQT--IAVRDTPYT------
A0A367RMI4      --------------------------------------SISQT--IAVRDTPHS------
A0A235HUM0      --------------------------------------FTSQT--VAVRDTPHS------
A0A2L2NW47      --------------------------------------SISQT--IAVRDTPHS------
A0A1E2WUR1      --------------------------------------STVQT--IAVRDTPHS------
A0A235IKU3      --------------------------------------LPTQT--VAVRDTPYS------
F4XKF3          --------------------------------------FFGGE--LPVTEQPHS------
A0A1D9FX10      --------------------------------------FFGGE--LPVTEQPHS------
A0A1D8TNX9      --------------------------------------FFGGE--LPVRDQPHS------
A0A1U7MYU6      --------------------------------------FFGGE--LPVTDQPHS------
A0A3C0NJ41      --------------------------------------RTVPE--LPVRDTPRS------
A0A352AG88      --------------------------------------GTIPE--LPVRDTPRL------
A0A350Y374      --------------------------------------RTIPE--LPVRDNPLA------
A0A355DPX0      --------------------------------------RTIPE--LPVRDNPLA------
A0A0D8ZUV2      --------------------------------------ATIPE--LPVRDMPRS------
A0A433VDI0      --------------------------------------WAVPE--LPVRDIPNS------
A0A3D1PG43      --------------------------------------WAVPE--ISVLENSLS------
A0A2P8QQ72      --------------------------------------CPIPE--LAVRNSPRS------
K9TZQ7          --------------------------------------CPVPE--LAVRNSPRS------
A0A2G7GPR0      --------------------------------------WSIPE--LPVINLPRS------
K9XH68          --------------------------------------WSIPE--LPVINLPRS------
A0A1U7HW70      --------------------------------------WSIPE--LPVINLPRS------
A0A2S6VEJ8      --------------------------------------WSIPE--LPVINLPRS------
                                                                            

K9SLA9          -TLAET-----------FRILHTNLK-----FL----EP-GKAPKVIAITSSIAKEGKST
A0A168TT23      -AVSEA-----------FRSLRTSLM-----FS----TP-QGMPKTILMTSPGPGDGKTT
A0A0M1JWX9      FGFLEA-----------FRALNTNIR-----FL----ST-DQPIRAIAVASAVAAEGKST
A0A2T1M1V6      -----------------FQRLAAIVS-----SF-------ELENRRLMITSATRSEGKTT
A0A2G7GCS2      -----------------LQRLASAV-------L-------MLEHQRLLVTSPTSGEGKTT
K9XBH8          -----------------LQRLASAV-------L-------MLEHQRILITSPTAGEGKTT
A0A1Z4LJ30      -----------------FQRLASAVS-----LM-------QLGSGRLMIASATTSEGKTT
K9RI76          -----------------FQRLASAVS-----LM-------QLNSGRLMIASANTEEGKTT
A0A352AE27      -----------------FQRLASAIS-----LQ-------PLKNRRLLVTSATMGEGKTT
A0A3B8JH60      -----------------FQRLASAIS-----LQ-------PLQDHRLLVTSAIMGEGKTT
A0A3C0N766      -----------------FQRLASAIS-----LQ-------PLQDHRLLVTSAIMGEGKTT
K9W9J7          -----------------FQRLASAIS-----LQ-------PLKDHRLLITSAIMGEGKTT
A0A139WSU3      -----------------FQRLASAIS-----LQ-------PLNNRRLLVTSATQGEGKTT
A0A433VN22      -----------------FQRLASAIS-----LQ-------PLENRRLLVTSAIMGEGKTT
Q7NF11          -----------------SRQLASTVS-----LM-------DLPNRRLMITSSTAGEGKTT
A0A1Z4JCS8      -----------------FQRVASAIS-----LQ-------PLKGIRLLIASAITGEGKTT
F4XTX2          -----------------FQRLASVIS-----LR-------SGEDRRILITSAMVSEGKTT
Q7NJN6          -----------------FRQLASVVS-----LL-------PLPARRLMITSANTGEGKTT
U5QCC3          -----------------FLQLASIVS-----LM-------PLEGQRLMITSSTFGEGKTT
A0A0S3TYD7      -APAAA-----------YQMLQSNLK-----YV----SS-DREARAIVVSSCIPSEGKST
U5QL42          -PFKEA-----------LRSLALSLR-----YL----G-SNNSVKTLLFTSSIPAEGKSI
K9QF04          -HYWEA-----------YISLQTNLD-----FL----D-PDKPLKSLVISSALPGEGKST
A0A3C0N2P0      -PLLES-----------FRSLNTNLQ-----FV----S-PDEAVRSVVISSATPGDGKST
K9TLQ0          -RFFEA-----------FRSLHADLY-----FM----S-PDRPLKSIVISSTLPAEGKTT
A0A076HBF2      -LYQEA-----------FRNLFTSIR-----FL----N-SDQPLRSIALTSSLPAEGKSL
A0A354B169      -YCQEA-----------FRSLFTSLR-----FL----N-SEKPLRLIAISSSLPREGKSL
G4FMX5          -FYQEA-----------FRNLFTSLR-----FL----N-SDRPLRSIALTSSLPAEGKSL
Q0IDT5          -FYQEA-----------FRNLFTSLR-----FL----N-TERPLKAVALTSSLPAEGKSL
A0A2D6FCW3      -FYQEA-----------FRNLFTSIR-----FL----N-SDQPLRSIAITSSLPAEGKSL
A3ZA21          -FYQEA-----------FRNLFTSIR-----FL----N-SDRPLRAIALTSSLPAEGKSL
A0A140K3H3      -SFTEG-----------LRTLAMNLR-----YT----LTEKGKINSLALTSATSAEGKTT
K9XUB8          -SFTEG-----------LRALAMNLR-----YT----ITETGKINSLALTSSTSAEGKTT
Q7NEU3          -MLREA-----------FRSLLTNLR-----FL----S-SDRKLKVFVVSSSMPGEGKST
A0A352XE00      -PFLEA-----------FRSLHTNLN-----FI----S-PDRPIRSLVMSSAVPADGKST
B4VS56          -PFLEA-----------FRSLQTNLQ-----FI----S-PDQPIRSVVISSAVPADGKST
A0A352AAQ3      -PVLEA-----------FRSLHANLH-----FL----S-PDRPIRSLVMSSAVPADGKST
A0A350Y472      -PLLEA-----------FRSLHANLH-----FL----S-PDKSIRSLVVSSAVPADGKST
A0A355DVB4      -PLLEA-----------FRSLHANLH-----FL----S-PDKTIRSLVVSSAVPADGKST
A0A2P8VVX1      -QFRDS-----------LDLIANNLQ-----LL----Q-NSHPSKAIAITSALPGEGKTT
A0A2P8WHY0      -TFREA-----------LDLVANNVQ-----LM----L-KGKGNQAIAVTSSLPSEGKTT
A0A2T1CMT9      -PFREA-----------IDLIYENLK-----LAYLNSSLVGSALKSIAITSAVAGEGKST
A0A1D8TX52      -PFQEA-----------LDMIYVNIQ-----LL----N-PGSEWKSLMVTSALSGEGKST
A0A1U7N5X9      -PFQEA-----------LDMIYVNIQ-----LL----N-SGSEWKSLMVTSALSGEGKST
A0A1D9G4T2      -PFQEA-----------LDMIYVNIQ-----LL----N-SGSEWKSLMVTSALSGEGKST
F4XP71          -PFQEA-----------LDMIYVNIQ-----LL----N-SGSELKSLMVTSALSGEGKST
A0A2P8QVH5      -PFRES-----------MDLIYQNIQ-----IL----G-SPLSFKSLLLTSALTGEGKST
A0A2T1FT70      -PFRES-----------MDLIYQNIQ-----IL----G-SPLSFKSLLLTSALTGEGKST
A0A433W4W4      -PFRES-----------MDLIYQNIQ-----IL----G-SPLSFKSLLLTSALTGEGKST
K9U5W1          -PFRES-----------MDLIYQNIQ-----IL----G-SPLSFKSLLLTSALTGEGKST
A0A254WLA7      -PFRES-----------MDLIYQNIQ-----IL----G-SPLSFKSLLLTSALTGEGKST
A0A2W6ZAV2      --LRES-----------LRNLFSSFR-----LL----R-ADKVVRLFSVTSTVELEGKST
A0A2G7GMH8      -SFRDA-----------LDLIYKNIR-----LL----T--AFPVKSLAVTSALAGEGKTT
K9W742          -PSWQS-----------LDLIYKNIQ-----LL----S-SVSTLRSLMVTSAVAGEGKST
K9SA61          -PFRES-----------MDLIYQNIQ-----LL----N-AASPLKSIVVTSALAGEGKST
A0A350Y7Z1      -PFRES-----------LDLIYKHIQ-----LL----N-SSATLRSIVVTSALPSEGKST
A0A352X2A7      -AFRES-----------LDLIYKNIQ-----LV----N-AGRLLKSLAVTSALSGEGKST
K9XPB0          -PFRES-----------LDLIYENLQ-----RL----G-SGFAFKSLLLTSAVAGEGKST
A0A0D8ZYV0      -PSWES-----------LDLIYKNIQ-----LL----NTAVASLQSIMVTSAVAGEGKST
A0A3D1PBA3      -PTWES-----------LDLIYKNIQ-----LM----N-ELASFKSLMVTSAVAGEGKST
A0A254WJ87      -PSWES-----------LDLIYRNLQ-----LM----N-EMAAFKSLVVTSAVAGEGKST
A0A2T1FP73      -PSWES-----------LDLIYRNLQ-----LM----N-EMAAFKSLVVTSAVAGEGKST
A0A433VMS2      -PSWES-----------LDLIYRNLQ-----LM----N-EMAAFKSLVVTSAVAGEGKST
K9TYA7          -PSWES-----------LDLIYRNLQ-----LM----N-EMAAFKSLVVTSAVAGEGKST
A0A2P8QUE1      -PSWES-----------LDLIYRNLQ-----LM----N-EMAAFKSLVVTSAVAGEGKST
A0A2T1DWE8      -PFRES-----------LDLIYKNIQ-----LL----P-SAAGLRSLVVTSALAGEGKST
A0A1U7I8L3      -PFRES-----------LDLIYQNIQ-----LV----N-STGSLKSLVITSALAGEGKSA
A0A2T1DJL8      -PFRES-----------LDLIYKNIQ-----LL----T-AANPLRSLVVTSALAGEGKST
A0A1Z4J9W0      -PFRES-----------LDLIYKNLQ-----LM----T-DGDPLKSLVVTSALAGEGKST
A0A0N7Z5K9      -PFRES-----------LDLIYKNLQ-----LM----T-DGDPMRSLVVTSALAGEGKST
A0A0S3TXC5      -PFRES-----------LDLIYKNLQ-----LM----T-DGSPMRSLVVTSALAGEGKST
A0A2T1DNG3      -PFRES-----------LDLLYQNLQ-----LI----NA-TAELHSIVVTSTLAGEGKST
A0A2P8W9H0      -PFLEA-----------FRILATNIR-----LS----NP-EQPLKSITVSSAVPNSGKTT
A0A3S0Y9N9      -PVSEA-----------FRILQTNLR-----FF----NS-KQHIKVIVVSSAVPQEGKST
A0A433UNK7      -SVSEA-----------FRMLQTNLR-----FF----NS-EQSIKVIVVSSSVPKEGKST
B8HNB0          -PFVEA-----------VRSLGLNLR-----YL----SP-DTELRTIAFTSTIPSEGKST
A0A1Z4LN32      -VIHEA-----------YQMLQANLK-----FI----SL-DRKIRSIAVTSSVAGEGKTE
A0A2I8A9F5      -MIHES-----------FGMLQANLK-----FI----SL-DKKIRTIAVTSSIAGEGKSE
A0A218Q6R8      -VIHES-----------YQMLQANLK-----FM----SL-DKKVRTIVVTSSVPGEGKSE
A0A0C1XVC4      -VIHEA-----------YQMLQANLK-----FI----SL-DRKISTIVVTSSVSGEGKTE
A0A218QGE0      -VIHEA-----------YQMLQANLK-----FI----SL-DRKVSAIVVTSSISGEGKTE
A0A3B8Y8H9      -LFLEA-----------FLGLQTNLV-----LL----NP-KQTIKSLTISSAIPEEGKST
A0A1Z3HMQ0      -MVTAA-----------YQMLQANLK-----FI----SS-DTPRRALTLTSSVPQEGKSE
A0A1E5QP61      -YTSEA-----------YRTLQANLK-----FI----SP-DREIRIIVVTSAVSQEGKST
A0A3M2GIL5      -VVSET-----------YRMLQANLR-----FL----SP-DKELKTIVVTSSMAKEGKSA
A0A433NM31      -MISEI-----------YGMIYANLK-----FL----GS-DQELRVITITSAVPKEGKST
A0A3M1PML8      -PIAAS-----------YQMLQANLK-----FL----SS-DKAVRSFVITSSVAQEGKSE
A0A352X442      -PIAQA-----------YQMLRANLK-----FL----SS-DKQIKAIVVTSSVPQEGKSE
A0A0T7BPZ0      -PMDEV-----------YQMLQANLK-----FL-----S-DRRIKAIAVTSSIPKEGKSE
A0A0M0SHU3      -PVGDA-----------YQMLQANLK-----FL-----S-DKQLKAITVTSSIPKEGKSE
A0A1D2PBN3      -PVGDA-----------YQMLQANLK-----FL----SS-DKQLKAIVVTSSVAKEGKSE
A0A0C2LVR7      -PVGDA-----------YQMLQANLM-----FL----SS-DNQLKAIVVTSSVAKEGKSE
A0A1Z4PQB9      -PVGDA-----------YQMLQANLK-----FL----SS-DNELKAIVVTSSVPKEGKSE
A0A1Z4SFN6      -PVGDA-----------YQILQANLK-----FL----SS-DKKLKAIVVSSCVSKEGKSE
K9PGI8          -PIGNA-----------YQMLQANLK-----FL----GS-DEELKAIAVTSSVAKEGKSE
A0A2W1JVB9      -PPSEA-----------VRMVQSNLK-----YL----NS-DKPLKVIVMTSGIPSEGKST
A0A3M1SVZ4      -LISEA-----------YRMLQTKLK-----FA----CA-EQSVKTIVVTSAIAKEGKST
K9SSQ0          -AFLPH-----SYNHSAFTEAVNSLALNIQNLA----AQ--RTFKTIAFTSSIPSEGKST
A0A2W1JIN9      -AILEA-----------YRALFKALE-----FR----GL--EEFHTLVVSSAISGEGKSV
A0A318AJV1      -GRVSPADLIGVAGATVYSEAIRNLRASLIGVR----QA--SGMRVIGFTSALPGEGKSN
A0A254WHG9      -AILES-----------YRSLLRSSE-----FS----AN--EDIKVIVISSALSGEGKSL
A0A2P8QIL5      -AILES-----------YRSLLRSSE-----FA----AN--EDIKVIVVSSALSGEGKSL
A0A2T1FLY5      -AILES-----------YRSLLRSSE-----FA----AN--EDIKVIVVSSALSGEGKSL
A0A433W447      -AILES-----------YRSLLRSSE-----FA----AN--EDIKVIVVSSALSGEGKSL
K9U1K8          -AILES-----------YRSLLRSSE-----FA----AN--EDIKVIVVSSALSGEGKSL
A0A1U7N2U4      -RLMEP-----------YRLLLTTME-----LR----AQ--KRLQLIVVSSAVSGEGKSV
A0A1D9G1F2      -RLMEP-----------YRLLLTTME-----LR----AQ--KRLQLIVVSSAVSGEGKSV
F4XV38          -RLMEP-----------YRLLLTTME-----LR----AQ--KRLQLIVVSSAVSGEGKSV
K9UYB2          -SLVEP-----------YRMLFKNLE-----FS----TA--ENLHLFVVSSTISGEGKSI
A0A0C1XJI7      -GLVEP-----------YRMLLKTLE-----FR----ST--DKVQVIVVSSTLSGEGKSI
A0A218QN17      -SLVEP-----------YRMLLKTLE-----FR----SN--DKVQVIVVSSTLSGEGKSI
K9RKN2          -GLVEP-----------YRMLFKTLE-----FR----SD--DELQKIVVSSTISGEGKSV
A0A2I8ADV2      -GLVEP-----------YRMLLKNLE-----FR----SH--EKLQVVVVTSTISGEGKSV
A0A1W5CKM3      -GLVEP-----------YRMLLKNLE-----FR----NV--DNLQVIVVSSPLAGEGKSV
Q3MEW0          -GLVEP-----------YRMLLKNLE-----FR----NV--DNLQVIVVSSPLAGEGKSV
A0A1Z4KIC7      -GLVEP-----------YRMLLKNLE-----FR----NV--DNLQVIVVSSPLSGEGKSV
Q8YSM5          -GLVEP-----------YRMLLKNLE-----FR----NV--DNLQVIVVSSPLSGEGKSV
A0A1Q4S1H4      -GLVEP-----------YRMLLKTLE-----CR----SP--GKLHLVVVSSALSSEGKSV
A0A433VBU6      -GLVEP-----------YRMLLKTLE-----CR----SA--SKLHSIVVSSALSGEGKSV
A0A1Q4RZJ6      -ALVEP-----------YRMLFKSLE-----FR----TS--E-LQLLVVSSTISGEGKSI
A0A1Z4SNV3      -GLVEP-----------YRMLFKSLE-----FR----TS--E-LQLLVVSSTISGEGKSI
A0A2H2XJQ1      -GLVEP-----------YRMLFKSLE-----FR----TS--E-LQLLVVSSTISGEGKSI
A0A3S5K358      -ALVEP-----------YRMLFKSLE-----FR----TS--E-LQLLVVSSTISGEGKSI
A0A0T7BPJ4      -GSVEP-----------YRMLLKNIE-----FR----NL--EDLNSIVISSTISGEGKSV
A0A0C1QS61      -SLVEP-----------YRMLFKTLE-----FR----S---DRMRVIVVSSSIAGEGKSI
A0A139X3R8      -SLVEP-----------YRMLFKTLE-----FR----S---DQMRLIVVSSSIAGEGKSI
A0A1Z4I7C5      -GLVEP-----------YRMLLKNLE-----FR----SI--DNLQVIVVSSPLSGEGKSV
A0A0C2MDK7      -ELIEP-----------YRTLFKTLE-----FR----RS--EQLRAIVVSSTISGEGKSV
A0A1Y0RCK1      -SLVEP-----------YRTLFKTLE-----FR----SR--EQLRLIVVSSTISGEGKSV
A0A1Z4PWZ0      -GLVEP-----------YRTLFKTLE-----FR----SS--EQLRLIVVSSPISGEGKSV
A0A0C2QLT0      -GLVEP-----------YRTLFKTLE-----FR----SP--EQVRLIVVSSPISGEGKSV
A0A1Z4J2K1      -GLVEP-----------YRTLFKTLE-----FR----SP--EQVRLIVVSSPISGEGKSV
A0A3S0ZSX0      -ALIEP-----------FRMLFKNLE-----FR----SS--EPLRQIVVSSTISGEGKSV
A0A2N6K4T3      -GLVEP-----------YRTLFKNLE-----FR----SR--ESLRSIVVSSTITGEGKSV
A0A370CKT2      -GLVEP-----------YRTLFKNLE-----FR----SS--EPLRSIVVSSTITGEGKSV
A0A0S3TL97      -GLVEP-----------YRTLFKNLE-----FR----SS--EPLRSIVVSSTITGEGKSV
A0A2N6M8A0      -GLVEP-----------YRTLFKNLE-----FR----SS--EPLRSIVVSSTITGEGKSV
A0A2N6M9E1      -GLVEP-----------YRTLFKNLE-----FR----SS--EPLRSIVVSSTITGEGKSV
A0A2N6KJI4      -GLVEP-----------YRTLFKNLE-----FR----SS--EPLRSIVVSSTITGEGKSV
A0A2N6MZ77      -GLVEP-----------YRTLFKNLE-----FR----SS--EPLRSIVVSSTITGEGKSV
A0A2N6KT20      -GLVEP-----------YRTLFKNLE-----FR----SS--EPLRSIVVSSTITGEGKSV
G6FSN3          -GLVEP-----------YRTLFKNLE-----FR----SS--EPLRSIVVSSTITGEGKSV
A0A0D6YL98      -GLVEP-----------YRTLLKNLE-----FR----NP--ESLRSIVVSSTITGEGKSV
A0A328I8B9      -GLVEP-----------YRTLLKNLE-----FR----NP--ESLGSIVVSSTITGEGKSV
A0A0M0SU69      -GLVEP-----------YRTLFKNLE-----FR----ST--EPLRSIVVSSTVTGEGKSV
A0A1Z4TIZ8      -GLIEP-----------YRTLFKNLE-----FR----SN--EPLRSIVVSSSITGEGKSV
A0A318BG22      -SLSEA-----------YYSIQTALQ-----LA----TP-GGLPRTLLVTSAAMAEGKST
A0A2T1E9V8      -FISES-----------YRMLQFNLE-----VA----SS--KALKVIAITSSVPNEGKST
A0A0P1C0L3      -DLSEA-----------YQATRANLA-----FL----TS-DGAPKLLMLTSSVLAEGKSV
A0A3M2GQQ6      -PFTEA-----------VRSLALNLR-----YL----GA-EDEAKTLALTSATSGEGKST
K9SGJ5          -AFREA-----------LRSLALNLR-----YL----GG-DLSIKSIAFTSAVPSEGKST
L8MYT6          -AFKEA-----------LSSLALNLR-----YL----GT-DNMMKVIAFTSSVPSEGKST
A0A352JGJ6      -AFKEA-----------LSSLALNLR-----YL----GT-DNTMKVIAFTSSVPSEGKST
