BYKdb

Dataset for cluster orphancd of phylum deinococcus-thermus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A399EFN2      MTPHTADSTEEISLERLIPLLLRAIRWALPAALLSATVTYFALKQQPLVYESASSLVAVQ
D7CW95          -----MQQEISVSLGDVFRFLRRGFLLALLLAALGAGLAYVLSGLREPLYRAETTLL-IT
                      :.  .:**  :: :* *.:  **  * *.* ::*.    .  :* : ::*: : 

A0A399EFN2      PGPLGSAGSFTTPLVSVAPLDPQAYKEAALSTQVLGQALAMAG----EPEGPQALMRLRQ
D7CW95          RGDL-NLGAFSAPVIVAPPLDASAYATAAESSEVIEEALVALGAETVTPQQVQGVRNRTA
                 * * . *:*::*:: ..***..**  ** *::*: :**.  *     *:  *.: .   

A0A399EFN2      AAKVRTVDGRQSSIITLRVRDRDPARAARLANAWAAALRGWEDQRAREHFTRYRRSVEAQ
D7CW95          ALPRESAAARDSSQLILQVEEGSAEGSAALANALARSLIEWDLLRAENALAQSIAQLDRS
                *    :. .*:** : *.* : ..  :* **** * :*  *:  ** : ::.   .:: .

A0A399EFN2      LEAILTEI-RQARQLKDPDRLRSLDALRGNLARDRDLAHALEESAVGLLALLEHAQVPLA
D7CW95          IANTQAEIARLQAEGAPPDQIGRLQNRLNNQLANRDEAEANIGTATSRLSVIQAAVPPLR
                :    :** *   :   **.:  *:   .*   :** * *   :*.. *:::: *  ** 

A0A399EFN2      PSAPRPLLGGAAAAVIASLLFFGFVLLREALVRAVRDSEEAARVTGLPVLGEFPRMPPNG
D7CW95          PVSPRPPLDAVIAGFLGFVLGYGILLLRNLLDTRLRSVEDLEAVSGLPILAEFAKSPKKT
                * :*** *... *..:. :* :*::***: *   :*. *:   *:***:*.**.. * : 

A0A399EFN2      KRELPAEAAAFLRTGVHHALADRHPKVVLVTSPEKAEGKSSVAIALARAYARADLPTLLV
D7CW95          RR-LPREASGYLRTNLLLATPKVHPKVILVTSPHHGEGKSSVAISLAESFTRANYRTLLV
                .* ** **:.:***.:  * .. ****:***** :.********:** :::**:  ****

A0A399EFN2      DADLRRPVVHREFGIAKGWDLVESLRDFTYSVHAH--------PVAPNLEVLPCLEAPEN
D7CW95          DADLRKPVIAREYNLDDKRHM--PLRTHLENPHGSYEAAHVGVNLAQTLDIIPTFRAAPS
                *****.**: **:.: . . :  .** .  . *.          :* .*:::* : *. .

A0A399EFN2      PAELLAEHWRDFLNNLVHTGRYKVVVVDSPPALAVSDALILAPHASGVLVAVSEGATDRK
D7CW95          PTELLSLGFPSCLESWQQD--YDVIVIDSAPLLDVADTLTIAPLCTGTVLVASLQETDPQ
                *:***:  : . *:.  :   *.*:*:**.* * *:*:* :** .:*.::..*   ** :

A0A399EFN2      RLEATLEVLSRVGARVVGLAMTNLRRGPAASGQFTYGYGYGY------GPVAVAD-RKEH
D7CW95          ALTDAVELLQRSGVRIFGIAATFVPRGTGARARAA-SYRYAYEGELQDDPLVVAPLPPPT
                 *  ::*:*.* *.*:.*:* * : **..* .. : .* *.*      .*:.**      

A0A399EFN2      KGLPKAGGPKSS
D7CW95          AAQPVKARSRPS
                 . *  . ...*

© 1998-2019