A0A1J5GLS2      -AFKEA-----------LSSLALNLR-----YL----GT-DNMMKVIAFTSSVPSEGKST
A0A2W4W6M5      -AFKEA-----------LSSLALNLR-----YL----GT-DNMMKVIAFTSSVPSEGKST
A0A2W7AN33      -AFKEA-----------LGSLALNLR-----HL----GM-DNLMKVIAFTSSVPSEGKST
A0A256BLV2      -AFKEA-----------LGSLALNLR-----YL----GT-DNMMKVIAFTSSVPSEGKST
A0A2W6ZXF3      -AFKEA-----------LSSLALNLR-----YL----GT-DNMMKVIAFTSSVPSEGKST
A0A2Z5WX66      -AFKEA-----------LSSLALNLR-----YL----GT-DNTMKVIAFTSSVPSEGKST
K9W1T3          -PISEA-----------YRMIHTSLR-----FM----SL-DNQLKVMVISSSVPKEGKST
A0A0D6YBN8      --LVDA-----------YLAIQTSLG-----FT----TE-HGVPRSIAITSTRPAEGKST
A0A318BJ18      --LVDA-----------YLAINTNLG-----FT----TE-HGVPRSFLVTSTRPAEGKST
A0A1Q4RTR1      -PASAA-----------FEKLQSTLE-----YT----LP-DQVLKSIVITSAIPNEGKSF
A0A1Z4SQV2      -PASAA-----------FEKLQSTLE-----YT----LP-DQVLKSIVITSAVPNEGKSF
A0A2H2XGN1      -PASAA-----------FEKLQSTLE-----YT----LP-DQVLKSIVITSAVPNEGKSF
A0A433UXH8      -PASAA-----------FEKLQSTLE-----YT----LP-DQVLKTIVITSAIPNEGKSF
A0A1Z4RMB9      -FSSEI-----------YRMIQANLK-----FL----TS-DKPPKVMLITSSVPEEGKST
D5A466          -LISEI-----------YRMIQANLK-----FL----GS-DRKVRVIVVTSSVPQEGKST
K1XF69          -LISEI-----------YRMIQANLK-----FL----GS-DRKVRVIVVSSSVPQEGKST
B5W297          -LISEI-----------YRMIQANLK-----FL----GS-DRKVRVIVVSSSVPQEGKST
H1W7M8          -LISEI-----------YRMIQANLK-----FL----GS-DRKVRVIVVSSSVPQEGKST
B4WP72          -VVTEA-----------YQMLWSNLK-----SV----TS-RQELKTIVITSAAAGEGKSE
A0A318B4H2      -QLYES-----------YLAVRTNLS-----FL----TD-HGAPGVLMLTSSRPNEGKSL
B4WQE3          -PFLEA-----------FKLLATNVC-----QG----GS-QDIAKSFSVSSAVPNEGKST
A0A2K3BR24      -SASEA-----------FRMLQANLK-----FS----SV-DQKMKVIVLTSSIPNEGKST
K9YXY1          -SASEA-----------FRMLQANLK-----FS----SV-DQKMKVIVLTSSIPSEGKST
A0A2P8W4F7      -SFAEA-----------FYSLEANLR-----ML----SS-DVPVQVVALTSSVPGEGKST
U5QJM6          -AYEEA-----------FRSLLTNIR-----FL----NS-DKKVNTFVISSSAPGEGKST
A0A1U7HGH0      -FITES-----------YRMLLANLK-----FP----PSLDRSSRVILVTSSIPKEGKST
K9XJD3          -FVTES-----------YRMLLANLK-----FP----PSLERSSRVILVTSSAPKEGKST
K9SX01          -PASEA-----------YRMLQTSLR-----FL----NS-DRQIKAIVITSSVPGEGKST
A0A1E5QIR9      -LISES-----------YRMLYANLK-----FL----GS-DRQVRVIAVTSAIPKEGKST
A0A1Z4IBC7      -PLGDA-----------YQILQVNLK-----FL----CS-DKPLKSIVVTSSVPKEGKSE
A0A1W5CPC7      -PLGDA-----------YQILQVNLK-----FL----CS-DKPLKSIVVTSSVPKEGKSE
Q3MDC6          -PLGDA-----------YQILQVNLK-----FL----CS-DKPLKSIVVTSSVPKEGKSE
A0A1Z4KM73      -PLGDA-----------YQILQVNLK-----FL----CS-DKPLKSIVVTSSVPKEGKSE
Q8YNX7          -PLGDA-----------YQILQVNLK-----FL----CS-DKPLKSIVVTSSVPKEGKSE
A0A367R4K6      -PLGDA-----------YQILQVNLK-----FL----CS-DKPLKSIVVTSSVPKEGKSE
A0A1E2WSV8      -PVGNA-----------YQILQVNLK-----FL----CS-DKPLKSIVITSSVAKEGKSD
A0A2R5FRT9      -PLGNA-----------YQVLQVNLK-----FL----CS-DKPLKSIVITSSVAKEGKSD
A0A2K8T1B6      -PLGNA-----------YQILQVNLK-----FL----CS-DKPLRSIVITSSVAKEGKSD
A0A235I9I0      -PVGNA-----------YQILQVNLK-----FL----CS-DKPLKSIVITSSVAKEGKSD
A0A2D0HQT8      -PVGNA-----------YQILQVNLK-----FL----CS-DKPLKSIVITSSVAKEGKSD
A0A2L2NU95      -PVGNA-----------YQILQVNLK-----FL----CS-DKPLKSIVITSSVAREGKSD
A0A367S084      -PVGNA-----------YQILQVNLK-----FL----CS-DKPLKSIVITSSVAKEGKSD
A0A0V7ZFJ4      -SVTSA-----------FEILQTNLA-----FT----VS-DKTLKVIVVSSSNPNEGKSF
A0A0V7ZNJ9      -VESSA-----------FEMLQTNLS-----FT----SS-DKTLKVLMVTSSVPGEGKSL
A0A367RIS1      -SVNAA-----------FEMLQINLG-----FT----FS-DKELKVIVVSSSVMNEGKSF
A0A235IXQ2      -SVNAA-----------FEMLQINLG-----FS----FS-DKELKVIVVSSSVINEGKSF
A0A1W5CNX3      -SVNAA-----------FEMLQINLG-----FS----FS-DKKLKVIVVSSCVMNEGKSF
Q3MEB7          -SVNAA-----------FEMLQINLG-----FS----FS-DKKLKVIVVSSCVMNEGKSF
A0A1Z4KHN9      -SVNAA-----------FEMLQINLG-----FT----FS-DKKLKVIVVSSCVMNEGKSF
Q8YT70          -SVNAA-----------FEMLQINLG-----FT----FS-DKKLKVIVVSSCVMNEGKSF
A0A218Q4C1      -SVNTA-----------FEMLQINLG-----FT----IS-DKKLKVIVVSSCLPGEGKSF
A0A166IWU6      -SVNTA-----------FEMLQINLG-----FT----IS-DKELKVIVVSSCLPGEGKSF
A0A2S0Q8C0      -SVNTA-----------FEMLQINLG-----FT----IS-DKELKVIVVSSCLPGEGKSF
W6FSX4          -SVNTA-----------FEMLQINLG-----FT----IS-DKELKVIVVSSCLPGEGKSF
A0A1B7WTD1      -PVSTS-----------LEMLHTNLG-----FT----IS-DKELQVILVTSSTSGEGKSF
A0A1B7WX82      -PVSTS-----------FEMLQTNLG-----FT----LS-DKELRVILVTSSTAGEGKSF
A0A0R0M9H9      -PVSTS-----------IEMLQTNLG-----FA-----T-DKELRVILLTSSSPSEGKSF
A0A1S1ZVW2      -PVSTS-----------IEMLQTNLG-----FA-----T-DKELQVILVTSSSPAEGKSF
A0A1Z4LRU5      -PASTA-----------FEILQTNLG-----FT----MS-DKALKVIVVSSSIPGEGKSF
A0A1Z4JVB4      -PAAVA-----------FEMFQTNLG-----FS----IC-EQKLKVIVVSSAVPGEGKSF
K9PIA4          -PESAA-----------FEMLQTNLG-----FS----IS-DKKLKVIVVSSSIPGEGKSF
A0A1Z4M597      -PVSSA-----------FEMLQTNLS-----FS----IS-DKMLKVIAISSSIPGEGKSF
A0A1Z4MWT1      -PVSSA-----------FEMLQTNLS-----FS----IS-DKMLKVIAISSSIPGEGKSF
A0A1Z4TX53      -PVSSA-----------FEMLQTNLS-----FS----IS-DKMLKVIAISSSIPGEGKSF
A0A1Z4HVE1      -AESAA-----------FEMLQANLG-----FS----IS-DKTLKVIALSSSIPGEGKSF
A0A252ECZ1      -PESSA-----------FEMLQANLS-----FS----IS-DKKLKVIVVSSSVPGEGKSF
A0A1Z4G5Y1      -PESAA-----------FEMLQTNLG-----FS----IS-DKTLKVIVLSSSIPGEGKSF
A0A252DNA2      -PESAA-----------FEMLQANLG-----FS----IS-DKTLKVIVLSSSIPGEGKSF
A0A252E1Q4      -PESAA-----------FEMLQANLG-----FS----IS-DKTLKVIVLSSSIPGEGKSF
A0A2A2TNQ5      -SGSMA-----------FEMLMTNLA-----FS----VS-DQELRVIVVTSSVPGEGKSL
A0A3S1C4K5      -PATSA-----------FEMLVTNLS-----FT----LS-DQALRVIAVTSSVPGEGKSF
A0A1X4G3D5      -PISRS-----------FQILQTNLG-----FA-----R-DRELQVMLVTSSSQGEGKSF
D4TNI2          -PISRS-----------FQILQTNLG-----FA-----R-DRELQVMLVTSSSQGEGKSF
A0A1Z4H6Z8      -PESTA-----------FEMLQVNLG-----FS----IS-DKTLKVIVVSSSIPSEGKSF
A0A1Z4NPM1      -PASVA-----------FEMLQTNLS-----FT----VS-DNELRVILVTSSVPGEGKSF
A0A3F3KPR9      -PVSTS-----------IEMLQTNLG-----FA-----T-DKELRVILLTSSSPGEGKSF
D4TGN7          -PVSTS-----------IEMLQTNLG-----FA-----T-DKELRVILLTSSSPGEGKSF
A0A1Z4UZW9      -PVSTS-----------FEMLQTNLG-----FT----LS-DKELRVILLTSSIPGEGKSF
A0A0K2M5H0      -PVSTS-----------FEMLQTNLG-----FT----CS-DKELRVILVTSATPGEGKSF
A0A1B7VSH4      -PVSTS-----------FEMLQTNLG-----FT----VS-DKKLRVILVTSATPGEGKSF
A0A1B7W126      -PVSTS-----------FEMLQTNLG-----FT----VS-DKELRVILVTSATPGEGKSF
A0A3D4C6Q6      -PVSTS-----------FEMLQTNLG-----FT----VS-DKELRVILVTSATPGEGKSF
K7W0A4          -PVSTS-----------FEMLQTNLG-----FT----LS-DKELRVILLTSSTPGEGKSF
A0A1B7UTR1      -PVSTS-----------FEMLQTNLG-----FT----LS-DKQLRVILVTSSTSGEGKSF
A0A1B7UVJ4      -PVSTS-----------FEMLQTNLG-----FT----LS-DKQLRVILVTSSTSGEGKSF
A0A2T1CIL7      -RYNEA-----------YNMLQANLK-----FL----TT-NWDRKAIAVTSSVPQEGKSE
A0A1Z4RPC6      -FASEI-----------YRMIQTNLK-----FL----AV-KRQPKVIVITSSVPGEGKST
A0A2T1CMZ0      -FASEI-----------YRMIQTNLK-----FL----AV-KQQPKVILMTSSVPGEGKSL
L8M4F7          -YTSEI-----------YRMIRTNLT-----AR----SS-QVLPKVILVTSSVPGEGKST
L8LZE9          -YTSEI-----------YRMIQANLK-----FM----TS-QRPPKVILVTSSIPGEGKST
A0A140K2P2      -FASEV-----------YRMIQANLK-----FM----SL-ENSTQVILVTSSVPEEGKST
K9XWX4          -FASEV-----------YRMIQANLK-----FM----SL-EHPPQVILVTSSVPEEGKST
A0A140KB14      -FNSEL-----------YRMIQANLK-----IL----NQ-DNPPQVILITSSVPGEGKST
K9XX88          -FNSEI-----------YRMIQANLK-----IL----NQ-DNPPQVVLVTSSVPGEGKST
A0A433V7A0      -FIYEL-----------YCMIQANLK-----FL----CS-DKALKVIVITSTVPSEGKST
A0A0C2LBE2      -PVGDA-----------YQMLQANLK-----FL----SS-DREPRVIVVTSSVSGEGKSE
A0A433NN38      -AIRDA-----------YQMLQANLR-----FL-----S-DKQLKAIAVTSSVAKEGKSE
A0A2N6K0T2      -PVGDA-----------YQMLQANLK-----FL-----S-DKQLKAITVTSSIPKEGKSE
A0A2N6ML72      -PVGDA-----------YQMLQANLK-----FL-----S-YKQLKAITVTSSIPREGKSE
G6FQZ6          -PVGDA-----------YQMLQANLK-----FL-----S-YKQLKAITVTSSIPKEGKSE
A0A2N6MQX9      -PVGDA-----------YQMLQANLK-----FL-----S-YKQLKAITVTSSIPKEGKSE
A0A2N6KXT6      -PVGDA-----------YQMLQANLK-----FL-----S-YKQLKAITVTSSIPKEGKSE
A0A2N6KGB9      -PVGDA-----------YQMLQANLK-----FL-----S-YKQLKAITVTSSIPKEGKSE
A0A2N6L3Y5      -PVGDA-----------YQMLQANLK-----FL-----S-YKQLKAITVTSSIPKEGKSE
A0A0S3TIS7      -PVGDA-----------YQMLQANLK-----FL-----S-YKQLKAITVTSSIPKEGKSE
A0A1U7GW28      -PVGDA-----------YQMLQANLK-----FL-----S-YKQLKAITVTSSIPKEGKSE
A0A2N6LW63      -PVGDA-----------YQMLQANLK-----FL-----S-YKQLKAITVTSSIPKEGKSE
A0A1Z4TQ63      -PVGDA-----------YQMLQANLK-----FL-----S-DKQLKAITVTSSIPKEGKSE
A0A0D6YFE2      -PVGDA-----------YQMLQANLK-----FL-----S-DKQLKAITVTSSIPKEGKSE
A0A328IH74      -PVGDA-----------YQMLQANLK-----FL-----S-DKQLKAITVTSSIPKEGKSE
A0A1Z4NDS1      -PFSDA-----------YQMLQANLK-----FL----AS-DNELKTIVVSSSVSGEGKSE
K9F4D9          -SILDA-----------YQALQANLK-----FS----CV-DTHVKTVTVTSAVGGEGKSE
U9VXM0          -SVLDA-----------YQSLQANLK-----FS----CV-ESQVKTITITSAVGGEGKSE
A0A2T1FTR8      -IEGES-----------FRMLQTNLQ-----FL----NA-DDSLKVVVVSSSQSGEGKST
K9UA41          -IEGES-----------FRMLQTNLQ-----FL----NA-DDSLKVVVVSSSQSGEGKST
A0A1Z4SMD6      -IVHDA-----------YQMLQANLK-----FI----S--DKKVRTIAVASSVALEGKSE
A0A2H2Y096      -IVHDA-----------YQMLQANLK-----FI----S--DKKVRTIAVASSVALEGKSE
K9S8M8          -IISEN-----------YRMLQANLR-----FL----SP-DRELKVIVVTSPVPQEGKST
A0A1Z4NFV0      -VIHEA-----------YQMLQANLK-----FI----SH--KKVRTIVITSSVAGEGKSE
B0CAX4          -SVSES-----------YRMLQANLK-----FL----SS-DHHVQVFVVTSSIPKEGKST
U5DPF5          -SMSEA-----------FRMLQANLK-----FS----TT-DRKLKVVAVTSSIPREGKST
A0A350Y0P6      -ITSEA-----------YRMLEANLK-----FL----SP-DHVLKRIVVTSSVAQEGKST
A0A352X940      -IVSEA-----------YRMLEANLK-----FL----SP-DKMLKVIVVTSSVSREGKST
B8HTN4          -HLSEA-----------YRTLQANLK-----FL----SSPDHPIRTIVITSTRPQEGKST
A0A2A2TPF8      -VIHEA-----------YQMLQANLN-----FI----SH-KK-VRTIVVTSSVAGEGKSE
A0A1Z4R0P8      -VIHEA-----------YQMLEANLN-----FI----SH-KR-VRTLVVTSSVAGEGKSE
A0A0T7BUI3      -IIHEA-----------YQMLQANLN-----FI----SH-KK-VRAIAITSCVPGEGKSE
A0A1Z4LP32      -MIHEA-----------YQMLQANLK-----FI----SH-KE-VRTIVVTSSVVGEGKSE
K9REP9          -MIHEA-----------YQMLQANLK-----FI----SH-KE-VRTIAVTSSVVGEGKSE
A0A1Z4SIJ3      -VIHDA-----------YQMLQANLK-----FI----SH-KK-VCTLAITSSVAGEGKSE
A0A2H2XPG4      -VIHDA-----------YQMLQANLK-----FI----SH-KK-VCTLAITSSVAGEGKSE
K9V3C7          -VIHEA-----------YQMLRANLK-----FI----SH-KQ-VRTIVVTSSVAGEGKSE
A0A1Z4T6Y7      -VIHEA-----------YQMLQANLK-----FI----SH-KK-VRTIVITSSVPGEGKSE
A0A2H2Y561      -VIHEA-----------YQMLQANLK-----FI----SH-KK-VRTIVITSSVPGEGKSE
A0A1Q4S362      -VIHEA-----------YQMLQANLK-----FI----SH-KT-VRTIVVTSSVPGEGKSE
A0A3S1CIN8      -VIHEA-----------YQMLQANLK-----FI----SH-KT-VRTIVVTSSVPGEGKSE
A0A2A2TC28      -VIHEA-----------YQMLQANLK-----FI----SH-KK-VCTIVVTSSVAGEGKSE
A0A0C1NCB0      -VVHEA-----------YQMLQANLK-----FI----SH-KR-LRTIVVTSSVPGEGKSE
A0A2N6K7Q9      -VVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVTAEGKSE
A0A2N6MXH6      -VVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVTAEGKSE
A0A2N6M5A8      -VVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVTAEGKSE
A0A2N6LL61      -VVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVTAEGKSE
A0A0S3TP66      -VVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVTAEGKSE
G6FP91          -VVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVTAEGKSE
A0A1U7GYR5      -VVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVTAEGKSE
A0A2N6KY52      -VVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVTAEGKSE
A0A2N6KMP5      -VVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVTAEGKSE
A0A2N6MA45      -VVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVTAEGKSE
A0A1Z4TLC8      -LVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVSAEGKSD
A0A0M0SFT2      -LVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVSAEGKSE
A0A0D6Y7R4      -LVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVSAEGKSE
A0A328IGA1      -LVHEA-----------YQMLQANLK-----FI----SH-RK-VRKIVVTSSVSAEGKSE
A0A0C2LFH0      -VVHEA-----------YQMLQANLK-----FI----SH-RK-VRTIVVTSSVPGEGKSE
A0A1Z4IYV4      -VIHEA-----------YQMLQANLK-----FI----SH-KK-VRTIVVTSSVPGEGKSE
A0A1Z4Q0T6      -VIHEA-----------YQMLQANLK-----FI----SH-KK-VRTIVVTSSVAGEGKSE
A0A0C2PT44      -VIHEA-----------YQMLQANLK-----FI----SH-KK-VRTIVVTSSVAGEGKSE
A0A1D2P6J4      -VVHEA-----------YQMLQANLK-----FI----SH-KR-VRTIVVTSSVAEEGKSE
A0A3M9ZEU1      -PISEA-----------YHMLQANLK-----FL----SS-DQEIRVVVVTSAVAKEGKST
A0A1Z4JK72      -MIHEA-----------YQMLQANLK-----FM----SL-DKKVKTIVISSAVPREGKSE
A0A0N7Z489      -MIHEA-----------YQMLQANLK-----FM----SL-DKPVKTIVISSAVPREGKSE
A0A0S3TXS2      -MIHEA-----------YQMLQANLK-----FM----SL-DKKVKTIVISSAVPREGKSE
A0A1Z4RN12      -PLKEA-----------YQNIQVNLK-----LL----GA-NVETKTIAVTSSVPQEGKSS
A0A2T1CMF9      -PLKEA-----------YQNIQVNLN-----LL----DA-DAKKKVIAITSSVPQEGKSS
Q7NDC5          -PVSEA-----------YRSIRTHLK-----FL----SS-ERGLRAFVLTSASPQEGKST
U5QGK3          -PMSEA-----------YRSVRTYLK-----FL----SA-ESPLTAVVFTSASPQEGKST
A0A2W4UY24      -PLVES-----------YQSLQANLK-----FS----YF-DGSLKAITVTSAVGGEGKSE
A0A254WLE3      -PIAEA-----------FRMLQANLK-----FS----SS-DK-LKVILVTSSVPGEGKST
A0A433W533      -PIAEA-----------FRMLQANLK-----FS----SS-DK-LKVILVTSSVPGEGKST
A0A2P8QWJ3      -PIAEA-----------FRMLQANLK-----FS----SS-DK-LKVILVTSSVPGEGKST
A0A2T1FKP8      -PIAEA-----------FRMLQANLK-----FS----SS-DK-LKVILVTSSVPGEGKST
K9U6L7          -PIAEA-----------FRMLQANLK-----FS----SS-DK-LKVILVTSSVPGEGKST
A0A2T1GMT4      -ITSEM-----------SRTIQSNLR-----FL----GA-DKPLKTIAITSSVANEGKSK
K9UI51          -ITSEM-----------SRTIQSNLR-----FL----SA-DKPLKIIAITSSVANEGKSK
K9TYI2          -LTSEI-----------YRMIQANLK-----FL----SP-DRALRTIVITSAVPKEGKST
A0A254W5G5      -LTSEI-----------YRMIQANLK-----FL----SP-DRVLKTIVVTSAVPKEGKST
A0A2T1FXY4      -LTSEI-----------YRMIQANLK-----FL----SP-DRVLKTIVVTSAVPKEGKST
A0A1Z4QL41      -LASEM-----------YRMIQANLR-----LV----SS-DQVLKSIVVTSAVSKEGKST
A0A252D4T4      -LTSEI-----------YRMIQANLR-----FL----SS-DKVLKTIVVSSAVPKEGKST
A0A252DJH5      -LTSEI-----------YRMIQANLR-----FL----SS-DKVLKTIVVSSAVPKEGKST
A0A252EB80      -LTSEI-----------YRMIQANLR-----FL----SS-DKVLKTIVVSSAVPKEGKST
A0A1Z4HPW5      -LTSEI-----------YRMIQANLR-----FL----SS-DKVLKTIVVSSAVPKEGKST
A0A1Z4MSN1      -LTSEI-----------YRMIQANLR-----FL----SS-DKVLKTIVVSSAVPKEGKST
A0A1Z4U1C2      -LTSEI-----------YRMIQANLR-----FL----SS-DKVLKTIVVSSAVPKEGKST
A0A0D6KV51      -LTSEI-----------YRMIQANLR-----FL----SS-DKVLKTIVVSSAVPKEGKST
A0A1Z4MKF8      -LTSEI-----------YRMIQANLR-----FL----SS-DKVLKTIVVSSAVPKEGKST
A0A2C6WC43      -LTSEM-----------YRMIQANLK-----FL----SS-DKVLKTIVVTSAVPKEGKST
A0A1Z4L5A1      -LTSEM-----------YRMIQANLK-----FL----SS-DKVLKTIVVTSAVPKEGKST
A0A367QD86      -LTSEM-----------YRMIQANLK-----FL----SS-DKVLKTIVVTSAVPKEGKST
A0A235IZ96      -LTSEM-----------YRMIQANLK-----FL----SS-DKALKTIVVTSAVPKEGKST
A0A2L2NGP0      -LTSEM-----------YRMIQANLK-----FL----SS-DKALKTIVVTSAVPKEGKST
A0A2K8SM78      -LTSEM-----------YRMIQANLK-----FL----SS-DKVLKTIVVTSAVPKEGKST
A0A2R5FPC0      -LTSEM-----------YRMIQANLK-----FL----SS-DKVLRTIVVTSAVPKEGKST
K9QM62          -LTSEM-----------YRMLQANLK-----FL----SS-DKELKTIVVTSSVPKEGKSS
A0A1Z4FWI3      -LTSEI-----------YRMIQANLR-----FL----SS-DKVLKTIVVSSAVPKEGKST
A0A1Z4JYE7      -LTSEI-----------YRMIQANLK-----FL----SS-DKLLKTIVVTSAVAKEGKST
A0A140KBA0      LPIREA-----------YQILQANLK-----LL----SL-SQARKVIAVTSCVPQEGKSH
K9XSG1          LPIREA-----------YQILQANLK-----LL----SL-SQERKVIAVTSCVPQEGKSH
A0A0F5YE28      -FISEI-----------YRMLQANLK-----FL----SS-DKRIKTIVVTSSVPKEGKST
U7QEH7          -FISEI-----------YRMLQANLK-----FL----SS-DKRIKTIVVTSSVPKEGKST
A0A3S1ATK5      -LTSEM-----------YRVIQANLR-----LL----SS-DKVIKSIVVTSSISKEGKST
A0A2Z6CPH0      -LTSEI-----------YRMIQANLK-----FL----SS-DKVLKTIVVTSSVPKEGKST
A0A1Z4GT50      -LTSEI-----------YRMIQANLR-----FL----SS-DKVVKTIVITSAVPKEGKST
A0A1Z4GIX0      -LTSEM-----------YRMIQANLK-----FL----SS-DKVLKTVVVTSAVPKEGKST
A0A2H6LC24      -LTSEM-----------YRMIQANLK-----FL----SS-DKVLKTVVVTSAVPKEGKST
B2J6N5          -LTSEM-----------YRMIQANLK-----FL----SS-DKVLKTIVVTSAVPKEGKST
A0A367RMI4      -LTSEM-----------YRMIQANLK-----FL----SS-DNVLKTIVITSAVPKEGKST
A0A235HUM0      -LTSEM-----------YRMIQANLK-----FL----SS-DNLLKTIVITSAIPKEGKST
A0A2L2NW47      -LTSEM-----------YRMIQANLK-----FL----SS-DHLLKTIVITSAVPKEGKST
A0A1E2WUR1      -LTSEM-----------YRMIQANLK-----FL----SS-DKVLKTIVVTSAVPKEGKST
A0A235IKU3      -LTSEM-----------YRMIQANLK-----FL----SS-EKALKTIVVTSAVPKEGKST
F4XKF3          -MVSEV-----------YRMIQANLK-----FL----RS-DHPLKVIVVTSSVSKEGKST
A0A1D9FX10      -MVSEV-----------YRMIQANLK-----FL----RS-DHPLKVIVVTSSVSKEGKST
A0A1D8TNX9      -MVSEV-----------YRMIQANLK-----FL----KS-DHPPKVIVVTSSVSKEGKST
A0A1U7MYU6      -MVSEV-----------YRMIQANLK-----FL----RS-DHPLKVIVVTSSVSKEGKST
A0A3C0NJ41      -PISEA-----------YRMLQANLK-----FL----SS-DKPLKVIVVTSSVPKEGKST
A0A352AG88      -PISEA-----------YRMLQANLK-----FL----SS-DKTPRVIVVTSSVPKEGKST
A0A350Y374      -AISEV-----------YRMLQANLK-----FL----SS-DKPPKVILVTSSVPQEGKST
A0A355DPX0      -AISEV-----------YRMLQANLK-----FL----SS-DKPPQVILVTSSVPQEGKST
A0A0D8ZUV2      -PLSEA-----------YRMLQANLK-----FL----SS-DKPLRVIVVTSSVPREGKST
A0A433VDI0      -PISEA-----------YRMLQANLK-----FL----GS-DKALKVIVVTSAVSKEGKST
A0A3D1PG43      -PIAEN-----------YRMLQANLK-----FL----SS-ERALKAVVVSSSVPKEGKST
A0A2P8QQ72      -LTAEA-----------YRMLQANLR-----FL----NL-DRPLKAVVVTSSVPKEGKST
K9TZQ7          -LTAEA-----------YRMLQANLR-----FL----NL-DRPLKAVVVTSSVPKEGKST
A0A2G7GPR0      -PISEA-----------YRMLQANLK-----FL----SS-DKPLKVIVVTSAVPKEGKST
K9XH68          -PISEA-----------YRMLQANLK-----FL----SS-DKPLKVIVVTSAVPKEGKST
A0A1U7HW70      -PISEA-----------YRMLQANLK-----FL----SS-DKPLKVIVVTSAVPKEGKST
A0A2S6VEJ8      -PISEA-----------YRMLQANLK-----FL----SS-DKPLKVIVVTSAVPKEGKST
                                                              . .:*    .**: 

K9SLA9          FTANLAI-AAAQMGAKVLLIDADLRKPTQHQLW--QV-PNSQGLSN-------VLA-GS-
A0A168TT23      NAINLAT-VLAQNGARVLLIDADLRKPRLHRDF--SI-QQAPGVTN-------RIADVG-
A0A0M1JWX9      AAVNLAQ-AAATMGQRVLLVDGDLRRPQVHAKL--GI-LNRQGLSN-------VLA----
A0A2T1M1V6      LTLGLAW-ALVQLGFRVLLVDADLRQA--------EM-SRKLGYPQ-------FRRGTG-
A0A2G7GCS2      VTLGLAL-ALVNFGFRVLIVDGDLRQA--------EL-SRRLGQLQ-------KQPK-N-
K9XBH8          MTLGLAL-ALVNCGFRVLMVDGDLRQA--------EL-SRRLGHSK-------TETTMN-
A0A1Z4LJ30      ATLGLAN-ALINLGFKVLVVDGDFRKS--------EL-SQSLGYQS-------QTILDS-
K9RI76          TTIGLAN-ALLVLGFKVLLVDGDFRRG--------EL-SESLGYQP-------QAKSRF-
A0A352AE27      VTLGLAT-ALVDLGFRVLLVDGDFRKA--------QL-SHRLGYAR-------ELLPPE-
A0A3B8JH60      VTLGLAT-ALADLGFRVLLVDGDFRKA--------EL-SRRLGYGR-------ELKGTE-
A0A3C0N766      VTLGLAT-ALADLGFRVLLVDGDFRKA--------EL-SRRLGYGR-------ELKGTE-
K9W9J7          VTLGLAR-ALADLGFRVLLVDGDFRKA--------EL-SRRLGYGR-------EVELAD-
A0A139WSU3      VAIGLAY-GLVDLGFRVLLVDGDFRSA--------EL-SRSLGYAE-------DSTIEQ-
A0A433VN22      VAIGLAN-ALVDLGFKVLLVDADFRQA--------AL-SRRLGYTQ-------TST-ED-
Q7NF11          LTLGLAN-ALAEMGFRVLLVDADFRQA--------SL-SRLLGHGP-------QVEGTQ-
A0A1Z4JCS8      VALQLAH-ALTELGFRVLLVDGDFRKA--------QL-SHQLGYLS-------D-RSVG-
F4XTX2          VTLGLAT-ALVDLGFRVLVVDGDFRQA--------TL-SQRLGHHH-------D-PLKP-
Q7NJN6          VTLGLAK-ALRELGFRVLVVDADFRQA--------GL-GRKLQVGP-------G------
U5QCC3          VTLGLAR-ALRSLGFRVLVVDADFRQA--------GL-GRLLQVNQ-------G------
A0A0S3TYD7      VSANLAS-AFAQIGKRVLLIDADLRRPRQHHVW--SLGTNDVGFSD-------VLV-GV-
U5QL42          ISYNLGL-VLSEFGKRVLVVDADMRKPNLHRFL--EL-PNSRGLST-------AIA-TE-
K9QF04          IAVYLAQ-VAASMGKRVLLIDADLRRPTIHTRV-HSL-TNVWGLSN-------LIS-GS-
A0A3C0N2P0      ITTFLAQ-AAAAMGQRVLLVDADLRRPRIHETT--DL-PNVWGLSN-------VIS-SE-
K9TLQ0          ISMKLAE-AASAMGNRVLLVDADLRRPQIDQRM--DL-PNVWGLSN-------LIS-TD-
A0A076HBF2      VNVLLAK-TLSEMGQRILLIDADLRKPQMHVRL--GL-NNLSGLSN-------VLT-ED-
A0A354B169      IIVLLAK-TLAEMGKKILVIDADMRRPQLHQRL--GL-NNLVGLSN-------LLA-DD-
G4FMX5          VNTLLAK-TLAEMGQRVLLIDADLRKPQLHTRL--GL-NNLRGLSN-------VLT-DD-
Q0IDT5          VNVLLAK-TLAEMGQRVLLVDADLRKPQLHIRL--GI-NNLQGLSN-------LIT-ED-
A0A2D6FCW3      VNVLLAK-TLSEMGQKVLLIDADLRKPQLHTRL--GL-NNLRGLTN-------VLT-DD-
A3ZA21          VNVLLAK-TLSEMGQRVLLIDADLRKPQMHTRL--GL-NNLSGLSN-------LLA-DD-
A0A140K3H3      VTYNLGI-VLAELGLNVLIIDADMRKPKIHKLA--KL-PNDEGLSE-------AIT-TE-
K9XUB8          VTYNLGL-VLAELGLRVLIVDADMRKPKIHKLA--KL-ANDEGLSE-------AIA-NE-
Q7NEU3          VATNLAK-VVGGLNRKALLVDADLRRPTVSNKL--EL-SNGPGLST-------VLA-GE-
A0A352XE00      TSMFLAQ-AAAAMGEKVLLVDADLRRPQIHVRM--NL-LNMWGLSN-------AIS-SD-
B4VS56          IATFMAQ-AAAAMGQRVLLVDADLRRPQLHVRT--DL-PNVWGLSH-------VIS-SD-
A0A352AAQ3      TSAFLAQ-AAAAMGERVLLVDADLRRPQVHVKT--DL-PNVWGLSN-------VIS-SE-
A0A350Y472      VAAFLSQ-AAAAMGERVLLVDADLRRPQVHVKT--DL-PNVWGLSN-------VIS-SE-
A0A355DVB4      VAAFLAQ-AAAAMGERVLLVDADLRRPQVHVKT--DL-PNVWGLSN-------VIS-SE-
A0A2P8VVX1      LTLGLAF-SLARMGQRVLVIDADLRRSGIQAGL--GL-VAEQGLSG-------LLT-GE-
A0A2P8WHY0      VALGLAF-SLARMRQRVLVIDADLRRSGIATEL--GL-STEGNLAN-------LLK-GV-
A0A2T1CMT9      LTLGLAL-SIARDRQKVLVIDADLRSPSLHKSF--AL-TNLSGLTN-------FLG-GE-
A0A1D8TX52      LALGLAL-SAARLHRRVLLIDVDMRRPRLHQQL--GL-SNYEGLSTLLEDDTALLE-DD-
A0A1U7N5X9      LALGLAL-SAARLHRRVLLIDVDMRRPRLHQQL--GL-SNQEGLST-------LLE-DD-
A0A1D9G4T2      LALGLAL-SAARLHRRVLLIDVDMRRPRLHQQL--GL-SNQEGLST-------LLE-DD-
F4XP71          LALGLAL-SAARLHRRVLLIDVDMRRPRLHQQL--GL-SHQEGLST-------LLE-DD-
A0A2P8QVH5      LAAGMAL-SVARLQRRVLLIDADLRRSNIHKLL--NL-SNDRGLST-------LLT-EE-
A0A2T1FT70      LAAGMAL-SVARLQRRVLLIDADLRRSNIHKLL--NL-SNDRGLST-------LLT-EE-
A0A433W4W4      LAAGMAL-SVARLQRRVLLIDADLRRSNIHKLL--NL-SNDRGLST-------LLT-EE-
K9U5W1          LAAGMAL-SVARLQRRVLLIDADLRRSNIHKLL--NL-SNDRGLST-------LLT-EE-
A0A254WLA7      LAAGMAL-SVARLQRRVLLIDADLRRSNIHKLL--NL-SNDRGLST-------LLT-EE-
A0A2W6ZAV2      ASALFAQ-TMADLGQRVLLVDADLRRPSLHRLM--SV-ANGEGLSN-------LLT--E-
A0A2G7GMH8      LALGLAI-AAARLHQKVLLIDTDLRRPSLHKQL--EL-SNEQGLST-------LLT-SD-
K9W742          LALGLAI-SAARLHQRVLLIDADLRNPTLHEKL--NL-PNDYGLST-------LLS-SD-
K9SA61          LAMGLAM-SAARLHQRVLLIDADLRRPSLHKQL--NL-PNDRGLSS-------LLS-GD-
A0A350Y7Z1      LVVGLAF-SAARLHQRVLLIDADLRRPSLHKQL--NL-ANEQGLAT-------LLV-ED-
A0A352X2A7      LVMGLAL-TAARLQQRVLLIDTDLRFPTLHRQL--NL-PNEEGLST-------LLA-DD-
K9XPB0          LVLGLAF-SIARHQKRVLVIDADLRCPSLHEKL--GV-ENNSGLSD-------LLQ-GT-
A0A0D8ZYV0      LALGLAL-SAARLHQRVLLIDADLRRPNLHQML--NL-PNEEGLST-------LLA-SD-
A0A3D1PBA3      LALGLAL-SAARLHQRVLLIDADLRRPNLHEML--SL-PNEQGLST-------LLS-SD-
A0A254WJ87      LALGLAL-SAARLHQRVLLIDTDLRRPSLHQIL--NL-PNDYGLST-------LLS-SD-
A0A2T1FP73      LALGLAL-SAARLHQRVLLIDTDLRRPSLHQIL--NL-PNDYGLST-------LLS-SD-
A0A433VMS2      LALGLAL-SAARLHQRVLLIDTDLRRPSLHQIL--NL-PNDYGLST-------LLS-SD-
K9TYA7          LALGLAL-SAARLHQRVLLIDTDLRRPSLHQIL--NL-PNDYGLST-------LLS-SD-
A0A2P8QUE1      LALGLAL-SAARLHQRVLLIDTDLRRPSLHQIL--NL-PNDYGLST-------LLS-SD-
A0A2T1DWE8      IALGLAI-SAARLHQRVLLVDADLRRPSLHQQL--DL-PNNYGLST-------LLT-RH-
A0A1U7I8L3      IALGLAI-SAARLHQRVLLIDADLRRPSLHKEL--NL-PNDRGLST-------LLT-ND-
A0A2T1DJL8      IALGLAI-SAARLHQRVLIIDADLRRPGLHKQL--EL-PNEQGLST-------LLS-GD-
A0A1Z4J9W0      VALGLAI-SAARLHQRVLLIDADLRRPGLHKQL--QL-PNDHGLST-------LLT-SD-
A0A0N7Z5K9      VALGLAI-SAARLHQRVLLIDADLRRPGLHEQL--QL-PNEHGLST-------LLT-SD-
A0A0S3TXC5      VALGLAI-SAARLHQRVLLIDADLRRPGLHHQL--QL-PNDHGLST-------LLT-SD-
A0A2T1DNG3      LSVGLAI-SAARLHQRVLLIDADLRRPNLHKLL--NL-PNEQGLST-------LLV-SQS
A0A2P8W9H0      VSFHLAY-TMALLGYRTLVVDNDFRRPSLHTLC--HL-PNEKGLSN-------YVI-GE-
A0A3S0Y9N9      IAANLAF-SISQIGRKVLLVDADFRRPSQDKIW--NI-MNHAGLTN-------VIK-SQ-
A0A433UNK7      IAANLAF-SISQLGRNILLVDADLRNPSQHKIW--EI-PNEVGLSN-------VLK-RQ-
B8HNB0          IVYNLGR-MLAELGQKVLIVDADTRNPTIHQII--EQ-PNLRGLTT-------AIASDK-
A0A1Z4LN32      VAANLAA-VMAQVGRRVLLVDADMRQPSQHHLW--GL-INSIGLSN-------VMV-GE-
A0A2I8A9F5      IAANLAA-VIAQTGRRVLLIDADMRRPSQHHLW--NL-INSAGLSN-------VVV-EQ-
A0A218Q6R8      VSANLAA-VMAQVGRKVLLVDADMRQPSQHHLW--GL-LNSIGLSN-------VMV-GQ-
A0A0C1XVC4      VAANLAA-VMSLAGRRVLLVDADMRQPSQHHLW--GL-INSVGLSN-------FMV-GE-
A0A218QGE0      VAANLAA-VMSLAGRRVLLVDADMRQPSQHHLW--GL-INSVGLSN-------VMV-GE-
A0A3B8Y8H9      VAAHLAQ-AAAKMGQKVLLVDGDLRLPQLHHQPGLTS-SNQYSLED-------ILN-QD-
A0A1Z3HMQ0      VAANLAA-TIAQTGKQVLLVDADMRSPWQHHLW--NV-VNQIGLSH-------VLV-GE-
A0A1E5QP61      VAANLAV-ATAQLGRRVLLIDGDMRHSTQHQIW--NL-TNVAGLSD-------VIA-NQ-
A0A3M2GIL5      VAANLAL-AIAQLGRRVLLIDADLRHPIQHHIW--DL-TNIAGLSD-------AIV-SQ-
A0A433NM31      VSANLAL-AIAQLGFKVLLVDADMRSPSQHQFW--EL-GNNKGLSN-------LIV-EQ-
A0A3M1PML8      IAANLAA-TMAQLGRKVLLVDADLRRPAQHHTW--NL-VNAAGLTN-------LLI-DQ-
A0A352X442      VSANLAA-AIAQVGRRVLLVDADMRHPSQHHLW--NL-TNAVGLSN-------LLV-GE-
A0A0T7BPZ0      VSANLAV-AMAQVGRKVLLIDADMRHPIQHHIW--GI-TNAKGLSN-------IIV-DQ-
A0A0M0SHU3      VSANLAV-AMAEVERRVLLVDADMRHPIQHHIW--QL-SNKRGLSN-------IIV-DQ-
A0A1D2PBN3      VAVNLAV-AMAQVGRRVLLVDADMRHPVQHHVW--GM-TNAVGLSN-------VIV-D--
A0A0C2LVR7      VAVNLAV-AMAQVGRRVLLVDADMRHPVQHHVW--GM-TNAVGLSN-------VIV-DE-
A0A1Z4PQB9      VAANLAV-AMAQVGRRVLLVDADMRHPVQHHVW--GM-TNAVGLSN-------VIV-DE-
A0A1Z4SFN6      VAANLAV-AMAQLGHRVLLVDADMRRPVQHHIW--GM-TNAVGLSN-------VIV-DQ-
K9PGI8          VAANLAV-AIAQLGRRVLLVDADMRHPVQHHIW--GM-TNAVGLSN-------VIV-DQ-
A0A2W1JVB9      ASANLAM-AMAELGQKVLLVDADLRRPVQHRTW--EL-LNRVGLSD-------VLV-GE-
A0A3M1SVZ4      IAANLAA-AISQVGRRVLLVDADLRRPLQHEIW--NL-GNEMGLGN-------TIS-GQ-
K9SSQ0          IIYNLSL-TLAELGYKVLLVDADMRKPTIHSLA--GV-SNKLGLSQ-------AIA-TK-
A0A2W1JIN9      VTSYLAA-VAAMLSRRTLIIDADLRRPTIHKQF--QL-PNKSGLSD-------ILS-GD-
A0A318AJV1      TALAFAR-MLAVNGARVLLVDADLRNSKFPGSM--AI-GPGKGLIE-------ALR-GR-
A0A254WHG9      VSSYLAA-VAATLSRRTLLIDADLRCPTQHKLF--KL-AAKPGLAE-------VAQ-GK-
A0A2P8QIL5      VSSYLAA-VAATLSRRTLLIDADLRCPTQHKLF--KL-AAKPGLAE-------VAQ-GK-
A0A2T1FLY5      VSSYLAA-VAATLSRRTLLIDADLRCPTQHKLF--KL-AAKPGLAE-------VAQ-GK-
A0A433W447      VSSYLAA-VAATLSRRTLLIDADLRCPTQHKLF--KL-AAKPGLAE-------VAQ-GK-
K9U1K8          VSSYLAA-VAATLSRRTLLIDADLRCPTQHKLF--KL-AAKPGLAE-------VAQ-GK-
A0A1U7N2U4      VVSHLAA-VSARFSRRTLIIDADWRHPMQHNLF--GL-PPQPKVKD-------LMD-SN-
A0A1D9G1F2      VASHLGA-VSVRFSRRTLIIDADWRHPMQQDLF--GL-SPQPKVTD-------VID-SN-
F4XV38          VASHLGA-VSVRFSRRTLIIDADWRHPMQHNLF--GL-PPKPKVTD-------VID-SN-
K9UYB2          VTSHLGA-ISAMLSRRTLIIDADLRKPVQHKLF--NL-NPQPGIAE-------VFD-GT-
A0A0C1XJI7      VASHLAA-ISAMLSRRTLIIDADLRRPMQHTLF--NL-APKPGITD-------VIE-KR-
A0A218QN17      VASHLAA-ISAMLSRRTLIIDADLRRPMQHTLF--NL-APTPGITD-------VIE-KR-
K9RKN2          VVSHLAA-VSAMLSRKTLVIDADLRRPVQHTLF--NL-PPKPGITE-------IIE-GR-
A0A2I8ADV2      VVSHLAA-VAAMLFRRTLIIDADLRRPVQHTLF--NL-PPKPGISD-------VIN-GN-
A0A1W5CKM3      IVSHLAA-VSAMLSRRTLIIDADLRKPSQHTLF--NL-PPRPGITD-------VID-GT-
Q3MEW0          IVSHLAA-VSAMLSRRTLIIDADLRKPSQHTLF--NL-PPRPGITD-------VID-GT-
A0A1Z4KIC7      IVSHLAA-VAAMLSRRTLIIDADLRKPSQHTLF--NL-PPRPGITD-------VID-GT-
Q8YSM5          IVSHLAA-VAAMLSRRTLIIDADLRKPSQHTLF--NL-PPRPGITD-------VID-GT-
A0A1Q4S1H4      VVSHLAA-VAAMLSRRTLLIDADLRRPKLHRAF--NL-QAAPGLSD-------AIS-QR-
A0A433VBU6      VVSHLAA-VSAMLSRRTLLIDADLRRPKLHRVF--NL-QNAPGLSD-------AIT-ER-
A0A1Q4RZJ6      VASHLAA-VSAMLSRRTLIIDADLRRPVQHTIF--NL-PGKPGITD-------IVE-GN-
A0A1Z4SNV3      VASHLAA-VSAMLSRRTLIIDADLRRPVQHTIF--NL-PAKPGITD-------IVE-GS-
A0A2H2XJQ1      VASHLAA-VSAMLSRRTLIIDADLRRPVQHTIF--NL-PAKPGITD-------IVE-GS-
A0A3S5K358      VASHLAA-VSAMLSRRTLIIDADLRRPVQHTIF--NL-PGKPGISD-------IVE-GN-
A0A0T7BPJ4      VASHLGA-VSAMLSRKTLIIDADLRRPEQHRIF--HL-EHKPGVAD-------VIA-GN-
A0A0C1QS61      VASHLAA-IAGMLSWRTLIIDADLRRPEQHTLF--NL-AGKPGVSD-------VLE-GD-
A0A139X3R8      VASHLAA-VAAMLSWRTLVIDADLRRPEQHTLF--NL-SGKPGVTD-------VLE-GD-
A0A1Z4I7C5      IVSHLAA-VCAMLSRRTLIIDADLRKPSQHTLF--NL-PPKPGITD-------VID-GK-
A0A0C2MDK7      VASHLAA-VVGMLSWRTLIIDADLRRPSQHTLF--NL-APGPGITD-------VLE-GN-
A0A1Y0RCK1      VASHLAA-VAAMLSWRTLVIDADLRKPVQHTLF--HL-APKLGITD-------VLE-GN-
A0A1Z4PWZ0      VASHLAA-VAAMLSWRTLIIDADLRRPVQHTLF--NL-TPKPGITD-------VLE-GN-
A0A0C2QLT0      VASHLAA-VAAMLSWRTLIIDADLRRPVQHTLF--NL-TGKPGITD-------VLE-GN-
A0A1Z4J2K1      VASHLAA-VAAMLSWRTLIIDADLRRPVQHTLF--NL-TPKPGITN-------VLE-GN-
A0A3S0ZSX0      VASHLAA-VCAMLSRRTLLIDADLRRPAQHTLF--NL-APQPGITD-------LIY-GE-
A0A2N6K4T3      VASHLAV-ISAMLSRRTLLIDADLRRPILHTLF--NL-APQPGITD-------VID-SE-
A0A370CKT2      VASHLAA-ISAMLSRRTLLIDADLRRPILHTLF--NL-APRPGITD-------VID-SE-
A0A0S3TL97      VASHLAA-ISAMLSRRTLLIDADLRRPILHTLF--NL-APRPGITD-------VID-SE-
A0A2N6M8A0      VASHLAA-ISAMLSRRTLLIDADLRRPILHTLF--NL-APRPGITD-------VID-SE-
A0A2N6M9E1      VASHLAA-ISAMLSRRTLLIDADLRRPILHTLF--NL-APRPGITD-------VID-SE-
A0A2N6KJI4      VASHLAA-ISAMLSRRTLLIDADLRRPILHTLF--NL-APRPGITD-------VID-SE-
A0A2N6MZ77      VASHLAA-ISAMLSRRTLLIDADLRRPILHTLF--NL-APRPGITD-------VID-SE-
A0A2N6KT20      VASHLAA-ISAMLSRRTLLIDADLRRPILHTLF--NL-APRPGITD-------VID-SE-
G6FSN3          VASHLAA-ISAMLSRRTLLIDADLRRPILHTLF--NL-APRPGITD-------VID-SE-
A0A0D6YL98      VASHLAV-ISAMLSRRTLLIDADLRRPMLHTLF--NL-APQPGITD-------VID-SQ-
A0A328I8B9      VASHLAV-ISAMLSRRTLLIDADLRRPMLHTLF--NL-APQPGITD-------VID-SQ-
A0A0M0SU69      VASHLAV-ISAMLSRRTLLIDADLRRPVLHTLF--NL-VPQPGITD-------VID-SE-
A0A1Z4TIZ8      VASHLAV-ISAMLSRRTLLIDADLRRPVLHTLF--NL-APQPGITD-------VID-SQ-
A0A318BG22      TSAALAQ-GVADRGKRVLLVDADLRKPTLHHRF--AQ-TNQVGFSN-------LLT-GE-
A0A2T1E9V8      TCANLAA-VMAQLEHKVLIIDADFRHPSQHLIW--QI-SNEEGLMN-------VIA-EK-
A0A0P1C0L3      SSLALAA-SFARLGKRTLLIDGDLRNSRLMALLGGEG-ADTAGLAA-------LLTTND-
A0A3M2GQQ6      LTYNLGR-VLSELGQRVLIVDADMRKPTVHEFI--KQ-PNALGLSS-------AIA-TD-
K9SGJ5          LVFNLAS-ILAELGHKVLVVDADMRKPNVHHLA--KL-RNNYGLST-------VIA-TN-
L8MYT6          LTYNLAM-ILSSLGYRILLVDADLRKPTVHKLA--RL-SNKFGLST-------ALA-TP-
A0A352JGJ6      LTYNLAT-ILAALGYKVLLVDADMRKPTVHKLS--KL-SNKFGLST-------ALA-TP-
A0A1J5GLS2      LTYNLST-ILAVLGYRVLLVDADMRKPTIHKLS--KL-PNKVGLST-------ALA-TP-
A0A2W4W6M5      LTYNLAT-ILAALGYKVLLVDADMRKPTVHKLT--KL-SNKVGLST-------ALA-TP-
A0A2W7AN33      LTYNLAV-ILSSLGYRVLLVDADMRKPTIHKLA--GL-SNKVGLSM-------ALA-TP-
A0A256BLV2      LTYNLAT-ILSALGYRVLLVDADMRKPSIHKLA--GL-SNKVGLST-------ALA-TP-
A0A2W6ZXF3      LTYNLST-ILAALGYRVLLVDADMRKPTVHKLS--KL-PNKVGLST-------ALA-TP-
A0A2Z5WX66      LTYNLST-ILAALGYKVLLVDADMRKPTVHKLT--NL-SNKSGLST-------ALA-TP-
K9W1T3          TAANLAV-AISQLGQRVLLIDADMRKPSQHKIW--QL-PNETGLST-------VLT-GQ-
A0A0D6YBN8      TALAVAT-MLARSQKKVILVDGDMRSPSIHHLG--GV-DHERGLSN-------FLT-GH-
A0A318BJ18      TALALAT-MLARAGKRTILVDGDMRSPSVHQLG--GV-DHDHGLSN-------FLS-GE-
A0A1Q4RTR1      VSANLAL-AMAQLGRRVLIIDADMRCSSQHEVW--KV-ENSQGLNE-------ILE-NK-
A0A1Z4SQV2      VSANLAL-AMAQLGRRVLIIDADMRCSRQHEIW--KV-ENSQGLNE-------ILE-GT-
A0A2H2XGN1      VSANLAL-AMAQLGRRVLIIDADMRCSRQHEIW--KV-ENSQGLNE-------ILE-GT-
A0A433UXH8      VSANLAL-AMAQLGRRVLIIDADMRCSNQHQIW--KV-ENSQGLNE-------ILE-NK-
A0A1Z4RMB9      VVANLAA-AIAQLGRSVLLIDADLRRSSQHTLW--GV-DNNLGLKD-------ILTNDQ-
D5A466          VSANLAA-AIAQLGHRVILIDGDMRQPIQHHIW--GL-TNAVGLSD-------VLV-EE-
K1XF69          VSANLAA-AIAQLGHRVILIDGDMRQPIQHHIW--GL-TNAVGLSD-------VLV-EE-
B5W297          VSANLAA-AIAQLGHRVILIDGDMRQPIQHHIW--GL-TNAVGLSD-------VLV-EE-
H1W7M8          VSANLAA-AIAQLGHRVILIDGDMRQPIQHHIW--GL-TNAVGLSD-------VLV-EE-
B4WP72          VSVNLAT-TIAQSGQRVLLIDADMRHPSLHKTW--NI-SNRVGLSS-------FLV-GQ-
A0A318B4H2      SAYALSR-LFAETGASVVLIDADMRNTRLDDLV--AL-DARPGLSN-------YLS-GA-
B4WQE3          ISFYLAH-ASASLGKRTLLVDADLRHPTLHRLC--NL-PNEKGLSD-------YIA-GD-
A0A2K3BR24      VSANLGM-ALAELGHRVLIIDADLRRPSQHQVW--EE-PNAVGLSN-------VLV-ED-
K9YXY1          ISANLGM-ALAELGNKVLIIDGDLRRPSQHQVW--EE-PNAVGLSN-------VLV-ED-
A0A2P8W4F7      ICAHLAI-AAANMGRRVLLIDGDLRKPSQHLIF--GQ-PNRQGLSD-------LITQAI-
U5QJM6          VSTNLAR-IAAELNRKVLIIDADLRRPTVAKRL--EL-TNSRGLSS-------VLA-GN-
A0A1U7HGH0      TCANLAA-VMALLNYKVLIIDADLRHPSQHQIW--EI-ANHIGLMN-------TIT-KR-
K9XJD3          TCANLAA-VMALLNYKVLIIDADLRHPSQHQIW--EI-ANHIGLMN-------TIA-KR-
K9SX01          VSANLAV-AIAQLGKRVLLVDVDMRRPSQHKIW--GL-GNASGLSN-------ILV-GE-
A0A1E5QIR9      VSANLAL-AIAQLGFRVLLVDADMRHPSQQAFW--DT-PKTVGLSN-------IIV-EQ-
A0A1Z4IBC7      VSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW--EL-SNEIGLSN-------VLI-GQ-
A0A1W5CPC7      VSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW--DL-SNAIGLTN-------VLI-GQ-
Q3MDC6          VSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW--DL-SNAIGLTN-------VLI-GQ-
A0A1Z4KM73      VSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW--DL-SNAIGLTN-------VLI-GQ-
Q8YNX7          VSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW--DL-SNAIGLTN-------VLI-GQ-
A0A367R4K6      VSANLAV-TMAQAGRRVLLVDTDMRHPIQHHIW--EL-KNTVGLSN-------VII-GQ-
A0A1E2WSV8      VSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW--GL-PNAMGLSN-------VII-GQ-
A0A2R5FRT9      VSANLAV-TMAQAGRRVLLVDADMRNPMQHHIW--GL-TNVTGLSN-------AIA-GQ-
A0A2K8T1B6      VSANLAV-TMAQAGRRVLLVDADMRNPIQHHIW--GL-KNTIGLSN-------VII-GE-
A0A235I9I0      VSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW--GL-TNTSGLSN-------IIG-SQ-
A0A2D0HQT8      VSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW--GL-TNTMGLSN-------IIT-NQ-
A0A2L2NU95      VSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW--GL-TNTMGLSN-------VIL-NQ-
A0A367S084      VSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW--GL-TNTMGLSN-------ILI-NQ-
A0A0V7ZFJ4      VSANLAV-TLSQLGRKVLLVDADMRRPRQHRIW--RR-PNLIGLSN-------VLV-GQ-
A0A0V7ZNJ9      VSANLAV-TISQFGQRVLLIDGDMRRPRQHKLW--KI-HSFSGLSN-------LLV-GK-
A0A367RIS1      VAANLAV-ATAQMGKRVLLIDADMRRPRQHEIW--QK-PNLMGLSN-------VLV-GQ-
A0A235IXQ2      IAANLAV-ATAQMGRRVLLIDADMRHPHQHKMW--QQ-PNLMGLSN-------VLV-GQ-
A0A1W5CNX3      IAANLAV-ATAQMGRRVLLIDADMRRPRQHEMW--QQ-PNLMGLSN-------VLV-GQ-
Q3MEB7          IAANLAV-ATAQMGRRVLLIDADMRRPRQHEMW--QQ-PNLMGLSN-------VLV-GQ-
A0A1Z4KHN9      IAANLAV-ATAQMGRRVLLIDADMRRPRQHEMW--QQ-PNLMGLSN-------VLV-GQ-
Q8YT70          IAANLAV-ATAQMGRRVLLIDADMRRPRQHEMW--QQ-PNLMGLSN-------VLV-GQ-
A0A218Q4C1      ITANLAV-ATAQMGQRVLLIDADMRRPSQQEVW--QV-RNLIGLSN-------VLV-GQ-
A0A166IWU6      VAANLAV-ATAQMGRRVLLIDADMRRPRQQELW--QV-RNLMGLSN-------ILA-GQ-
A0A2S0Q8C0      VAANLAV-ATAQMGRRVLLIDADMRRPRQQEVW--QV-RNLMGLSN-------VLA-GQ-
W6FSX4          VAANLSV-ATAQMGRRVLLIDADMRRPRQREVW--QV-RNLMGLSN-------VLA-GQ-
A0A1B7WTD1      VAGNLAV-AASHVGKRVLLIDCDMRRPRQHRIW--EI-PNLLGMSN-------ILA-GQ-
A0A1B7WX82      VAANLAL-AAAHVGRRVLLVDADMRRPRQQRIW--ET-PNLLGLSN-------ILA-GQ-
A0A0R0M9H9      VSANLAL-AASHLGKRVLIVDADLRRPRQHKVW--GL-PNFVGLSN-------VLV-AQ-
A0A1S1ZVW2      VSANLAL-AASHLGKRVLIVDADLRRPRQHKVW--GL-PNFVGLSN-------LLV-AQ-
A0A1Z4LRU5      VSSNLAV-AMAQLGRRVLLIDADMRRPTQQNIW--DL-PNMIGLSN-------VLV-GQ-
A0A1Z4JVB4      IAANLAT-ATAQLGKKVLLLDADMRRSRQHKIW--QQ-SHLMGLSN-------ILV-GQ-
K9PIA4          VTANLAV-AIAQLGRRVLLIDADMRRPRQHKIW--EQ-SNLIGLSN-------ILV-GQ-
A0A1Z4M597      VAANLAV-AVAQLGRRVLLVDADMRRPRQHKIW--EQ-NNLVGLSN-------ILV-GQ-
A0A1Z4MWT1      VAANLAV-AVAQLGRRVLLVDADMRRPRQHKIW--EQ-NNLVGLSN-------ILV-GQ-
A0A1Z4TX53      VAANLAV-AVAQLGRRVLLVDADMRRPRQHKIW--EQ-NNLVGLSN-------ILV-GQ-
A0A1Z4HVE1      VAANLAV-AAAQTGRRVLLVDADMRRPRQHKIW--EQ-SNLIGLSN-------ILV-NQ-
A0A252ECZ1      VAANLAV-AAAQIGHRVLLVDADMRRPRQHKIW--EQ-SNLIGLSN-------ILV-GQ-
A0A1Z4G5Y1      VAANLAV-AAAQTGRRVLLVDADMRRPRQHKVW--EQ-SNLIGLSN-------ILV-NQ-
A0A252DNA2      VAANLAV-AAAQTGRRVLLVDADMRRPRQHKVW--EQ-SNLIGLSN-------ILV-NQ-
A0A252E1Q4      VAANLAV-AAAQTGRRVLLVDADMRRPRQHKVW--EQ-SNLIGLSN-------ILV-NQ-
A0A2A2TNQ5      VAANLAV-AKAQMGKRVLLIDADMRRPRQHEIW--EL-QNFMGLSN-------ALV-GQ-
A0A3S1C4K5      VAANLAV-AKVQMGYRVLLIDADMRRPRQHKVW--EK-ANFMGLSE-------VLV-GQ-
A0A1X4G3D5      VSANLAA-ALSYLGKRVLIVDGDLRRPCQHRVW--KL-PNFVGLSE-------ILA-GR-
D4TNI2          VSANLAA-ALSYLGKRVLIVDGDLRRPCQHRVW--KL-PNFVGLSE-------ILA-GR-
A0A1Z4H6Z8      VAANLAV-AAAQTGRRVLLVDADMRRPRQHKIW--EQ-SNLIGLSN-------ILV-NQ-
A0A1Z4NPM1      VSANLAV-AMSQLGKRVLLIDADMRRPRQHKVW--QL-ANITGLSN-------LLV-GQ-
A0A3F3KPR9      ISANLAL-AASHLGKRVLIVDGDLRRPRQHKVW--GL-PNFVGLSN-------VLV-AQ-
D4TGN7          ISANLAL-AASHLGKRVLIVDGDLRRPRQHKVW--GL-PNFVGLSN-------VLV-AQ-
A0A1Z4UZW9      VAANLALAAAAQPGRRVLLVDADMRRPRQQSIW--EI-HNLLGLSN-------VLA-GQ-
A0A0K2M5H0      VAANLAL-AAAYVGRRVLLVDADMRLPRQHRVW--EI-HNLLGLSN-------ILA-GQ-
A0A1B7VSH4      VAANLAL-AGAYVGKRVLLVDADMRRPRQHRVW--EI-HNLLGLSN-------ILA-GQ-
A0A1B7W126      VAANLAL-AGAYVGKRVLLVDADMRRPRQHRVW--EI-HNLLGLSN-------ILA-GQ-
A0A3D4C6Q6      VAANLAL-AGAYVGKRVLLVDADMRRPRQHRVW--EI-HNLLGLSN-------ILA-GQ-
K7W0A4          VAANLAL-AAAHVGRRVLLVDADMRRPRQHRVW--EI-PNLLGLSN-------ILA-GQ-
A0A1B7UTR1      MAANLSL-AAAHVGRRVLLVDADMRRPRQHRIW--ET-PNLLGLSN-------ILA-GQ-
A0A1B7UVJ4      MAANLSL-AAAHVGRRVLLVDADMRRPRQHRIW--ET-PNLLGLSN-------ILA-GQ-
A0A2T1CIL7      VASNLAK-SMADLGRRVLLIDADLRRPTQHHIL--GL-SNTAGLSN-------VLL-NE-
A0A1Z4RPC6      IAANLAA-AMAQLGRKVLLIDGDLRKASQQDLW--QV-SNLMGVKD-------VIT-HK-
A0A2T1CMZ0      VAANLAA-AMAQLGRKVLLIDGDLRKASQHDLW--QI-SNKVGVKD-------VVA-HK-
L8M4F7          VTANLAA-AISQLGSRVLLVDGDLRRPSQHLLW--NR-NSHQGIKE-------VIQ-GE-
L8LZE9          VTANLAA-AISQLGRKVLLIDGDLRKASQHQLW--GV-SNQKGVKE-------LLT-EK-
A0A140K2P2      VSANLAA-AIAQLGKRVLLIDGDLRKPSQHRLW--NL-ENFVGLRD-------VIV-AQ-
K9XWX4          VSANLAT-AIAQLGKRVLLIDGDLRKPSQHHLW--NL-DNFVGLKD-------VIS-AQ-
A0A140KB14      VAANLAA-AIAQLGRRVLLIDGDLRRATQHHLW--SM-SNHLGFKD-------VLT-HK-
K9XX88          IAANLAT-AIAQLGRRVLLIDGDLRRANQHHLW--NM-SNHLGLKD-------VLT-HK-
A0A433V7A0      VAANLAA-AIAQLGKQVLLVDADMRHPSQHTAW--NL-INEVGLSN-------AIV-SR-
A0A0C2LBE2      VAANLAM-AMTQVGHRVLLVDADMRHPVQHHVW--NL-TNAVGLSH-------VIV-NP-
A0A433NN38      VSANLAV-VMAQVGRRVLLVDADMRRPCQHHIW--GL-TNAQGLSN-------AIVDDQ-
A0A2N6K0T2      VSANLAV-AMAQVERRVLLVDADMRHPIQHHIW--QL-RNNQGLSN-------IIV-DQ-
A0A2N6ML72      VSANLAV-AMAQVERRVLLVDADMRHPIQHHIW--QL-SNNQGLSN-------IIV-DQ-
G6FQZ6          VSANLAV-AMAQVERRVLLVDADMRHPIQHHIW--QL-SNNQGLSN-------IIV-DQ-
A0A2N6MQX9      VSANLAV-AMAQVERRVLLVDADMRHPIQHHIW--QL-SNNQGLSN-------IIV-DQ-
A0A2N6KXT6      VSANLAV-AMAQVERRVLLVDADMRHPIQHHIW--QL-SNNQGLSN-------IIV-DQ-
A0A2N6KGB9      VSANLAV-AMAQVERRVLLVDADMRHPIQHHIW--QL-SNNQGLSN-------IIV-DQ-
A0A2N6L3Y5      VSANLAV-AMAQVERRVLLVDADMRHPIQHHIW--QL-SNNQGLSN-------IIV-DQ-
A0A0S3TIS7      VSANLAV-AMAQVERRVLLVDADMRHPIQHHIW--QL-SNNQGLSN-------IIV-DQ-
A0A1U7GW28      VSANLAV-AMAQVERRVLLVDADMRHPIQHHIW--QL-SNNQGLSN-------IIV-DQ-
A0A2N6LW63      VSANLAV-AMAQVERRVLLVDADMRHPIQHHIW--QL-SNNQGLSN-------IIV-DQ-
A0A1Z4TQ63      VSANLAV-AMAEVERRVLLVDADMRHPIQHHIW--QL-SNKKGLSN-------IIV-DQ-
A0A0D6YFE2      VCANLAV-AMAEVERRVLLVDADMRHPIQHHIW--QL-SNKKGLSN-------LIV-DK-
A0A328IH74      VCANLAV-AMAEVERRVLLVDADMRHPIQHHIW--QL-SNKKGLSN-------IIV-DK-
A0A1Z4NDS1      VSANLAV-TVAQLGRRVLLIDADMRCPIQHHIW--GL-NNTIGLSN-------VIV-NQ-
K9F4D9          VAANLAL-TLAHLGHTVLLVDADLRKPTQHHIW--DL-PNVQGLSN-------FAS-GQ-
U9VXM0          VAANLAL-TLAHLGHMVLVVDADMRKPTQHLIW--DL-PNLQGLSN-------FAT-GQ-
A0A2T1FTR8      VAANLAL-AVAELGKRVLLVDADMRKPAQHLIW--RQ-GNYEGLSN-------VLS-GQ-
K9UA41          VAANLAL-AVAELGKRVLLVDADMRKPAQHLIW--RQ-GNYEGLSN-------VLS-GQ-
A0A1Z4SMD6      VSANLAA-ALANAGRRVLIVDTDMRQPRQHHLW--GL-INSTGLSN-------IIV-GQ-
A0A2H2Y096      VSANLAA-ALANAGRRVLIVDTDMRQPRQHHLW--GL-INSTGLSN-------IIV-GQ-
K9S8M8          VSANLAA-AMAQLGRRVLLVDADMRHPMQHHVW--HL-TNLAGLSN-------VIM-KQ-
A0A1Z4NFV0      VAANLAT-SIAQSGRRVLLVDADMRNPSQHHLW--GR-INPTGLSN-------ILV-GQ-
B0CAX4          VVANLAL-ALGELGHRVLVIDADMRRPSQHQVW--EL-PNALGLSN-------VLV-EQ-
U5DPF5          VSANLGV-ALAELGNRVLVIDADMRRPSQHQVW--EL-ANTTGLSN-------VLV-EQL
A0A350Y0P6      VSANLAI-AMAQVGRRVLLVDADMRHPMQHHIW--DL-ANTVGLSE-------VIV-HQ-
A0A352X940      VSANLAA-AMAQLGRKVLLIDADMRHPIQHHIW--DL-ANAMGLSE-------VIV-NH-
B8HTN4          VSANLAL-AIAELGHKVLLIDADLRLPLQHQIW--EL-PNATGLTH-------LLA-DN-
A0A2A2TPF8      VSANLAA-VMAQAGKRVLIIDADMRNPSQHHLW--GV-MNLTGLSN-------VIV-GQ-
A0A1Z4R0P8      VSANLAA-VIAQTGKRVLLIDADMRNPSQHHLW--GV-MNLTGLSN-------AIV-GQ-
A0A0T7BUI3      VSANLAA-ILAQAGRRVLLIDADMRKPSQHHLW--GL-INSVGLSN-------VIV-GQ-
A0A1Z4LP32      VSANLAA-ILAQSGKRVLLVDADMRQPNQHHLW--GL-INGGGLSN-------VIV-GQ-
K9REP9          VTANLGA-ILAQGGQRVLIVDADMRQPMQHHLW--GL-INSGGLSN-------VIV-GQ-
A0A1Z4SIJ3      VAANLAA-ALAQSGRQVLLVDADMRQPAQHRLW--GL-INSVGLSN-------VIV-GQ-
A0A2H2XPG4      VAANLAA-ALAQSGRQVLLVDADMRQPAQHRLW--GL-INSVGLSN-------VIV-GQ-
K9V3C7          VSANLAA-AIAQTGKRVLLVDADMRQPSQHHLW--GL-MNVKGLSN-------LLV-DR-
A0A1Z4T6Y7      VSANLAA-VIAQAGKRVLLVDGDMRNPAQHHLW--GV-MNLTGLSN-------VIV-GQ-
A0A2H2Y561      VSANLAA-VIAQAGKRVLLVDGDMRNPAQHHLW--GV-MNLTGLSN-------VIV-GQ-
A0A1Q4S362      VSANLAA-VIAQAGKRVLLVDSDMRNPSQHHLW--GV-MNLTGLSN-------VIV-GQ-
A0A3S1CIN8      VSANLAA-VIAQAGKRVLLVDSDMRNPSQHHLW--GV-MNLTGLSN-------VIV-GQ-
A0A2A2TC28      VTANLAA-IIAQSGRRVLLVDADMRQPSQHHLW--GL-INSSGLSN-------IIV-GQ-
A0A0C1NCB0      VSANLAA-VLAQSERKVLLIDADMRLPSQHHIW--GL-INSVGLSN-------VIV-AQ-
A0A2N6K7Q9      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--GL-INSVGLSH-------LLV-GQ-
A0A2N6MXH6      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--GL-INSVGLSH-------LLV-GQ-
A0A2N6M5A8      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--GL-INSVGLSH-------LLV-DQ-
A0A2N6LL61      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--GL-INSVGLSH-------LLV-GQ-
A0A0S3TP66      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--GL-INSVGLSH-------LLV-GQ-
G6FP91          VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--GL-INSVGLSH-------LLV-DQ-
A0A1U7GYR5      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--GF-INSVGLSH-------LLV-DQ-
A0A2N6KY52      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--GL-INSVGLSH-------LLV-DQ-
A0A2N6KMP5      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--GL-INSVGLSH-------LLV-GQ-
A0A2N6MA45      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--GL-INSVGLSH-------LLV-GQ-
A0A1Z4TLC8      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--SL-INSVGLSH-------LLV-GQ-
A0A0M0SFT2      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--SL-INSVGLSH-------LLV-GQ-
A0A0D6Y7R4      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--SL-INSVGLSH-------LLV-GQ-
A0A328IGA1      VSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW--SL-INSVGLSH-------LLV-GQ-
A0A0C2LFH0      VSANLAA-VLAQAGRRVLLVDADMRKPSQHHLW--GL-VNSVGLSN-------VIV-GQ-
A0A1Z4IYV4      VSANLAA-VLAQAGRRVLLVDADMRKPTQHHLW--GV-INSVGLSN-------MIV-CQ-
A0A1Z4Q0T6      VSANLAA-VLAQAGRRVLLVDADMRKPTQHHLW--GV-INSVGLSN-------MIV-CQ-
A0A0C2PT44      VSANLAA-VLAQAGRRVLLVDADMRKPTQHHFW--GV-INSVGLSN-------LIV-CQ-
A0A1D2P6J4      VSANLAA-VLAQAGRRVLLVDADMRKPTQHHLW--GV-INSVGLSN-------MIV-CQ-
A0A3M9ZEU1      IAANLAA-AAAQVGRRVLLIDADLRYPQQHHIW--DL-LNTGGLSN-------VIV-GQ-
A0A1Z4JK72      VAANLAA-TMAQSGRKVLLVDADMRNPSQHHLW--GI-VNSVGLSN-------VVV-DQ-
A0A0N7Z489      VAANLAA-TMAQSGRRVLLVDADMRNPSQHHLW--GL-VNSVGLSN-------VVV-DQ-
A0A0S3TXS2      VAANLAA-TMAQSGRKVLLVDADMRNPSQHHLW--GL-VNSVGLSN-------VVV-DQ-
A0A1Z4RN12      VSANLAV-ARAQCGQKVLLVDADMRRPTQHRIW--EI-TNEIGLSN-------VLK-HE-
A0A2T1CMF9      VSANLAV-ARSQCSQRILLIDADMRRPTQHHIW--EI-SNQIGLSE-------VLS-GK-
Q7NDC5          TAANLAA-VSAQAGARVLLVDGDLRKPRQHALW--DL-DNRQGLST-------LLV-GE-
U5QGK3          TVANLAI-VSAQSGARVLLIDADLRKPRQHKLW--EV-SNQQGLST-------LLT-GE-
A0A2W4UY24      ISANLAL-TLAQLGHSVLLIDADMRSPIQHHIW--DI-SNLKGLSN-------LVA-GQ-
A0A254WLE3      VSANLGA-AIAQLGNRVLIVDADMRRPRQHHIW--EK-ANTEGLSD-------AIV-GQ-
A0A433W533      VSANLGA-AIAQLGNRVLIVDADMRRPRQHHIW--EK-ANTEGLSD-------AIV-GQ-
A0A2P8QWJ3      VSANLGA-AIAQLGNRVLIVDADMRRPRQHHIW--EK-ANTEGLSD-------AIV-GQ-
A0A2T1FKP8      VSANLGA-AIAQLGNRVLIVDADMRRPRQHHIW--EK-ANTEGLSD-------AIV-GQ-
K9U6L7          VSANLGA-AIAQLGNRVLIVDADMRRPRQHHIW--EK-ANTEGLSD-------AIV-GQ-
A0A2T1GMT4      VAANLAA-AIAGMGQKVLLIDADMRVPYQHRFW--KL-PLKKGLSE-------LIE-RK-
K9UI51          VAANLAA-AIAGMGQKVLLIDADMRVPYQHRFW--KL-PLRKGLSE-------LIE-RK-
K9TYI2          VSANLAA-AIAQLGRKVLLVDADMRDSSQHHLW--QL-TNAAGLSE-------VLV-GQ-
A0A254W5G5      ISVNLAV-AIAQLGRKVLLVDADMRDSSQHHLW--QL-TNAAGLSE-------VLV-GQ-
A0A2T1FXY4      VSANLAA-AIAQLGRKVLLIDADMRDSSQHHLW--QL-TNAAGLSE-------VLV-GQ-
A0A1Z4QL41      VSANLAA-VMAQLGRKVLLIDADLRLPSQHDLW--QL-NNLAGLSE-------VLV-DE-
A0A252D4T4      VSANLAA-AIAQLGRRVLLIDADMRVPSQHHLW--QI-TNTAGLSE-------VLV-GE-
A0A252DJH5      VSANLAA-AIAQLGRRVLLIDADMRVPSQHHLW--QI-TNTAGLSE-------VLV-GE-
A0A252EB80      VSANLAA-AIAQLGRRVLLIDADMRVPSQHHLW--QI-TNAAGLSE-------VLV-GE-
A0A1Z4HPW5      VSANLAA-AIAQLGRKVLLIDADMRVPTQHHLW--QI-TNTAGLSE-------VLV-GE-
A0A1Z4MSN1      VSANLAA-AIAQLGRKVLLIDADMRVPTQHHLW--QI-TNTAGLSE-------VLV-GE-
A0A1Z4U1C2      VSANLAA-AIAQLGRKVLLIDADMRVPTQHHLW--QI-TNTAGLSE-------VLV-GE-
A0A0D6KV51      VSANLAA-AIAQLGRKVLLIDADMRVPTQHHLW--QI-TNTAGLSE-------VLV-GE-
A0A1Z4MKF8      VSANLAA-AIAQLGRKVLLIDADMRVPTQHHLW--QI-TNTAGLSE-------VLV-GE-
A0A2C6WC43      VSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW--EL-TNAVGLSE-------VLV-GQ-
A0A1Z4L5A1      VSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW--QL-TNAVGLSE-------VLV-GQ-
A0A367QD86      VSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW--QL-TNVVGLSE-------VLV-GQ-
A0A235IZ96      VSANLAA-AIAQLGRQVLLIDADMRVPSQHHFW--QL-SNAVGLSE-------VLV-GQ-
A0A2L2NGP0      VSANLAA-AIAQLGRQVLLIDADMRVPSQHHFW--QL-SNAVGLSE-------VLV-GQ-
A0A2K8SM78      VSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW--QL-TNAVGLSE-------VLV-GQ-
A0A2R5FPC0      VSANLAA-AIAQLGRKVLLIDADMRIPSQHHLW--QL-TNAVGLSE-------VLI-GQ-
K9QM62          VSANLAL-AISQMGRKVLLIDADMRVPSQHKIW--EL-SHTSGLSD-------VLV-GQ-
A0A1Z4FWI3      VSANLAA-AIAQLGRRVLLIDADMRVPSQHHLW--QI-TNSAGLSD-------VLV-GE-
A0A1Z4JYE7      VSANLAA-AIAQLGRRVLLIDADMRVSSQHYIW--GI-TSTAGLSE-------VLV-GH-
A0A140KBA0      VSANLAI-AQNQVGKRILLIDADMRRPSQHKIW--SI-PNYLGLSN-------VLK-GE-
K9XSG1          VSANLAI-AQNQVGKRILLIDADMRRPTQHKIW--SI-PNYLGLSN-------VLK-GE-
A0A0F5YE28      VSANLAA-TLAQLGYRVMLIDADMRQPSQHHLW--GL-TNAVGLSD-------ILV-GQ-
U7QEH7          VSANLAA-TLAQLGYRVMLIDADMRQPSQHHLW--GL-TNAVGLSD-------ILV-GQ-
A0A3S1ATK5      VAANLAT-VISQLGRKVLLIDADLRVPTQHHFW--QI-SNSPGLSE-------VLV-AQ-
A0A2Z6CPH0      VSANLAA-AIAQLGRRVLLIDADMRVPSQHHLW--QL-TNVAGLSE-------VLV-GQ-
A0A1Z4GT50      VSANLAA-AIAQLGRRVLLIDADMRVPSQHHIW--QL-TNAAGLSE-------VLV-AQ-
A0A1Z4GIX0      VSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW--QL-TNAAGLSE-------VLV-GQ-
A0A2H6LC24      VSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW--QL-TNAAGLSE-------VLV-GQ-
B2J6N5          VSANLAT-AIAQLGRQVLLIDADMRVPSQHHLW--EV-SNADGLSE-------VLV-GQ-
A0A367RMI4      VSANLAA-AIAQLGRQVLLIDADMRVPSQHHLW--EL-TNEVGLSE-------VLV-GQ-
A0A235HUM0      VSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW--QL-TNEVGLSE-------VLV-GQ-
A0A2L2NW47      VSANLAA-AIAQLGRQVLLIDADMRVPSQHHLW--QL-TNEVGLSE-------VLV-GQ-
A0A1E2WUR1      VSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW--QL-TNAVGLSE-------VLV-GQ-
A0A235IKU3      VSANLAA-AIAQLGRQVLLIDADMRVPSQHHFW--QL-SNAVGLSE-------VLV-GQ-
F4XKF3          VSANLAA-AMAQLGRRVLLIDSDMRHPCQHYIW--QV-MNVAGLSQ-------VLI-GE-
A0A1D9FX10      VSANLAA-AMAQLGRRVLLIDSDMRHPCQHYIW--QV-MNVAGLSQ-------VLI-GE-
A0A1D8TNX9      VSANLAA-AMAQLGRRVLLIDADMRHPCQHYIW--QV-MNVAGLSQ-------VLI-GE-
A0A1U7MYU6      VSANLAA-AMAQLGRRVLLIDSDMRHPCQHYIW--QV-MNVAGLSQ-------VLI-GE-
A0A3C0NJ41      VSANLAA-AMAQLGRRVLLVDADLRHPFQHHMW--EL-TNAGGLSD-------VLV-GQ-
A0A352AG88      VSANLAA-AIAQLGRRVLLIDADLRHPLQHHIW--DL-TNTAGLSD-------VLV-GQ-
A0A350Y374      VSANLAL-AIAQLGRRVLLVDADLRYPVQHHIW--QL-TNAAGLSD-------VLV-VQ-
A0A355DPX0      VSANLAL-AIAQLGRRVLLVDADLRYPVQHHIW--QL-TNAAGLSD-------VLV-VQ-
A0A0D8ZUV2      VSANLAT-AMAQLGYRVLLVDADMRRPVQHHIW--KL-NNITGLSD-------VIV-GQ-
A0A433VDI0      VSANLAA-AIAQLERQVLLVDADMRRPVQHHVW--EL-TNAVGLSD-------VIV-GQ-
A0A3D1PG43      VSANLAA-AIAQLGRRVLLVDADMRCPVQHHIW--NI-NNVAGLSN-------VIV-SQ-
A0A2P8QQ72      VCANLAV-AIAQLGRRVLLIDADLRSPIQHHIW--QQ-TNVEGLSH-------VLV-GG-
K9TZQ7          VCANLAV-AIAQLGRRVLLIDADLRSPIQHHIW--QQ-TNVEGLSH-------VLV-GG-
A0A2G7GPR0      VSANLAA-AMAQLGRKVLLIDADMRHPLQHHIW--EL-TNAAGLSD-------VIV-SQ-
K9XH68          VSANLAA-AMAQLGRKVLLVDADMRHPLQHHIW--EL-TNAAGLSD-------VIV-SQ-
A0A1U7HW70      VSANLAA-AMAQLGRKVLLVDADMRHPLQHHIW--EL-TNAAGLSD-------VIV-SQ-
A0A2S6VEJ8      VSANLAA-AMAQLGRKVLLVDADMRHPLQHHIW--EL-TNAAGLSD-------VIV-SQ-
                    ..           :::* * *                                   

K9SLA9          --A-NFY--TTTQQVE-PR-----LELLTAGTLPTN--PAALLDS-RPMNSLLSVAAR--
A0A168TT23      --SQEVATSSIIPTTT-EG-----LFVMPSGNQAPN--PAELLSS-DRMRKIINMSAR--
A0A0M1JWX9      --T-DLQAKDAIQRSPIEEN----LFILTAGTLPPD--PIRLLSS-QKMQQLMQQWSR--
A0A2T1M1V6      --YPE------ILLPIHPG-----FDLMLAPLIQPN-KIGEFFLR-GEFEQRLNRAQASD
A0A2G7GCS2      --GQQ------TPVSVCLG-----LDLLPAPNLSKT-KIPEYFAR-GRFQQNLDQIQAEG
K9XBH8          --AKQ------SPVSVSLG-----LDLIPAPAVRRE-KIAEFFAR-GSFERNLNQIQSSG
A0A1Z4LJ30      --RF-------IHKKIRPN-----LDLLSVNIAEDK--ISEFVAR-GEFEQHLNFVQTND
K9RI76          -----------VHNQVRFN-----LDLLSVNIAEDK--ISEFVAR-GEFEQYLNLIQAQG
A0A352AE27      -----------KPVQLRPS-----LDLVPTLPKQGK--IVEMVTR-GRFEESLVAAQSAN
A0A3B8JH60      --APLFADVAQQPVQIQPS-----LDLVPISPKKGK--IVELVRG-GRFEQSLEAIQSAG
A0A3C0N766      --APLFADVAQQPVQIQPS-----LDLVPISPKKGK--IVELVRG-GRFEQSLEAIQSAG
K9W9J7          --APRFANEVQQPVSLEGG-----LDLLPTSPKKGK--IVELVRR-GRFEQSLAVAESAN
A0A139WSU3      -----------LQRSIQPN-----LDLLPTLPKRGK--IVETIKR-GRFEQALTACEARG
A0A433VN22      -----------LSISIQPN-----LDLLPTLPRQGK--IVEIIRR-GNFEKTLATCEANN
Q7NF11          --A--------EPVSVIAD-----LDLVPALAIEDT--STAFFVQ-GGFERYLDDVQTD-
A0A1Z4JCS8      --D--------QVISLQPN-----LDFVPTMPQTGK--IVDLVKR-GRFERYLAVAESQK
F4XTX2          --G--------QPVKIQPS-----LDLLPTSHKKGK--IVELVTQ-GKFEQSLATAEESG
Q7NJN6          --S--------EPVALAPS-----LSFLPAGRPDERTSVGEYIAR-GHFSRYLSELESAG
U5QCC3          --N--------EPVALAPS-----LNFLPAGQPDGDASIGEHIVK-GNFTRHLDRLKQEN
A0A0S3TYD7      --S-TLE--DALCPVM-EN-----LWLLPAGKIPPN--PIALLDS-ERMSFLMQVFLE--
U5QL42          --T-PWQ--QLVQSGGNPN-----LTLLTSGPIPPN--PVALLNS-EKMTELLAQWRE--
K9QF04          --F-PIE--NIIQISPENEN----LHILTAGKTPPN--PAQLLSS-SKMRDLLVQFQK--
A0A3C0N2P0      --I-NFE--DVIQRSPIEDN----LFVLTAGQIPPD--PTRLLSS-KKMKNLVERFQE--
K9TLQ0          --S-LNA--QDSIQQSALNQN---LYVLTAGQMPPD--PARLLSS-QRMKQLIEEFKT--
A0A076HBF2      --D-QTW--RDAVQTVPGYQN---WSVLTAGRRPPD--PTRLLSS-NRMRSLVNELEASG
A0A354B169      --C-LHW--RNCVQSLPGYEH---WDVITAGLPPPD--STRLLSS-NRMRDLMVDLGHCG
G4FMX5          --S-SHW--RQALQPINGYEG---WSVMTAGRRPPD--PTRLLSS-KRMHQLVEDLGKSE
Q0IDT5          --A-LHW--RDLCKQVPGYEN---WSVMTAGLRPPD--PTRLLSS-QRMHDLVQEITQSN
A0A2D6FCW3      --S-NSW--RSLLQPVEGYEN---WSVITAGRRPPD--PARLLSS-NRLHQLVEDLENSG
A3ZA21          --G-FHW--RDVVQTVPGYDQ---WSLITAGRRPPD--PTRLLSS-QRMHSLVQELANGG
A0A140K3H3      --R-PWT--DFVQIGVVEN-----LHLITSGSTSPN--PIALLNS-DKMKQLLQQWQE--
K9XUB8          --R-PWT--DYVRLGVLEN-----LHLITAGSTSPN--PIALLNS-DKMKQLMQQWQE--
Q7NEU3          --M-HW----SNCVNQIDEN----VHVLTSGPLPPD--PVALLDS-LRMKELVKQWGE--
A0A352XE00      --I-NVD--NLIQESPVDEN----LFVLTAGQLPPD--PTRLLNS-KKMQNLVEYFQS--
B4VS56          --I-NVK--DVIQPSPLEEN----LFVLTAGQIPPD--PTRLLCS-QKMQHLVESFEE--
A0A352AAQ3      --I-SVD--DVIQQSPWEEN----LFVLTAGQIPPD--PIRLLCS-KKMQNLVAYLQK--
A0A350Y472      --I-NVS--DVIQQSPLEDN----LFVLTAGQIPPD--PTRLLCS-KKMQNLVERFHG--
A0A355DVB4      --I-NVS--DVIQQSPLEDN----LFVLTAGQIPPD--PTRLLCS-KKMQNLVDRFHG--
A0A2P8VVX1      --P-AQN--RPHRLDFGSVF----VDVLPAGPIPDD--PISLLSS-PRFRQLLARGKE--
A0A2P8WHY0      --T-RPS--RPHRLDFGPGH----IDVLPAGDPLND--PITLLSS-PRFQKLIHRCKS--
A0A2T1CMT9      --I-SLP--LIHQVSLSGAR----IDLITSGTMTED--PVKILNS-SRLGRFIEQQKE--
A0A1D8TX52      --T-ATP--NPVSISPLGST----IDVLTAGPTPID--PVKLLGS-KRMKNLMAEFQE--
A0A1U7N5X9      --I-ATP--SPVSISPLGST----IDVLTAGPTPID--PVKLLGS-KRMKNLMAEFQQ--
A0A1D9G4T2      --T-ATP--SPVSISPLGST----IDVLTAGPTPID--PVKLLGS-KRMKNLMAEFQQ--
F4XP71          --T-ATP--SPVSISPLGST----IDVLTAGPTPID--PVKLLGS-KRMKNLMAEFQQ--
A0A2P8QVH5      --A-DVR--ERDCIQSVQPS----LDVLTAGPTPTD--IVKLLSS-QRMKHLIESFEQ--
A0A2T1FT70      --A-DVR--ERDCIQSVQPS----LDVLTAGPTPTD--IVKLLSS-QRMKHLIESFEQ--
A0A433W4W4      --A-DVR--ERDCIQSVQPS----LDVLTAGPTPTD--IVKLLSS-QRMKHLIESFEQ--
K9U5W1          --A-DVR--ERDCIQSVQPS----LDVLTAGPTPTD--IVKLLSS-HRMKHLIESFEQ--
A0A254WLA7      --A-DVR--ERDCIQSVQPS----LDVLTAGPTPTD--IVKLLSS-QRMKHLIESFEQ--
A0A2W6ZAV2      --P-TLQ--PERLIQPISER----LDLITAGPAPPD--ATKLLSS-ERCSALVEQIRSLP
A0A2G7GMH8      --R-ALP--CRRRIQLFGAQ----IDVLTSGPTPVD--PVQLLSS-SKMKEMMLAFEQ--
K9W742          --A-PLP--IQTSLHASSAY----IDVITSGPISPD--PANLLSS-PRMGELMAEFEQ--
K9SA61          --A-LF---QHGDIQPSGHDSD--ISVLTAGPTPTD--PAKLLSS-RRMAELMAMFEQ--
A0A350Y7Z1      --S-SIP--SPQRLSLSGSE----IDVLTAGPIPPD--PVKLLSS-QRMRQLMAGFEQ--
A0A352X2A7      --N-SIP--NPQHVSLLGSN----IDVLTAGPIPLD--PVKLLSS-PRMKKLMASFEQ--
K9XPB0          --T-ASL--NIQQVTLAGEN----IDLVTCGSRITD--PVKFLSS-PKFKQSIDQLQA--
A0A0D8ZYV0      --A-NVP--SNAGIQSSGSY----IDILTAGPMPAD--PANLLSS-ERMRELMAKFED--
A0A3D1PBA3      --A-TLP--GQGVIQSSGAF----IDILTAGPLPSD--PANLLSS-QRMRELIAEFEK--
A0A254WJ87      --A-TLP--MHNAIQSSGSY----IDILTAGPQPED--PANLLSS-QRMRELMAGFEQ--
A0A2T1FP73      --A-TLP--IHNAIQSSGSY----IDILTAGPQPED--PANLLSS-QRMRELMAGFEQ--
A0A433VMS2      --A-TLP--IHNAIQSSGSY----IDILTAGPQPED--PANLLSS-QRMRELMAGFEQ--
K9TYA7          --A-TLP--IHNAIQSSGSY----IDILTAGPQPED--PANLLSS-QRMRELMAGFEQ--
A0A2P8QUE1      --A-TLP--IHNAIQSSGSY----IDILTAGPQPED--PANLLSS-QRMRELMAGFEQ--
A0A2T1DWE8      --T-PLR--HHGDFQPSHRYTDIPLSILTSGPTPTD--PAQLLSA-ERMGDLVQALEQ--
A0A1U7I8L3      --V-SLR--DETNVQISRQHNN--ISILTAGPTPLD--PAQLLSS-QRMRELMANFEQ--
A0A2T1DJL8      --R-ML---SQNAIQLAGTYSDLSISVLTAGPAPSD--PVKLLSS-RRMKELMTVFEQ--
A0A1Z4J9W0      --R-AI---TQGAIQPASTYSDLPISVLTAGSSPSD--SVKLLSS-KRMRDLMTLFEQ--
A0A0N7Z5K9      --R-AL---TQAAIQPASTYSDLPISVLTAGPTPTD--SVKLLSS-KRMRDLMTVFEQ--
A0A0S3TXC5      --R-AL---TQSAIQPASTYSDLPISVLTAGPTPTD--SVKLLSS-KRMRDLMTVFEQ--
A0A2T1DNG3      PIPQQIE--TQDANLR-GN-----ISVLTAGPTPAD--PAKLLSS-QRMKEIIATFEQ--
A0A2P8W9H0      --Y-DFE--DIVVNLPLDEK----LFIVTAGPIPPS--PLKILAA-PRMQEFYDKINQ--
A0A3S0Y9N9      --L-DLD--NAMTKVT-SN-----LQVITAGEQTNN--PSALINS-TQMAVFIAQVAQ--
A0A433UNK7      --V-DLD--QAVTEIV-PN-----LEVLTAGELNHN--PASLLDS-SQMAVFVAQVAQ--
B8HNB0          ----SWQ--EMLIPGGVTN-----LDILTAGFRPPN--PIALLDS-YKMVGLIDEWRQ--
A0A1Z4LN32      --H-DLE--DAVQKVT-EN-----LSVLTSGVMPPN--PLALIDS-ERMTSFIEMLSL--
A0A2I8A9F5      --N-DFS--ATVQAVT-PS-----LSVLTSGVTPPN--PLALIDS-EAMKSLIDNLSK--
A0A218Q6R8      --E-ELS--DTIKQIT-PN-----LSVLTTGVIPPN--PLALIDS-ECMTSLINRLNQ--
A0A0C1XVC4      --N-KFT--NSVRKIA-NN-----LSVLTAGVMPPN--PLALIDS-ERMTSFIDILSK--
A0A218QGE0      --N-DFS--KSVQRIT-SN-----LSVLTAGVMPPN--PLALIDS-ERMTSFIDMLSQ--
A0A3B8Y8H9      --L-APDQAITISPLN-PN-----LYVLVGTAKSPN--PSASLSC-EKFATLSRQWQE--
A0A1Z3HMQ0      --G-HLN--QALRPVA-NN-----LTLLSAGVTPPN--PLALIDS-ERMAALVRTLAK--
A0A1E5QP61      --A-KFN--IAVREVM-EN-----LDVLPSGATPPN--PLALIDS-KRMASLLEEFRD--
A0A3M2GIL5      --V-ELD--QATLDVS-DN-----LDVLPSGVIPPN--PLALLDS-KRMAGAIEQFAQ--
A0A433NM31      --I-DLE--TVVTKVE-QN-----LYVLTSGVLPPN--PLAILNS-RRMASLVEVFSS--
A0A3M1PML8      --V-SSE--SVIQEVM-PG-----LHVLPSGVVPPN--PVALLDS-KRMASLVEDFLK--
A0A352X442      --A-DFS--TAVQEVM-PG-----LEVLTSGVIPPN--PVAILDS-KRMANLMETFAK--
A0A0T7BPZ0      --V-PFN--TLMREVM-PN-----LFVITSGVLPPN--PVALLDS-QGMESLVINFAQ--
A0A0M0SHU3      --V-PIE--TVLHEVM-PN-----LHVLTSGVMPPN--PVALLDS-ERMASLVANFTK--
A0A1D2PBN3      --V-PID--IAVQEAI-PN-----LYVLSSGVVPPN--PVALLDS-RRMAALVNTFVK--
A0A0C2LVR7      --L-PID--IAVQEAI-PN-----LYVLPSGVVPPN--PMALLDS-RRMAALVNTFVK--
A0A1Z4PQB9      --L-PID--IAVQEVI-PN-----VYVLPSGVVPPN--PVALLDS-RRMAALVNTFVS--
A0A1Z4SFN6      --S-PMR--VAIQEVM-PY-----LYVLPSGVVPPN--SVALLDS-QRMATLVTTFTE--
K9PGI8          --V-PLN--KAVQEFI-PN-----LYVLTSGVIPPN--SIALLGS-KRMDSLVKIFAK--
A0A2W1JVB9      --A-TLE--DAIQEGE-TN-----LDVLTAGVLPPN--PSALIDS-DHMVNLLQEFGR--
A0A3M1SVZ4      --V-DFH--LALQPTM-PN-----LDVLTAGTLAPN--PIALLDS-QRMVSLMEEFAD--
K9SSQ0          --L-PWQ--QIIHTGDHSQFSAGYLHIITAGATPPN--PMILLES-NKFQKLLGEWDQ--
A0A2W1JIN9      --V-SLE--SAAQSTSIDN-----LSVVTAGSSCVL--PSRFFES-DGMKILLEEARS--
A0A318AJV1      --A-PLV--ATVIPDRIGG-----LDILPVAQTLFI--SRDIFSP-STVQNLLENGRA--
A0A254WHG9      --L-ALA--EAVQTTGIDK-----LKVLCSGRPRSH--PSELFES-RQIQQVIAAAAT--
A0A2P8QIL5      --L-ALA--EAVQTTGIDK-----LKVLCSGRPRSH--PSELFES-RQIQQVIAAAAS--
A0A2T1FLY5      --L-ALA--EAVQTTGIDK-----LKVLCSGRPRSH--PSELFES-RQIQQVIAAAAS--
A0A433W447      --L-ALA--EAVQTTGIDK-----LKVLCSGRPRSH--PSELFES-RQIQQVIAAAAS--
K9U1K8          --L-ALA--EAVQTTGIDK-----LKVLCSGRPRSH--PSELFES-RQIQQVIAAAAS--
A0A1U7N2U4      --Q-TCL--EAVQPTAIAN-----LSILTCSDQPSG--PATFLQS-QVMKSILAAAGD--
A0A1D9G1F2      --Q-TWL--SAVQPTAIPN-----LSILTCSDLPSG--PATFLQS-QVIKSILAAAAD--
F4XV38          --Q-TWR--SAVQPTAIAN-----LSILTCSDQPSG--SATFLQS-QMIKSILAAAAD--
K9UYB2          --K-TLT--QAIQPTEIEN-----LWVLTCGDFYGS--ASQMLES-AAMRHIITEASE--
A0A0C1XJI7      --R-SLN--QAVQLTDVDN-----LHVLTGGEFHGR--PSQLLES-PAMKSLVAEAAE--
A0A218QN17      --R-SLN--QAVQPTDVEN-----LDVLTGGEFHGR--PSQLLES-PAMKSLVAEAAA--
K9RKN2          --R-NFA--NAIQKTDVDN-----LDVLTCGELHGR--PSQLLES-VEMKLILEEAAK--
A0A2I8ADV2      --R-TLL--NAVQPTDIEN-----LSVLTCGELHGR--PSQLLES-EAMKSLIAEAAH--
A0A1W5CKM3      --R-PLL--SAVQSTTIEN-----LSVLTCGELRGR--PSQILES-AAMKALVAEAAQ--
Q3MEW0          --R-PLL--SAVQSTTIEN-----LSVLTCGELRGR--PSQILES-AAMKALVAEAAQ--
A0A1Z4KIC7      --R-PLL--SAVQSTTIEN-----LSVLTCGELRGR--PSQILES-AAMKSLVAEAAQ--
Q8YSM5          --R-PLL--SAVQSTTIEN-----LSVLTCGELRGR--PSQILES-AAMKSLVAEAAQ--
A0A1Q4S1H4      --SGRLA--DFVQPTGIEN-----LSVLTCGSMSAR--PSQLLES-NQMKALLTEAAE--
A0A433VBU6      --R-RLA--DFVQPTAIEN-----LFVLTCGSMSTR--PSQLLES-TYMKALMMEAAE--
A0A1Q4RZJ6      --I-SLK--EAVQPTEIEN-----LSVLTCGGIYGR--PSQILES-AAMKKLIAEAAA--
A0A1Z4SNV3      --I-SLK--EAVQPTEIEN-----LSVLTCGELHVR--PSQILES-PAMKRLISEAVA--
A0A2H2XJQ1      --I-SLK--EAVQPTEIEN-----LSVLTCGELHVR--PSQILES-PAMKRLISEAVA--
A0A3S5K358      --I-SLK--EAVQPTEIEN-----LSVLTCGGIYGR--PSQILES-AAMKKLIAEAAA--
A0A0T7BPJ4      --L-SLM--EAVQPSGTEN-----LSVLTCGEMHNR--PSQLLES-PEMKALIAEATA--
A0A0C1QS61      --I-SLA--DAVQSTDIEN-----LDVLTCGELHGR--PSQLLES-IAMKSLVAEASE--
A0A139X3R8      --I-SLA--DAVQSTDIEN-----LDVLTCGELHGR--PSQLLES-VAMKSLVAEAAE--
A0A1Z4I7C5      --R-PLL--NAVQSTAVDN-----LSVLTCGELRGR--PSQILES-PAMKSLVAQAAE--
A0A0C2MDK7      --I-SLL--DAVQPTDIEN-----LDVLTCGELHGR--PSQLLES-IAMKSLMAEAAE--
A0A1Y0RCK1      --I-SLL--DAVQPTDIEN-----LDVLTCGQLHGR--PSQLLES-IEMKSLIAEASE--
A0A1Z4PWZ0      --V-SLL--DAVQPTDIEN-----LDVLTCGELYGR--PSQLLES-IAMKSLVAEAAE--
A0A0C2QLT0      --V-SLL--DAVQPTDIEN-----LDVLTCGELYGR--PSQLLES-IAMKSLVAEAAE--
A0A1Z4J2K1      --V-SLL--DAVQPTDIEN-----LDVLTCGELYGR--PSQLLES-IAMKSLVAEAAE--
A0A3S0ZSX0      --R-SLQ--QTVQPTRIEN-----LFVLTCGELYGR--PLQLLES-DAMKSLLAEAVQ--
A0A2N6K4T3      --R-SLE--ETVQQTNIAN-----LCVLTCGELCGY--PSRLLES-NAISSLLAEATR--
A0A370CKT2      --R-SLE--ETVQRTNIPN-----LSVLTCGELHGR--PSHLLESXXXMKSLLIEAVR--
A0A0S3TL97      --R-SLE--ETVQRTNIPN-----LSVLTCGELHGR--PSHLLES-EAMKSLLIEAVR--
A0A2N6M8A0      --R-SLE--ETVQRTNIPN-----LSVLTCGELHGR--PSHLLES-EAMKSLLIEAVR--
A0A2N6M9E1      --R-SLE--ETVQRTNIPN-----LSVLTCGELYGR--PSHLLES-EAMKSLLIEAVR--
A0A2N6KJI4      --R-SLE--ETVQRTNIPN-----LSVLTCGELHGR--PSHLLES-EAMKSLLIEAVR--
A0A2N6MZ77      --R-SLE--ETVQRTNIPN-----LSVLTCGELHGR--PSHLLES-EAMKSLLIEAVR--
A0A2N6KT20      --R-SLE--ETVQRTNIPN-----LSVLTCGELYGR--PSHLLES-EAMKSLLIEAVR--
G6FSN3          --R-SLE--ETVQRTNIPN-----LSVLTCGELHGR--PSHLLES-EAMKSLLIEAVR--
A0A0D6YL98      --R-SLE--ETVQRTHIAN-----LSVLTCGDLYGR--PSHLLES-EAMRSVIIEATR--
A0A328I8B9      --R-SLE--ETVQRTHIAN-----LSVLTCGDLYGR--PSHLLES-EAMRSVIIEATR--
A0A0M0SU69      --R-SLE--ETVQRTHIAN-----LCVLTCGDLYGR--PSHLLES-EVMKSLMTEATQ--
A0A1Z4TIZ8      --R-SLE--ETVQRTHIAN-----LSVLTCGDLYGH--LSHLLES-EVMKSLITEAIL--
A0A318BG22      --L-PLS--DVRIRLQDQG-----FDIITSGPLPPN--PALLLSS--GLQSQIDALMA--
A0A2T1E9V8      --V-SFS--DRVIQTVRKN-----LDVITTGESDHN--QNILLDS-RKMGAFINQCPK--
A0A0P1C0L3      --A-SLE--SQVFSSDLFA-----IDVLPAGRTPPN--PVELLAS-PRIGHILTQARD--
A0A3M2GQQ6      --R-NWS--DLIHRSESGR-----LHILTSGPTPPN--PVALLES-QKMTQMLTQWRQ--
K9SGJ5          --R-SWRQVVQSANVK-GC-----LNVITSGPLPPN--PMVLLES-TKMTKLLQLWRQ--
L8MYT6          --S-PWQELTQVVDEK-GN-----LHILTSGSIPPN--PMLLLES-VKMTALVQEWRQ--
A0A352JGJ6      --S-PWQDLVQIADEK-DN-----LHILASGSLPPN--PMLLLES-TKMSALLQEWRQ--
A0A1J5GLS2      --T-PWQDLIQSGDEK-GN-----LDVLTSGSIPPN--PMMLLES-TKMNALIQEWRQ--
A0A2W4W6M5      --S-PWQDLIQVADDK-GN-----LHVLTSGSIPPN--PMLLLES-AKMTALLQEWRQ--
A0A2W7AN33      --S-PWQDLIQVGSDH-NN-----LYILTSGSPPPN--PMLLLES-NKMTTLLEEWKQ--
A0A256BLV2      --S-PWQDLIQAGDEQ-DN-----LHILTSGSLPPN--PMLLLES-NKMAALLQEWRQ--
A0A2W6ZXF3      --T-PWQDLIQSGDEK-GN-----LDVLTSGSIPPN--PMLLLES-TKMSALIQEWRQ--
A0A2Z5WX66      --N-PWQDLVQVADET-GN-----LHVLTSGSLPPN--PMLLLES-TKMTALLQEWRQ--
K9W1T3          --S-DFN--DAVVEVM-EN-----LEVLTAGTPPPN--PLILIDS-SQMAVLVGQSAQ--
A0A0D6YBN8      --D-NIQ--DLTFEMRDLG-----FTAMSAGPIPPN--AAELLTG-HRLQMLVARLLE--
A0A318BJ18      --D-DID--SLVFSMSDLG-----FSAMTAGPIPPN--AAELLTG-QRLNILLDRLLE--
A0A1Q4RTR1      --I-DLQ--TAVKNIS-NN-----VYLLTAGATPSN--PFATLAS-PRMNALIATAQQ--
A0A1Z4SQV2      --I-DLQ--TAERKVS-NN-----VYLLTAGVTPSN--PFAILGS-PQMNDLMATAQQ--
A0A2H2XGN1      --I-DLQ--TAERKVS-NN-----VYLLTAGVTPSN--PFAILGS-PQMNDLMATAQQ--
A0A433UXH8      --I-DLQ--TASRKVA-NN-----VYLLTAGTTPSN--PFATLAS-PRMNALIATAQQ--
A0A1Z4RMB9      --S-PLS---VIKRPM-PK-----LSLLTSGIVNSN--PLALLDS-PMMSDFVGRSRR--
D5A466          --A-TLS--EAVKPGI-DQ-----LDILTAGVTPPN--PLALLDS-RRMTSLIRNFSE--
K1XF69          --A-TLS--EAVKPGI-DQ-----LDILTAGVTPPN--PLALLDS-RRMTSLIRNFSE--
B5W297          --A-TLS--EAVKPGI-DQ-----LDILTAGVTPPN--PLALLDS-RRMTSLIRNFSE--
H1W7M8          --A-TLS--EAVKPGI-DQ-----LDILTAGVTPPN--PLALLDS-RRMTSLIRNFSE--
B4WP72          --S-SAQ--DTIQSVM-PR-----LHVLPSGWISSN--PVDLLDA-SSMERLIAELSE--
A0A318B4H2      --N-EIG--DVLQEPRGEG-----FAMIPAGPTPPN--AAELLSS-DRFKDMLATLRQ--
B4WQE3          --A-LLDESFVNLAVD-EN-----LFFMSSGSIAVD--PAKVLAS-KKIEEFFQQIYK--
A0A2K3BR24      --K-EVN--SVVKELM-QN-----LDVLTAGAPPPN--STALLDS-QRMKDVLNQCSL--
K9YXY1          --K-EIN--SVVRELM-PN-----LDVLTAGAPPPN--STALLDS-QRMKDVLNQCSL--
A0A2P8W4F7      --D-DPNDLVLQLPGN-PN-----LHLLTAGARPPA--PGRLLSS-RKMQQLTEQYRR--
U5QJM6          --L-SWQ--EAVQKLG-EN-----LFVLTSGPIPPN--PVSLLDS-RKMAELTKQWRE--
A0A1U7HGH0      --V-GVNK-KAIQPVA-KN-----IDVLTTGTSESD--LGILIDS-RSMSTLITQYAK--
K9XJD3          --I-GVNK-KAIQPVA-KN-----IDVLTTGTSESD--LSILIDS-RSMSALITQYAK--
K9SX01          --T-QLE--TVLESVV-PN-----LDILSSGVLPPD--PLTLIDS-QHMTNLIGDWSR--
A0A1E5QIR9      --V-DPH--EAIAEVM-PH-----LFVLTAGSLPPN--PLALLNS-RRMAALIEDCAQ--
A0A1Z4IBC7      --V-TLE--DAVQEVM-PN-----LEVLPCGILPPN--PVAMLDS-QRMATLMSNFAR--
A0A1W5CPC7      --V-TLD--EAVQEVM-PN-----LEVLPCGILPPN--PVAMLDS-QRMATLMSNFAR--
Q3MDC6          --V-TLD--EAVQEVM-PN-----LEVLPCGILPPN--PVAMLDS-QRMATLMSNFAR--
A0A1Z4KM73      --V-TLD--EAVQEVM-PN-----LEVLPCGILPPN--PVAMLDS-QRMATLMSNFAR--
Q8YNX7          --V-TLD--EAVQEVM-PN-----LEVLPCGILPPN--PVAMLDS-QRMATLMSNFAR--
A0A367R4K6      --V-SLD--EAVQEVM-PN-----LEVLTCGTLPPN--PVAMLDS-QSMTKLISSFGR--
A0A1E2WSV8      --A-SLD--TVVQEVM-PN-----LEVLTSGVLPPN--PVAMLDS-QRMATLISSFGR--
A0A2R5FRT9      --V-SLD--VAIQEVM-PN-----LEVLTSGILPPN--PVAMLDS-QRMATLISNFGI--
A0A2K8T1B6      --A-SLD--TVAQEVM-PN-----LEVLTSGVLPPN--PVAMLDS-QRMATLISNFGR--
A0A235I9I0      --A-PLD--TVVQEVM-PN-----LEVLTSGVLPPN--PVAMLDS-QRMATLISSFGR--
A0A2D0HQT8      --A-SLD--TVVQEVM-PN-----LEVLTSGVLPPN--PVAMLDS-QRMATLISNFGK--
A0A2L2NU95      --A-SLD--TVVQEVM-PN-----LEVLTSGVLPPN--PVAMLDS-QRMATLISNFGR--
A0A367S084      --A-SLD--TVVQQVM-PN-----LEVLTSGVLPPN--PVAMLDS-QRMAALISNFGR--
A0A0V7ZFJ4      --S-KLQ--DTLQKAL-PA-----LDVLLVGKIPPN--PLKLLES-QRMSSLIEEAKG--
A0A0V7ZNJ9      --A-ELQ--NSIQKPL-AT-----LDLLPAGKIPPN--PGALVDS-QSMVSLLEEAKK--
A0A367RIS1      --A-TLA--GAAKEVV-SN-----LELLTAGTIPPN--PVALLDS-QRMNGLLKHAAQ--
A0A235IXQ2      --T-SLA--EAAKEVV-IN-----LELLTSGTIPPN--PAALLDS-QRMNGLLKQAAQ--
A0A1W5CNX3      --A-TLA--EAAKEVV-IN-----LELLTSGTIPPN--PAALLDS-QRMNGLLQQAAE--
Q3MEB7          --A-TLA--EAAKEVV-IN-----LELLTSGTIPPN--PAALLDS-QRMNGLLQQAAE--
A0A1Z4KHN9      --A-TLA--EAAKEVV-IN-----LELLTSGTIPPN--PAALLDS-QRMNALLQQAAK--
Q8YT70          --A-TLA--EAAKEVV-IN-----LELLTSGTIPPN--PAALLDS-QRMNALLQQAAK--
A0A218Q4C1      --A-TLA--QSCHEAL-VN-----LHLLTAGTIPPN--PAALLDS-ERMHELLQEASQ--
A0A166IWU6      --T-DLT--QISQEAL-VN-----LDLLTAGTIPPN--PAALLDS-QRMHELVQQASQ--
A0A2S0Q8C0      --T-NLT--QSSQEAL-VN-----LDLLTAGTIPPN--PAALLDS-QRMHELVQQASQ--
W6FSX4          --T-NLT--QSSQEAL-VN-----LDLLTAGTIPPN--PAALLDS-QRMHELVQQASQ--
A0A1B7WTD1      --N-EVK--PAIHKVF-LN-----VDMLPAGKIPPN--PVTLLDS-QRMADLIEKARQ--
A0A1B7WX82      --A-QLK--NTVQEVS-PL-----VDLLPVGKIPPN--PVTLLDS-QRMADLVEEASN--
A0A0R0M9H9      --T-QLE--NCLQD-V-SS-----VNVLTAGKVPPN--PVKLLDS-QSMASLIAAARQ--
A0A1S1ZVW2      --T-QLE--NCLQD-V-SS-----VNVLTAGKVPPN--PVKLLDS-QSMASFITAARQ--
A0A1Z4LRU5      --A-ALN--GSTEEAL-VT-----LDVLTSGKIPPN--PLALLES-QSMANLVKDASQ--
A0A1Z4JVB4      --A-DLQ--STSKEVL-IN-----LDLLTSGIIPPN--PVALLNS-PRIAALLHQASN--
K9PIA4          --A-ELQ--SSTKEAL-MA-----MDLLTAGTIPPN--PAALLDS-QRLATLIKQATG--
A0A1Z4M597      --T-ELQ--TTSKEAL-MT-----LDIITAGTIPPN--PAALLNS-QRIATFIKEATQ--
A0A1Z4MWT1      --T-ELQ--TTTKEAL-MT-----LDIITAGTIPPN--PAALLNS-QRIATFIKQATQ--
A0A1Z4TX53      --T-ELQ--TTTKEAL-MT-----LDIITAGTIPPN--PAALLNS-QRIATFIKQATQ--
A0A1Z4HVE1      --A-ELQ--TTTKEAL-MT-----LDLITAGTIPPN--AAALLES-KRMAALIQEATS--
A0A252ECZ1      --A-ELP--TTTKEAL-MT-----LDFVSSGTIPPN--PAGLLES-KRMAALIQEATN--
A0A1Z4G5Y1      --A-ELA--TTTKEAL-MT-----LDLVTAGTIPPN--AAALLES-KRMVSLIQEATS--
A0A252DNA2      --A-ELP--TTTKEAL-MT-----LDLVTAGTIPPN--AAALLES-KRMAALIQEATS--
A0A252E1Q4      --A-ELP--TTTKEAL-MT-----LDLVTAGTIPPN--AAALLES-KRMAALIQEATS--
A0A2A2TNQ5      --G-EWV--NLTKEVV-YG-----LDVLTAGTIPPN--PLAIVDS-QSMATLIRETGK--
A0A3S1C4K5      --A-EYV--AIAQEAI-HN-----LDILTAGTIPPN--PAALLDS-QRMRALLEEASK--
A0A1X4G3D5      --T-QLG--ASIQEVS-S------ISVLTAGNTPPN--ALQLLDS-ESMVNFVQKVRN--
D4TNI2          --T-QLG--ASIQEVS-S------ISVLTAGNTPPN--ALQLLDS-ESMVNFVQKVRN--
A0A1Z4H6Z8      --A-ELP--TTTKEAL-MT-----LDLVTAGTIPPN--AAALLES-KRMAALIQEATN--
A0A1Z4NPM1      --A-VLS--QVTHEAL-VT-----LDLVTTGTTPPN--PVTLLES-KRMDNLIKDVSS--
A0A3F3KPR9      --T-QLE--NCLQDVS-S------VHVLTAGKVPPN--PVKLLDS-QSMASLIAAARR--
D4TGN7          --T-QLE--NCLQDVS-S------VHVLTAGKVPPN--PVKLLDS-QSMASLIAAARR--
A0A1Z4UZW9      --V-QLK--NAVQEVS-PQ-----VHILPAGRTPPS--PVTLLDS-QRMADLIEEARR--
A0A0K2M5H0      --A-QLE--NAVQEVS-PL-----VNMLPAGKIPPN--PVALLDS-QRMAALVEEASK--
A0A1B7VSH4      --T-QLK--NAVQEVS-PL-----VKMLPAGKIPPN--PVTLLDS-QCMADLVEEASK--
A0A1B7W126      --T-QLK--NAVQEVS-PL-----VKMLPAGKIPPN--PVALLDS-QCMADLVEEASK--
A0A3D4C6Q6      --T-QLK--NAVQEVS-PL-----VKMLPAGKIPPN--PVALLDS-QCMADLVEEASK--
K7W0A4          --M-QLK--NAVQEVS-PQ-----VNMLPAGKIPPN--PVALLDS-QRMADLIAEARN--
A0A1B7UTR1      --A-QLK--NTVQEVS-PL-----VDLLPVGKIPPN--PVTLLDS-QRMADLVEEASN--
A0A1B7UVJ4      --A-QLK--NTVQEVS-PL-----VDLLPVGKIPPN--PVTLLDS-QRMADLVEEASN--
A0A2T1CIL7      --T-EWQ--EAVQRVM-PN-----LDVLTAGVIPDN--PLPLLRL-QRMKTLINSLSN--
A0A1Z4RPC6      --T-PLD--QVVSQPM-KQ-----LDLLTAGTIAPN--PLALLDS-VEMSELVATARK--
A0A2T1CMZ0      --T-PLA--QVVTQPI-MQ-----LNVLTSGTIAPN--PLALLDS-PEMSQLVAAARK--
L8M4F7          --A-ELA--DAVTQPM-LN-----LKLLASGEVVSN--PLAILDS-SAMNELIAESRK--
L8LZE9          --I-ALN--QITQQPM-PN-----MDLLTSGEIISN--PLSLLDS-LEMSELVAKARR--
A0A140K2P2      --K-PLS--LAVSKPL-EK-----LDLLTAGELQSN--PLALLDS-EAMSELITQSRK--
K9XWX4          --K-PLS--LAVSRPL-EQ-----LDLLTAGEVQSN--PLALLDS-EAMSELINQSRH--
A0A140KB14      --T-SLQ--EVVARPL-DR-----LDLLTVGVVPPN--PLALLDS-KAMNELIVQAKQ--
K9XX88          --T-SLH--EVVARPI-ER-----LDLLTVGVVPPN--PLALLDS-IEMNELIAQAKK--
A0A433V7A0      --D-NPR--VAVKEVM-SN-----LDVLCSGVIPPN--PLALLDS-DRMASLISDFSN--
A0A0C2LBE2      --D-TLN--VALQEAM-PN-----LDVIPSGVVPPN--PVALLDS-KCMAALVSSFTE--
A0A433NN38      --I-PLN--TVVQEVM-PN-----LYVLPSGVIPPN--PLALLDS-QRMTALVTIFAR--
A0A2N6K0T2      --V-PLE--TTVHEVM-PN-----LHVLTSGVIPPN--PVALLDS-ERMATLVDSFIQ--
A0A2N6ML72      --V-PLE--TIVHEVM-PN-----LHVLTSGVMPPN--PVALLDS-DRMATLVASFTQ--
G6FQZ6          --V-PLE--TIVHEVM-PN-----LHVLTSGVIPPN--PVALLDS-DRMATLVASFTQ--
A0A2N6MQX9      --V-PLE--TIVHEVM-PN-----LHVLTSGVMPPN--PVALLDS-DRMATLVASFTQ--
A0A2N6KXT6      --V-PLE--TIVHEVM-PN-----LHVLTSGVIPPN--PVALLDS-DRMATLVASFTQ--
A0A2N6KGB9      --V-PLE--TIVHEVM-PN-----LHVLTSGVMPPN--PVALLDS-DRMATLVASFTQ--
A0A2N6L3Y5      --V-PLE--TIVHEVM-PN-----LHVLTSGVMPPN--PVALLDS-DRMATLVASFTQ--
A0A0S3TIS7      --V-PLE--TIVHEVM-PN-----LHVLTSGVMPPN--PVALLDS-DRMATLVASFNQ--
A0A1U7GW28      --V-PLE--TIVHEVM-PN-----LHVLTSGVMPPN--PVALLDS-DRMATLVASFNQ--
A0A2N6LW63      --V-PLE--TIVHEVM-PN-----LHVLTSGVMPPN--PVALLDS-DRMATLVASFTQ--
A0A1Z4TQ63      --V-PLE--SVVHEVM-PN-----LHVLTSGVIPPN--PVALLDS-DRMATLVANFTK--
A0A0D6YFE2      --V-ALE--TVVHEVM-PN-----LHVLTSGVIPPN--PVALLDS-DRMATLVANFTE--
A0A328IH74      --V-ALE--TVVHEVM-PN-----LHVLTSGVIPPN--PVALLDS-ERMAALVANFTQ--
A0A1Z4NDS1      --V-NLS--LAVEEVI-PN-----LHLLPAGVVPPN--PVALLDS-QRMAALVASFAQ--
K9F4D9          --V-PLK--DVIVSQE-PN-----LHILTAGVIPFN--PLAVLES-QLITSLLQASEK--
U9VXM0          --V-SLK--DVIISQE-PN-----LHILPAGVIPSN--PLAVLES-NLITSLLEASEK--
A0A2T1FTR8      --C-DRK--TATTEIQ-PN-----LFLVTAGVVPPN--PVVLIDS-VQMSTSIAQWSQ--
K9UA41          --C-DRK--TATTEIQ-PN-----LFLVTAGVVPPN--PVVLLDS-VQMSTSIAQWSQ--
A0A1Z4SMD6      --E-EFS--SAVQSIT-TN-----LSVLTAGVQPPN--PLALIDS-QRMASLIDIFSQ--
A0A2H2Y096      --E-EFS--SAVQSIT-TN-----LSVLTAGVQPPN--PLALIDS-QRMASLIDIFSQ--
K9S8M8          --T-DLS--EAVNPVM-DN-----LDVLTCGAIPPN--PLALLDS-QRMQSLVQEFGQ--
A0A1Z4NFV0      --D-DMS--KAVQTVT-GN-----LSVLTAGVIPPN--PLALLDS-EAMVAIVKTLSQ--
B0CAX4          --K-DWH--EAIRPED-DQ-----LDILTAGVTPPN--PVPLIDS-HHMAVLLEEFHQ--
U5DPF5          SVA-EIA--HAEGQDG-NK-----LDVLTAGVIPPN--PVALLDS-QRMTTLLDEAKH--
A0A350Y0P6      --T-QFE--FAVREVM-DN-----LDVLPSGVIPPN--SLALLNS-KRMASLVEYFSQ--
A0A352X940      --A-EFK--DAVREVT-DN-----LDVLPSGAIPPN--SLALLNS-KRMAFLVDDFAK--
B8HTN4          --H-SST--KFIHQES-DN-----LDVLTAGPRAPN--PLLLLDS-QHMASLIDKFRT--
A0A2A2TPF8      --E-QIR--RCIQSVT-RN-----LSVLTAGVIPPN--PIALLDS-QSMNALIQALSA--
A0A1Z4R0P8      --N-QIR--RCIQSVT-RN-----LSVLTAGVIPPN--PLVLIGS-ESMNALIHSLSE--
A0A0T7BUI3      --N-DFP--QAVQRIT-SN-----LFVLTAGVQPPN--PLGLIDS-EGMTELIRNFAQ--
A0A1Z4LP32      --D-EFS--RCYHQVN-KY-----LSVLSAGVQPPN--PSALIDS-AAMDSLIQSLLP--
K9REP9          --D-ELY--RCHHQVT-EN-----LSVLTAGVQPPN--PSALIDS-AGMDSLIQQLLP--
A0A1Z4SIJ3      --S-DFL--LSKKVVN-EH-----LSILTAGVRPPN--PLALIES-DRMASLISTFAQ--
A0A2H2XPG4      --S-DFL--LSKKVVN-EH-----LSILTAGVRPPN--PLALIES-DRMASLISTFAQ--
K9V3C7          --V-KLN--RVVQKVS-TN-----LSLLTAGVIPPN--PVALIDS-ESMMNLIQTMAG--
A0A1Z4T6Y7      --D-RIR--SCIQSVT-RN-----LSVLTAGVIPPN--PQALLDS-ESMSALIQALSQ--
A0A2H2Y561      --D-RIR--SCIQSVT-RN-----LSVLTAGVIPPN--PQALLDS-ESMSALIQALSQ--
A0A1Q4S362      --D-RIR--NCIQTVT-RN-----LSVLTAGVIPPN--PQALLDS-EGMSALIQALSQ--
A0A3S1CIN8      --D-RIR--NCIQTVT-RN-----LSVLTAGVIPPN--PQALLDS-EGMSALIQALSQ--
A0A2A2TC28      --D-EFS--LAVKTVT-NH-----LSILTAGVQPPN--PSALIDS-EGMLSLIEKISE--
A0A0C1NCB0      --D-EFS--QAVQEVT-SH-----LSVLTAGVQPPN--PLALIDS-ERMTSLIQMFSE--
A0A2N6K7Q9      --G-VLS--QAVQKVT-EF-----LAVLTAGVIPPN--PLALIDS-EGMTSLVDIFAE--
A0A2N6MXH6      --G-VFS--QAVQKVT-EF-----LAVLTAGVIPPN--PLALIDS-EGMTSLVDIFAE--
A0A2N6M5A8      --G-VFS--QAVQKVT-EF-----LSVLTAGVIPPN--PLALIDS-EGMTSLVDIFAE--
A0A2N6LL61      --G-VFS--QAVQKVT-EF-----LAVLTAGVIPPN--PLALIDS-EGMTSLVDIFAE--
A0A0S3TP66      --G-VFS--QAVQKVT-EC-----MAVLTAGVIPPN--PLALIDS-EGMTSLVDIFAE--
G6FP91          --G-VFP--QAVQKVT-EF-----LAVLTAGVIPPN--PLALIDS-EGMTSLVDIFAE--
A0A1U7GYR5      --G-VFS--QAVQKVT-EF-----LAVLTAGVIPPN--PLALIDS-EGMTSLVDIFAE--
A0A2N6KY52      --G-VFS--QAVQKVT-EF-----LAVLTAGVIPPN--PLALIDS-EGMTSLVDIFAE--
A0A2N6KMP5      --G-VFS--QAVQKVT-EF-----LAVLTAGVIPPN--PLALIDS-EGMTSLVDIFAE--
A0A2N6MA45      --G-VFS--QAVQKVT-EF-----LAVLTAGVIPPN--PLALIDS-EGMTSLVDIFAE--
A0A1Z4TLC8      --G-VFS--QAVHKVT-EY-----LSVLTAGVIPPN--PLALIDS-EGMTSLVDIFAE--
A0A0M0SFT2      --A-VFS--EAVHKVT-EF-----LSVLTAGVIPPN--PLALIDS-ESMTSLVDIFAE--
A0A0D6Y7R4      --A-VFS--EAVHKVT-EF-----LSVLTAGVIPPN--PLALIDS-EGMTSLVDVFAE--
A0A328IGA1      --A-VFS--EAVHKVT-EF-----LSVLTAGVIPPN--PLALIDS-EGMTSLVDVFAE--
A0A0C2LFH0      --D-QLP--QTVQTVT-KE-----LSILTAGVQPPN--PLGLIDS-DRMATLIETFCD--
A0A1Z4IYV4      --A-EFP--QGVQTVT-KH-----LSVLTAGVVPPN--PLALIDS-DRMATLIKMFSD--
A0A1Z4Q0T6      --A-EFP--QGVQTVT-QH-----LSVLTAGVVPPN--PLALIDS-DRMASLIKIFSD--
A0A0C2PT44      --A-EFP--QGVQTVT-KD-----LSVLTAGVVPPN--PLALIDS-DRMASLIKMFSD--
A0A1D2P6J4      --A-EFP--QGVKTVT-KH-----LSVLTAGVVPPN--PLALIDS-DRMATLIKMFSE--
A0A3M9ZEU1      --Q-ELS--TAIQPAM-PG-----LDVLPAGVVPPN--PVALLDS-KRMAGLITTFAH--
A0A1Z4JK72      --S-ELR--QAVKPIT-NN-----LSILTAGVMPPN--PLAILDS-EAMTTLLETIAK--
A0A0N7Z489      --S-ELR--QAVKPIT-SN-----LSVLTAGVMPPN--PLSILDS-EAMTAFLETVSR--
A0A0S3TXS2      --S-ELR--QAVKPIT-SN-----LSVLTAGVMPPN--PLSILDS-EAMTVFLETVSK--
A0A1Z4RN12      --V-QWA--DVVHKVM-PN-----LDVLTSGIVPEH--PISLLDS-EVMKDFVNNVSQ--
A0A2T1CMF9      --V-SWS--ETVQNVM-PN-----LDVLTSGSMPNN--PIALIDS-PSFLNFIAEVAL--
Q7NDC5          --A-DWQT-AVRPTPQ-PG-----LVVLTAGPPPPN--PVVLLES-RRLGELLGLWSE--
U5QGK3          --G-NWRDLLVQPPGL-ER-----LSLLTAGPMPPN--PLALLES-RQLPELLAQWRA--
A0A2W4UY24      --L-PLK--QAIVRQE-PN-----LHLLPAGSIPPN--PLAIIES-KRMASMLEVFKQ--
A0A254WLE3      --I-DYQ--SAIKEVL-PK-----LHILTAGATPPN--PVALLDS-VQMTSLIDNFAK--
A0A433W533      --V-DYQ--SAIKEVL-PK-----LHILTAGATPPN--PVALLDS-VQITSLIDNFAK--
A0A2P8QWJ3      --V-DYQ--SAIKEVL-PK-----LHILTAGATPPN--PVALLDS-VQITSLIDNFAK--
A0A2T1FKP8      --V-DYQ--SAIKEVL-PK-----LHILTAGATPPN--PVALLDS-VQITSLIDNFAK--
K9U6L7          --V-DYQ--SAIKEVL-PK-----LHILTAGATPPN--PVALLDS-VQITSLIDNFAK--
A0A2T1GMT4      --S-KFQ--QISWTVM-EN-----LDVLTAGGKPSN--PLSVLES-KHMKSLIQEVSKF-
K9UI51          --S-KLQ--QISWTVM-EN-----LDVLTAGARPSN--PLSALES-KQMKLLIQEVSKS-
K9TYI2          --A-QLS--VATSKVM-NN-----LDVLTAGVTPPN--PLALLDS-QQMAALVEGFSSR-
A0A254W5G5      --A-QLS--VATAKVM-NN-----LDVLTAGVTPPN--PLALLDS-QQMAALIEGFSSR-
A0A2T1FXY4      --A-QLS--IATSKVI-NN-----LDVLTAGVTPPN--PLALLDS-QQMAALVEGFSSR-
A0A1Z4QL41      --A-ELN--VALCKVM-DN-----LDVLTAGVRPLN--PLALLDS-KKMASLIEDCSHQ-
A0A252D4T4      --A-EFK--TAACNVI-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIQDFSSQ-
A0A252DJH5      --A-EFK--TAACNVI-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIQDFSSQ-
A0A252EB80      --A-EFK--TAACNVI-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIQDFSSQ-
A0A1Z4HPW5      --A-DFK--TAASNVI-EN-----LDVLTAGVRPPN--PLALLDS-KRMATLIQEFSNQ-
A0A1Z4MSN1      --A-EFK--TAASNVI-EN-----LDVLTAGVRPPN--PLALLDS-KRMATLIQEFSNQ-
A0A1Z4U1C2      --A-EFK--TAASNVI-EN-----LDVLTAGVRPPN--PLALLDS-KRMATLIQEFSNQ-
A0A0D6KV51      --A-EFK--TAASNVI-EN-----LDVLTAGVRPPN--PLALLDS-KRMATLIQEFSNQ-
A0A1Z4MKF8      --A-EFK--TAASNVI-EN-----LDVLTAGVRPPN--PLALLDS-KRMATLIQEFSNQ-
A0A2C6WC43      --A-EFN--TAVSKVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIDNFSSQS
A0A1Z4L5A1      --A-EFN--IAVSKVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIDNVSSQS
A0A367QD86      --A-EFN--TAVSKVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIDNVSSQS
A0A235IZ96      --V-EFN--MAISKVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIENSSSQH
A0A2L2NGP0      --V-EFN--MAISKVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIENSSSQH
A0A2K8SM78      --A-EFD--VTVSKVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIENFSSQH
A0A2R5FPC0      --A-EFD--VTVSRVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIENFSSQH
K9QM62          --S-QFN--ETVSQVT-HY-----LDVLTAGVRPPN--PLALLDS-KRMALLIQDFSDQ-
A0A1Z4FWI3      --A-EFK--TVACNVI-EN-----LDVLTAGVRPPN--PLALLDS-KRMASLIQDFSSQ-
A0A1Z4JYE7      --L-DVR--FAVKKVM-DN-----LDILTAGVRPPN--SLALLDS-KRMASLIKELSSQ-
A0A140KBA0      --A-EWQ--EAIKTIK-PG-----LDILTAGDLPDN--PVPLIDS-ERMKYLIETAAL--
K9XSG1          --V-EWQ--EAIKTIK-PG-----LDILTAGEPPDN--AVPLIDS-ERMKHLIGTTAL--
A0A0F5YE28      --A-ELS--SVIRQGI-ER-----LDIIPSGVTPPN--PLALLDS-KRMTSLIRNFSE--
U7QEH7          --A-ELQ--SGICQGI-ER-----LDIIPSGVTPPN--PLALLDS-KRMTSLIRNFSE--
A0A3S1ATK5      --V-EYS--NSIFRVM-DN-----LDVLPAGVRPPN--PLALLDS-KRMAALIEEFSS--
A0A2Z6CPH0      --S-EVD--TAVNQVM-DN-----LNVLTAGVRPPN--PLALLDS-KRMAALIKDFSS--
A0A1Z4GT50      --A-EFK--QAACKVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIEKFSN--
A0A1Z4GIX0      --A-EFP--TAVSQVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIDNFST--
A0A2H6LC24      --A-EFP--SAVYQVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIDNFSA--
B2J6N5          --T-EFD--VALSKVM-DN-----LDVLTAGSRPPN--PLALLDS-KRMASLIESFSSQY
A0A367RMI4      --A-EFD--IAVSKVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIESFSSHY
A0A235HUM0      --A-EFE--IAVSQVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIENFSSQY
A0A2L2NW47      --A-EFE--IAVSKVM-DN-----LDVLTAGVRPPN--PLALLDS-KRMASLIENFSSQY
A0A1E2WUR1      --A-EFD--IAVSKVM-DS-----LDVLTAGVRPPN--PLALLDS-KRMASLIENFSSQD
A0A235IKU3      --V-EFN--MAISKVM-DN-----LDVLTAGVRPAN--PLALLDS-KRMASLIENSSSQH
F4XKF3          --V-PLE--LAICKAM-EN-----LDVLTAGVMPPN--PLALLDS-KQMASLIQECST--
A0A1D9FX10      --V-PLE--LAICKAM-EN-----LDVLTAGVMPPN--PLALLDS-KQMASLIQECST--
A0A1D8TNX9      --V-PLE--LVICQAM-EN-----LDLLTAGVMPPN--PLALLDS-KQMASLIQEFST--
A0A1U7MYU6      --V-PLE--LAICQAM-EN-----LDVLTAGVMPPN--PLALLDS-KQMASLIEECST--
A0A3C0NJ41      --A-EFK--AVVTEVM-DN-----LDVLSCGVIPPN--PLALLDS-KRMASLIESFSQ--
A0A352AG88      --A-DFA--ATVRTGM-DS-----LDVLTAGVIPPN--PLALLDS-KRMASLIDDFSK--
A0A350Y374      --A-EFE--TAVNKVM-DN-----LDVLTAGVIPPN--PLALLDS-KRMASLIEYFSE--
A0A355DPX0      --A-EFE--TAVNKVM-DN-----LDVLTAGVIPPN--PLALLDS-KRMASLIEYFSE--
A0A0D8ZUV2      --S-EFK--TSVRTAI-KN-----LDVLTAGVMPPN--PIALLNS-QRMATLIDDFSA--
A0A433VDI0      --A-EFK--ASVTQVM-PN-----LEVLTSGVIPPN--PLALLDS-KRMASLIESFSA--
A0A3D1PG43      --T-EFQ--TTVQQVM-TN-----LDVLTAGVMPPN--PMALLDS-QRMASLVNYFTQ--
A0A2P8QQ72      --T-DFQ--AAVEQVM-PN-----LHVLTAGVVPPN--PMALIDS-QRMAALVSSLSD--
K9TZQ7          --T-DFQ--AAVEQVM-PN-----LHVLTAGVVPPN--PMALIDS-QRMAALVSSLSD--
A0A2G7GPR0      --A-EFE--SVVTEVI-PK-----LDVLSAGVIPPN--PMALLDS-KRMASLVQYFTN--
K9XH68          --A-EFE--SVVTEVI-PK-----LDVLSAGVIPPN--PMALLDS-KRMASLVQYFSD--
A0A1U7HW70      --A-EFE--SVVTEVI-PK-----LDVLSAGVIPPN--PMALLDS-KRMASLVQYFSD--
A0A2S6VEJ8      --A-EFE--SVVTEVI-PK-----LDVLSAGVIPPN--PMALLDS-KRMASLVQYFSD--
                                           :              .                 

K9SLA9          NYDLVLLDTPPVTVAADTTVLGKKTDGVVLLVRPGLTEIDSFAAAKDTL--TRSRQHVLG
A0A168TT23      AFDHVIIDSAPILGLADALVLSRCVDGVILVTSAGKTSKESIRTSTRRL--VQVQAPLLG
A0A0M1JWX9      EFDLVILDTPPLKNVVDGRVLAGYTDGVVLVVSMRQTNRNTILQTLAEL--KTCGIKVLG
A0A2T1M1V6      NYDFILIDSPPVNLTSETSLMSRLIQNVMFLVRPGSSDRYSVFDSLEQL--KQQDAEIKG
A0A2G7GCS2      GYDYVLVDSPPIGLASETNLMSSVVRNVLFVVRSGKSDRYAVMDGFEQL--VQHHAQVMG
K9XBH8          GYDFVLVDSPPVGLASETNLMSSVIQNVLFVVRAGKSDRFSVMDSFEQL--VRHNAQIMG
A0A1Z4LJ30      NYDYVLVDSSPVTLTPEAALLAKVIINVLFVVRSTTSHRNYFCDSIEQL--TRHKAEIAG
K9RI76          NYDYVLVDSSPVALTPEAALLARIISKVVFVVRSTSSHRNYFYDSVEQL--TRHQAEICG
A0A352AE27      EYDYILVDSAPVSLTSETVLMAAITRNVLFVVRPGISKRNFVNDSLAQL--TQHNAELFG
A0A3B8JH60      DYDYILIDSAPVTFTSETALMASIVPNVLFVVRPGTSYSNSVNDSLEQL--AQHQAEILG
A0A3C0N766      DYDYILIDSAPVTFTSETALMASIVPNVLFVVRPGTSYSNSVNDSLEQL--AQHQAEILG
K9W9J7          KYDYVLIDSAPVSLTSETALMANVVPNVLFVVRPGTSYSNSVNESLDQL--AQHQAQVLG
A0A139WSU3      NYDYVIVDSAPVSLTSETALMATLISNVLFVVRPDSSYKNSVNESFAQL--SQHNVEILG
A0A433VN22      KYDYIIVDSAPVSFTSETPLIANIIRNVLFVVRPDTSYRDSVNESFAQL--TQHNAQILG
Q7NF11          GYDYVLVDSPPISLTSEAALMIPAVRNVLFVVRPGVSGRDAVSESLDRL--VRHNARLVG
A0A1Z4JCS8      DYDYVLVDSAPVSSTSETALMAAIVPYVLFVVRPGISARNVVNNSLEQL--TQHHAKLLG
F4XTX2          DYDYVLIDSAPVSMTSETALMAAVIGNLLFVVRPEISKRDFVSDSLEQL--AQHNAQLLG
Q7NJN6          GYDYVLIDTAPEDLVAETKLIAAAIGNVLFVVRPGVSNRDEVNASLAAL--QRFGSS-VH
U5QCC3          GHDYILIDTAPEQLVAETKLIAAEIRNVLFVVRPGTSDRDMVNSSLETL--KRCGAN-IN
A0A0S3TYD7      RYDYVIFDTPPLSGIADATILGKRADGLVLVSRLGVINFDTAKNAKEYI--RQAEQKVLG
U5QL42          NFDYVIVDTPPVVGLPDAQSIVSRVDRVVLIVAIERSTRSVIARVLEIL--RSSQCELAG
K9QF04          SYDLVIVDTPPLHGFADAKFLASQTNGLIMVIGLDKTEKTAAKQVLNDL--QISHIPLLG
A0A3C0N2P0      AYDLVIFDTPPLMGLADAKLLATHTDGIVMVVGLGKTDRSVFKEVLYGL--RTSHAHVLG
K9TLQ0          SFDLVIFDTPPLGAISDAKFLAPHTDGLVMVIGMGKSDRAILREVFDGL--KMSRTPVLG
A0A076HBF2      QFDLVLFDTPPVLGLADAALVAEHCDGLMLLVSLDRVDRSLPKESVSRI--RSSGAPLLG
A0A354B169      DYDLVLFDTPPLLGLTDAVLVAENCDGLVLLVSLDLVDRALPKQAIEII--HNSGCPLLG
G4FMX5          EFDLILFDTPPVLGLADAALVAEHCDGLMLLVSLDRVDRSLPKEAINRI--RSSGAPLLG
Q0IDT5          DFDLVLFDTPPVLGLADASLVAEHCDGLMLLVSLNRVDRGLPQEAVNRI--VSSGVPLLG
A0A2D6FCW3      EFDLILFDTAPVLGLADAALVAEHCDGLVLMVSLDRVDRSLPKEAVARI--LSSGAPLLG
A3ZA21          EFDLVVFDTPPVLGLADAALVAEHCDGLMLLVSLDRVDRGLPKESVARI--RSSGAPLLG
A0A140K3H3      AYDYVLVDTPPIGVVADAKSLANQVDSVLFVVGIEKATRRAINNSLEIL--RNSQCNIAG
K9XUB8          AYDYVLIDTPPIGVMADAKSLANQVDSVLFVVGMERATRRAINNSLEVL--RSSQCNISG
Q7NEU3          RYDLVIIDSPPMIGLADATILTKCADGLVFVIGLEVARRGGVLSALERL--RSASLVPVG
A0A352XE00      KFDLVIFDMPPLLGLADARLLAAYTDGILMVVGLGKTDREVLKQVLYSL--RMSHAKVLG
B4VS56          MFDLVIFDTPPMLGLADARLLAAHTDGIVMVVGLGRTDRTVLMQVLSGL--KTSHARVLG
A0A352AAQ3      SFDLVIFDTPPLLGLADARVLAAHTDGIVMIVGLGRTDREVLKQVLYGL--KTSNARVLG
A0A350Y472      AFDLVIFDTPPLLGLADARLLAAHTDGIIMVVGLGKTDRAVLTHVLYGL--KTSHAKVLG
A0A355DVB4      AFDLVIFDTPPLLGLADARLLAAHTDGIIMVVGLGKTDRAVLTHVLYGL--KTSHAKVLG
A0A2P8VVX1      RYDLILVDTTPLIGMADALKVGAVCDSTVLVTRLDRITQSQLTEAMSLL--THLN--VMG
A0A2P8WHY0      IYDVVLVDTPPLTGMADALKIGAVCDNVLLVARLDKITQPQIDVTMALL--SQLQ--VLG
A0A2T1CMT9      NYDLILVDTPPAIGMVDAIKIASICDTSLIVSRLNKSKVSKFLEVTALF--GKLN--VLG
A0A1D8TX52      TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRLERVTQSQLTQATAIL--RNLN--LIG
A0A1U7N5X9      TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRLERVTQSQLTQATAIL--RNLN--LIG
A0A1D9G4T2      TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRLERVTQSQLSQATAIL--RNLN--LMG
F4XP71          TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRLERVTQSQLSQATAIL--RNLN--LMG
A0A2P8QVH5      SYDLVLVDAPPILGLADASIVASLCSGTVVVERLNRVTRFDLNQSLEAL--SKLN--VIG
A0A2T1FT70      SYDLVLVDAPPILGLADASIVASLCSGTVVVERLNRVTRFDLNQSLEAL--SKLN--VIG
A0A433W4W4      SYDLVLVDAPPILGLADASIVASLCSGTVVVERLNRVTRFDLNQSLEAL--SKLN--VIG
K9U5W1          SYDLVLVDAPPILGLADASIVASLCSGTVVVERLNRVTRFDLNQSLEAL--SKLN--VIG
A0A254WLA7      SYDLVLVDAPPVLGLADASIVASLCSGTVVVERLNRVTRFDLNQSLEAL--SKLN--VIG
A0A2W6ZAV2      GYDVVLFDTPPSLALSDALLLSEHLDGTVFLVSLQQVDRDLPAQALRRI--RSFGVDILG
A0A2G7GMH8      EYDLVLLDTPPVLGRVDAIQTASFCSGAILVARIDRVTRTEITQVTEML--SRTN--VFG
K9W742          SYDLVLVDAPPVLGLVDSILTASYCGGVLLVARMGQITKTELTQATAML--SKLN--LIG
K9SA61          TYDLVVLDAPPVLGMVDAMLAGSFCQGVMLVGRIGQVTRTELGQAAHTL--HQLN--VIG
A0A350Y7Z1      NYDLILVDTPPILGMVDALQAASFCNGVVIVGRISRVTQSELTEAIAML--SHLN--AIG
A0A352X2A7      TYSLILLDSPPILGMVDAMEVASFASGVIMVGRMNRVSQSQLTEAIAML--SKLN--AIG
K9XPB0          NYDLILIDTPPVLGMVDAIKISGYCGGTMIVSRLNQVKATELIEATNLL--CNSNSKVLG
A0A0D8ZYV0      TYDLVLVDAPPVLGMVDAILSASFCSGVVLVSRMGKVTRTELTQATAML--SKLN--MIG
A0A3D1PBA3      NYDLILLDAPPVLGMVDAMIAASLCTGVVLVSRVGQVTKTELTQARAML--NKLN--VIG
A0A254WJ87      NYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRVGMVKKTELVQANAML--RKLN--VIG
A0A2T1FP73      NYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRVGMVKKTELVQANAML--RKLN--VIG
A0A433VMS2      NYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRVGMVKKTELVQANAML--RKLN--VIG
K9TYA7          NYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRVGMVKKTELVQANAML--RKLN--VIG
A0A2P8QUE1      NYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRVGMVKKTELVQANAML--RKLN--VIG
A0A2T1DWE8      AYDLIIIDAPPVLGIVDALLTASFCSSMVLVGRIGHVTRAELTQATALL--SKLN--VIG
A0A1U7I8L3      SYDLVLLDAPPVLGIVDAILAASFCSGAVLVGRIGRVTRTELTQATNML--HKLN--VIG
A0A2T1DJL8      SYDLVIVDVPPVLGIVDAMLAASFCDGTLLVGKVGQVTRNEVTQAVTAM--NRLN--LVG
A0A1Z4J9W0      HYDLVILDAPPVLGIVDALLASSCSDGVLLVGRMGHVQKSEIAQAVGML--NRLN--LVG
A0A0N7Z5K9      HYDLVILDCPPVLGIVDALLAASFCDGTLLVGRMGHVDKNEVSQAVGML--SRLN--LVG
A0A0S3TXC5      HYDLVILDAPPVLGIVDALLAASFCDGALLVGRMGHVDRNQVSQAVGML--SRLN--LVG
A0A2T1DNG3      TYDLVIVDAPPALGMVDAVLTASCCSGVLLVGRINQVTRPKLTQSIEML----NQLNLIG
A0A2P8W9H0      EFDFIIFDTPPLLGFADTPMIAEKTQGMLLAVHLGEVKYSQLQAALDEL--QIAQTSVIG
A0A3S0Y9N9      KYDFVIIDSPPFTVAADATILGKLANGILLVVRPGVVDADSASLAKELL--EKAGQNVLG
A0A433UNK7      KYDFVIIDTSPLTVAADATILGKLVNGILFVVRPGVADSHSVSLSKEML--EKADQNVLG
B8HNB0          HYDYILVDTPPVLGVPDIQSIGCRFDGVVMLVAMNGPTTAALTRAVEIL--RGSRSNLLG
A0A1Z4LN32      NYDYIVFDTPPLTGNAESAVLSQMVDGALVIVRPKLVNSATATAAKSLL--ERSETNVLG
A0A2I8A9F5      KYDYIVFDTPPLLGNADAAVLSKLADGVLVVSRIGIVDVTSVNAAKSLL--SRSEVNVLG
A0A218Q6R8      QYDYIIFDTPPLIGTVDAAVLGKMVDGVLVVVRPGVVDSTSVTGAKTLL--SRSEANILG
A0A0C1XVC4      TYDCVIFDTPPLIGSADAAVLGNMVDGVLIVVRPGVVDSNTATAAKSLL--ARSEANILG
A0A218QGE0      SYDYVIFDTPPLVGTADAAVLGNMVDGVLIVVRPGVVDSNTATAAKSLL--ARSEANILG
A0A3B8Y8H9      KFDLVIFDAPPLLGLVDAKLLTAKTDGLLLVVRLDKTNKDLVKKAVEEM--QSAQLPILG
A0A1Z3HMQ0      RYDYVLFDTPPLIGAADAAVLGRATDGVLLVLRPRLVDSASAQAAKSLL--QRSGAEILG
A0A1E5QP61      NYEFIIIDTPPFLLVADALALGKMTDGLLLVTRPGIIDTASAGGAREIL--AQSGQNVLG
A0A3M2GIL5      DYDFILIDTPPLVMAADALTVGKMSDGIVLVVRPGAIDRVSAAASQQLL--RQSGVNVLG
A0A433NM31      SYDFVLIDTPPLSAAADARIIGAMTDGIVMIVQPQLLDTGSAISAKELL--EQSSQNVLG
A0A3M1PML8      EYDFVLFDTPPLAGIADAAVLGKMTDGMVLVVRPGVVDSSRALAAREFL--KQSGQQVLG
A0A352X442      GYDAVIVDTPPMAGIADAPILGKMADGILLVVRPGVVDAGSAKAAKEFI--ARSGQTVLG
A0A0T7BPZ0      EFDCIIFDTPPLVGIADAAVLGKLADGILLVVRPEVLDLGSAQASKEFL--QQSHQRVLG
A0A0M0SHU3      DYDCVIFDAPPLAGTADAAVLGKLADGVLLVVRPEVVDFASANAAKEFL--IQSGQKVLG
A0A1D2PBN3      DYDFVIFDTPPLAGIADAAVLGKLADGILLVVRPGVVDSASANAAKEFL--TQSGQQVLG
A0A0C2LVR7      DYDFVIFDTPPLAGTADAAVLGKLADGILLVVRPGVVDSASANAAKEFL--TQSGQQVLG
A0A1Z4PQB9      NYDFVIFDTPPLAGIADAAVLGKLADGILLVVRPGVVDSASANAAKEFL--TQSGQQVLG
A0A1Z4SFN6      EYDFVIFDTPPLSGMADAAVLSKLADGIMLVVRPGVINYASANAAKEFL--KQSGQQVLG
K9PGI8          EYDFVIFDTPPLTGIPDAAVLGKMTDGILLVVRPGIVDSASASAAKEFL--DQSGQQVLG
A0A2W1JVB9      RYRYVIIDSPPLSAAADTLTLSRMADGLLLVVRPGVAETGSVALSKELL--KQPGHNLLG
A0A3M1SVZ4      RYDFIILDAPPLNVAADASILGKMSDGILWVVRPGVADSTSTTVAREIV--EQSRQTVLG
K9SSQ0          TYDYVLIDTPPIVGITDAQSLAPRMDGVVLVTAIEKATKQAIFRAIEIL--KINNCKVAG
A0A2W1JIN9      SYDLVIVDTPPVTSCVDAMAVSSEGYPLLLIARPNVTEKDLLKRSAAEL--IEHNINVLG
A0A318AJV1      LYDFVVMDLPPVLGVADARLLAAMADANVFVVRWGSTPPEAASLALSSL--DADGVNVHG
A0A254WHG9      QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARPSFTQRDIFTQAVAEL--RAKRVEILG
A0A2P8QIL5      QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARPSFTQRDIFTQAVAEL--RAKRVEILG
A0A2T1FLY5      QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARPSFTQRDIFTQAVAEL--RAKRVEILG
A0A433W447      QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARPSFTQRDIFTQAVAEL--RAKRVEILG
K9U1K8          QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARPSFTQRDIFTQAVAEL--RAKRVEILG
A0A1U7N2U4      HYDLVIVDTPPVSSFADAHTLSRYSDGLVMVTRANFTQKDILLQTVSKL--KDTSTPILG
A0A1D9G1F2      HYDLVIVDTPPVSSFPDAHTLSRYSDGLVMVTRPNFTQKDILLQTVSEL--NDSSTPILG
F4XV38          HYDLVIVDTPPVSSFADAHILSRYSDGLVIVTRPNFTQKDILLQTVSEL--KDSSTPILG
K9UYB2          HFDLVIIDTPPLTICADAITLGRITEGLLLVTRPKVTVKEMLQRTITEL--SRIQIPVLG
A0A0C1XJI7      NYDMVIIDTAPISACADAATLARQSDGIMLVTRPSITIKEVLQRAVSEL--NNNQIPVLG
A0A218QN17      TYDMVIIDTAPISACADAATLARQSDGIMLVTRPNITIKEVLQRAVSEL--NNNQIPVLG
K9RKN2          EYDLVIIDTPPVSACADAATLGKQGDGVVLVTRPSFTNKEMLQKAVSEL--TSNHIPILG
A0A2I8ADV2      HYDLVIIDTPPIGVCADASTLSQYSDGVIMTTRPSVTMKESLQRAVSEL--QQNRIPILG
A0A1W5CKM3      RYDLVIIDTPPLSACADASTLSQMSDGVILTTRPGFTLKEVLQRAVSEL--NQNRIPVLG
Q3MEW0          RYDLVIIDTPPLSACADASTLSQMSDGVILTTRPGFTLKEVLQRAVSEL--NQNRIPVLG
A0A1Z4KIC7      RYDLVIIDTPPLSACADASTLSQMSDGVILTTRPGFTLKEVLQRAVSEL--NQNRIPVLG
Q8YSM5          RYDLVIIDTPPLSACADASTLSQMSDGVILTTRPGFTLKEVLQRAVSEL--NQNRIPVLG
A0A1Q4S1H4      NYDLVILDTPPLSACADATTLSQLSDGVMLVTRPNYTIKEVLEKAVADL--TRDRIPMLG
A0A433VBU6      SYDLVILDTPPLSACADATTLGQLSDGIMLVTRPRYTIKEVFQKAVSDL--TRDRIPMLG
A0A1Q4RZJ6      NYDFVIIDTPPLSACADTATLAKQCEGVLMVTRPNITVKEVLQRAVSEL--NNNHIPIVG
A0A1Z4SNV3      NYDFVIIDTPPLSACADTATLAKQSEGVLMVTRPNITIKEVLQRAVSEL--NNNGIPIVG
A0A2H2XJQ1      NYDFVIIDTPPLSACADTATLAKQSEGVLMVTRPNITIKEVLQRAVSEL--NNNGIPIVG
A0A3S5K358      NYDFVIIDTPPLSACADTATLAKQCEGVLMVTRPNITVKEVLQRAVSEL--NNNHIPIVG
A0A0T7BPJ4      KFDLVIIDTPPLCACADASTLSRYSDGMVVVTRPGFTLKEILQKAVVDL--THNGVKVLG
A0A0C1QS61      NYDLVILDTPPLSACADAATLAKQSDGVMLVTRPGFTLKEILSRSVSEL--TRNRIPVLG
A0A139X3R8      NYDLVIIDTPPLSACADAATLAKQSDGVMLVTRPGFTLKEILSRSVSEL--TRNRIPILG
A0A1Z4I7C5      YYDIVIIDTPPLSACADAASLSQMSDGVILATRPGFTLKEVLQRAVSEL--NQNRIPILG
A0A0C2MDK7      NYDLVIIDTPPLTACADALTLAQEGNGLMLVTRPGFTDKEVLSRCVREL--TQNRISILG
A0A1Y0RCK1      NYDLVIIDTPPLSACADASTLAQQSDGVVLVTRPSFTDKEILSRCVWEL--TQNRIPILG
A0A1Z4PWZ0      NYDLVIIDTAPLCSCADASTLARQSDGVMLVTRPGFTEKEVLSRSVSEL--TQNRIPILG
A0A0C2QLT0      NYDLVIIDTPPLSACADASTLAQQSDGVMLVTRPGFTEKEVLSRSVSEL--TRNRIPILG
A0A1Z4J2K1      NYDLVIIDTPPLSACADASTLAQQSDGVMLVTRPGFTEKEILSRSVSEL--TRNRIPILG
A0A3S0ZSX0      QYDCVILDTPPLSACADAHTLSRQSDGVLIVTRPGFTIKEVLQRAVSEL--THNQIPIMG
A0A2N6K4T3      QYDCVIIDTPPLSACADAHTLGRQSNGILLVTRPGFTIKEVLKRAVSEL--THNQIPIIG
A0A370CKT2      QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRPGFTIKEVLQRAVSEL--THNQIPIMG
A0A0S3TL97      QYEFVVLDTPPLSACADAHTLGRQSDAILLVTRPGFTIKEVLQRAVSEL--THNQIPVMG
A0A2N6M8A0      QYEFVVLDTPPLSACADAHTLGRQSDAILLVTRPGFTIKEVLQRAVSEL--THNQIPVMG
A0A2N6M9E1      QYEFVVIDTPPLSVCADAHTLGRQSDGSLLVTRPGFTIKEVLQRAVSEL--THNQIPIMG
A0A2N6KJI4      QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRPGFTIKEVLQRAVSEL--THNQIPIMG
A0A2N6MZ77      QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRPGFTIKEVLQRAVSEL--THNQIPIMG
A0A2N6KT20      QYDFVVIDTPPLSACADAHTLGRQSDGSLLVTRPGFTIKEVLQRAVSEL--THNQIPIMG
G6FSN3          QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRPGFTIKEVLQRAVSEL--THNQIPIMG
A0A0D6YL98      LYDFVIIDTPPLGACADGQTLGRQSGGILLVTRPNFTIKEVLQKAVSEL--THNQIPIIG
A0A328I8B9      LYDFVIIDTPPLSACADGQTLGRQSSGILLVTRPNFTIKEVLQKAVSEL--THNQIPIIG
A0A0M0SU69      RFDCVIIDTSPLSACADAQTLGRQSDGILLVTRPDFTIKEVLQRAVSEL--THNQIPVMG
A0A1Z4TIZ8      QYDCVIIDTPPLSACADAQTLGRQSDGILLVTRPNFTIKEVLQRAVSEL--THNQIPIMG
A0A318BG22      DYDLVILDGPPVMGLADAPLLADVAEATVLVIEARRSRRGAIRSALRRL--GDARGMLAG
A0A2T1E9V8      QYDYVIIDTPPLAISADANILGKFADGVILVTRPGVADTISSKVVKERL--DQSGQNILG
A0A0P1C0L3      QYDQVVIDSAPMLSLADAVELSRFVDGVLYVVESNRMKVRALDNALRRL--RKSGAQIYG
A0A3M2GQQ6      AYDYVLIDTPPILGLSDSQSMVTKVDRVVLVCAIEQASRSSLMQTMETL--RHTGCTLAG
K9SGJ5          TYDYVLIDTPPIVGITDAQCLAGKVDSVVLVAAIERSTRSAIARAVEIL--GHSRANMAG
L8MYT6          EYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAINRSTRSGISRALEVL--ASARANVSG
A0A352JGJ6      AYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAINRSTRAGIARALEVL--EIARANVSG
A0A1J5GLS2      EYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAINRSTRSGISRALEVL--ASARANVSG
A0A2W4W6M5      EYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAINRSTRSGISRALEVL--SSARANVSG
A0A2W7AN33      EYDYVLVDTPPIIGITDALCLTSKVDTFILVAAINRSTRSGISHALGIL--STARANICG
A0A256BLV2      EYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAINRSTRSGISRALEIL--STARANVSG
A0A2W6ZXF3      VYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAINRSTRSGISRALEVL--ASARANVSG
A0A2Z5WX66      AYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAINRSTRGGIARALEIL--STARANVSG
K9W1T3          TYDFVIIDSPPVSVAADTTILGRMANGLMFVVRPGVANSGNLTYCKEIL--DQSSQNVLG
A0A0D6YBN8      SYDHVVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRSSLVKTALQRL--RAANAYILG
A0A318BJ18      RYDHVVIDSPPVMGLADAPLISSRVEGVVYAVESHGTRSTLVKTALGRL--AAANARIFG
A0A1Q4RTR1      EYDFVIIDTPPVIYAADALILGKLVDGTLVVVRPGAANSAISQEMKTLL--TQSTQRVLG
A0A1Z4SQV2      EYDFVIIDTPPVIYAADALVLGKLVDGALVVVRPGAANSAISQEMKTLL--KQSNQRVLG
A0A2H2XGN1      EYDFVIIDTPPVIYAADALVLGKLVDGALVVVRPGAANSAISQEMKTLL--KQSNQRVLG
A0A433UXH8      EYDFVIIDTPPVIYAADALVLGKLVDGTLVVVRPGAANSAISQEMKSLL--TQSTQRVLG
A0A1Z4RMB9      DYDLILIDAPPLPVTADVLTLSKLVDGIVFVTRPGVVEHESAELAQEAL--ATTRQQVLG
D5A466          EYDFVIIDTPPLVLAADALTLANMASGVLMVARPRILDRDSAKSAKEIL--GRSGQRILG
K1XF69          EYDFVIIDTPPLLLAADALTLANMASGVLMVARPRILDRDSAKAAKEIL--GRSGQRILG
B5W297          EYDFVIIDTPPLLLAADALTLANMASGVLMVARPRILDRDSAKAAKEIL--GRSGQRILG
H1W7M8          EYDFVIIDTPPLLLAADALTLANMASGVLMVARPRILDRDSAKAAKEIL--GRSGQRILG
B4WP72          YYDFIILDSSPFVGCADPSILGKVADGVVLVVRPGVLNAKAANAAREHL--MSTEQRVVG
A0A318B4H2      RYRHVIIDAPPVLGLADAPLLSRTVDGILFVVESNVGKLRMVRGALRRL--ELPGAKVFG
B4WQE3          TFDVIIFDTPPLLGFADSLMVAQITQGLLLTVRLGEIKSSQLQQALDRL--YTARVPVMG
A0A2K3BR24      DYDYVLVDTPPLAVAADAAILGRLGQGVLLVVRPSVVAASNLDNTREIL--QHSGQSLLG
K9YXY1          DYDYVLVDTPPLAVAADAVILGRLGQGVLLVVRPSVVAGGNLDSTREIL--QNSGQPLLG
A0A2P8W4F7      HYDLIIFDTPPLSGMIDAKLTAAHADGLLLVVRLHRSERSEIQRVLADLG-NTAQAPLLG
U5QJM6          EFDLVLIDSPPLIGLTDATLLARHADGILMVIGLETARRGGLKGARERL--EAAGVVPMG
A0A1U7HGH0      QYDYLIIDTPPLSIAADASILSKVVDGVILVTRPGIADISSSRFAKEYL--DQSGQNILG
K9XJD3          QYDYLIIDTPPLSIAADASILSKVVDGVILVTRPGIADISSSRFAKEYL--DQSGQNILG
K9SX01          AYDYVILDTPPVLAVADAIVLGRIADGVLIVARPEVLDSGAAIRTRAIL--DQSELNILG
A0A1E5QIR9      TYDFVILDTPPLSAAADARILSAMTDGMLIVVQPQLVDAASAIAAKELL--AQSGQNVLG
A0A1Z4IBC7      DYDFIIFDTPPLTGIADAAVLSTLTDGILLVVRPGVVDFDSANAAKEFL--TQSGQKVLG
A0A1W5CPC7      DYDFIIFDTPPLTGIADAAVLSTLTDGILLVVRPGVVDFNSANAAKEFL--TQSGQKVLG
Q3MDC6          DYDFIIFDTPPLTGIADAAVLSTLTDGILLVVRPGVVDFNSANAAKEFL--TQSGQKVLG
A0A1Z4KM73      DYDFIIFDTPPLTGIADAAVLSTLTDGILLVVRPGVVDFNSANAAKEFL--TQSGQKVLG
Q8YNX7          DYDFIIFDTPPLTGIADAAVLSTLTDGILLVVRPGVVDFNSANAAKEFL--TQSGQKVLG
A0A367R4K6      DYDFIIFDTPPLSGIPDAAVLSSLTDGILLVVRPGVVDLDRANSAKDFL--TQSGQKVLG
A0A1E2WSV8      DYDLVIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANAAKEFL--TQSGQKVLG
A0A2R5FRT9      DYDFIIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANSAKEFL--TQSGQKVLG
A0A2K8T1B6      DYDLVIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANSAKEFL--TQSGQKVLG
A0A235I9I0      DYDLVIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANAAKEFL--TQSGQKVLG
A0A2D0HQT8      DYDLVIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANAAKEFL--TQSGQKVLG
A0A2L2NU95      EYDFVIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANAAKEFL--TQSGQKVLG
A0A367S084      DYDLVIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANAAKEFL--TQSGQKVLG
A0A0V7ZFJ4      KYDFVILDTPPLTAVADGLMLSKLADGILLVVRPEAVDSDTVKVVRNRL--KQSGQQVLG
A0A0V7ZNJ9      EYDFIIIDTPPLTAAADSLIFSKLVDGTLLVVRPGIATSDAVSAAKNQL--EQSGQRVLG
A0A367RIS1      DYDCVIIDTPPLSVLADASIVGKMADGMLLVVRPGVVNSAAAKTTKALI--EHSRVLVLG
A0A235IXQ2      DYDCVIIDTPPLNILADASIVGKMADGMLLVVRPGVVNSAAAKTTKALL--EHSRVPVLG
A0A1W5CNX3      DYDYVIIDTPPLSVLADASIIGKMADGMLLVARPGVLNSAAAKTTKTLI--EHSRVSVLG
Q3MEB7          DYDYVIIDTPPLSVLADASIIGKMADGMLLVARPGVLNSAAAKTTKTLI--EHSRVSVLG
A0A1Z4KHN9      DYDCVIIDTPPLSVLADASIVSKMADGMLLVVRPGVVNSAAAKTTKTLI--EHSRVPVLG
Q8YT70          DYDCVIIDTPPLSVLADASIVSKMADGMLLVVRPGVVNSAAAKTTKTLI--EHSRVPVLG
A0A218Q4C1      DYDCVIIDTPPLTFIADASIIGKLADGILLVARPGVVNSDAIRTTKTLL--ENSRLSVLG
A0A166IWU6      DYDCVIIDTPPLTFIADASIIGKMADGILLVARPGILNSDAIRTTKALL--ENSRLSVLG
A0A2S0Q8C0      DYDCVIIDTPPLTFIADASIIGKMADGILLIVRPGIVNSDGIRTTKALL--KNSRLSVLG
W6FSX4          DYDCVIIDTPPLTFIADASIIGKMADGILLVARPGIVNSDAIRTTKALL--KNSRLSVLG
A0A1B7WTD1      DYDFVIIDSPPLTAVTDPLIISKFADGILLVVRPGQVEYSALKSAKSLL--NQSKVPVLG
A0A1B7WX82      NYDFVILDTPPLTAVTDPLIVAKYVDGLLLVVRPGKVEYSAMKSAKSLL--NQAKVPILG
A0A0R0M9H9      DYDFVIIDTPPLTAVADALIVGKLVDGVLLVVRPGQVESSAVKASNSLL--IQSKVPVLG
A0A1S1ZVW2      DYDFVIIDTPPLTAVADALIVGKLVDGVLLVVRPGQVESSAVKASNSLL--IQSKVPVLG
A0A1Z4LRU5      EYDLVIIDAPPLTVVADALNIGKLADGMLLVVRPGVANTGSVNAAKSLL--EQSGHRVLG
A0A1Z4JVB4      DYDFVIIDAPPLSAVADAQILGKLADGILLVVRPGLVDSTAANATRKLL--AQSSQRVLG
K9PIA4          EYDFVIIDAPPLTAVADAQILGKLVDGLLLVVRPGVVDSAAASETKTLL--EQSEQRVLG
A0A1Z4M597      EYDFVIIDCPPLTLVADALMLSKLVDGILLVVRPGVANTGSVNATKMLL--EQSGHQVLG
A0A1Z4MWT1      EYDFVIIDCPPLTLVADALMLSKLVDGILLVIRPGVANTGSVNATKMLL--EQSGHQVLG
A0A1Z4TX53      EYDFVIIDCPPLTLVADALMLSKLVDGILLVIRPGVANTGSVNATKMLL--EQSGHQVLG
A0A1Z4HVE1      NYDFVIIDAPPLTAVADAQILGKLVDGILLVVRPGVVDSAAAAATQTLL--RQSGQRVLG
A0A252ECZ1      DYDFVIIDAPPLTAVADAQILGKLADGI