BYKdb

Dataset for cluster tadcd of phylum deinococcus-thermus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A399FAX6      -----MRELPSYIKIDLAELWRTVVRYWWMLLAIFVLAAGLGYFLSKRQTPVYQSTARLL
E4U5D0          MNETVSREFED--EISLSDLFELLRKYALLVLLAAVFATALAFVVSAREPKVYRATAKVI
                      **: .  :*.*::*:  : .*  ::*   *:*:.*.:.:* *:. **.:**.::

A0A399FAX6      SAQTVAFGGGQFQSLPNSSPLDSQAYIQAALSTQVLKDTFNLGNQPVTTQRLDELRKKLR
E4U5D0          VSFESTARAAS-EVVIEPPPLDLSTYQEVARSPEVLEQAL---GRPLDPETLARVTQRYR
                 :   :  ... : : :..*** .:* :.* *.:**::::   ..*: .: *  : :. *

A0A399FAX6      VRAIDGRQSSVIVMSALDTNPANAAKIANAWANALRNWDDQRVRSTFSRNRQTLEAQLKS
E4U5D0          IDTMEGRRSGVLLLRVEAEAPDRAAAAANRWAEALLAWEQERALGTIQRQKKALSAQLAA
                : :::**.*.*::: .    * .**  ** **:**  *:::*. .*:.*:.::*.*** :

A0A399FAX6      LNSDLNRGGVSPQDLEARRTLLASVQRDLDLVRALEQGATGQLTLLDAADLPSKPVAPRP
E4U5D0          LEGELANLDPKSERYLSLALLKAQIQQKYDQLEVLEAGTQPRLHLLEPARPPAESVRPRP
                *:.:* . . ..:   :   * *.:*.. * : .** *:  .* **:.*  *::.* ***

A0A399FAX6      LFTALLAGFLTLAVGFFILLLRESSTRTVRNSEEASGITGLPVLGEFPRTPGAHGRELPR
E4U5D0          LLNAALAGTLTAFLAVFLAFFKEAVSPYLRDPEEAARLSGLPVLAEFPRMPPRPGVELPH
                *:.* *** **  :..*: ::.*: :  :*:.***: ::*****.**** *   * ***.

A0A399FAX6      ESASYLRTYVNRSLMDEHPKVVAITSAESGEGKSSISLALAKAYARAGKRTLLIDLDLRK
E4U5D0          ETALFLKTGLKPSLLADDPSIVLVTSTVEGEGKTSVALALAHALAQEGKPTLLVDADLRV
                *:* :*.* :: **: : *.:* :**: .****:*::****:* *. ** ***:* *** 

A0A399FAX6      PVLHKEFGIAAGADIVSVLRDPMFTLTAHQVEPGLHVLPCLQTLPDSAELLAEHFRPFLR
E4U5D0          PALQERLRLPQGPGLLQAL--STLEDTARQIAPNLYAITCSAPPHDPAEILGQHFKGWIR
                *.*:: : :. *..::..*  . :  **.*: *.*:.:.*  .  *.**:*.:**. ::*

A0A399FAX6      RLLELQEWDVVILDTAPILEVTDTLIVAPQVSGLLLVVSAGSTNRRRLSAALDSLKRIGA
E4U5D0          FHSERRAYRYIVIDSAPLLPVVDTLALAPHATALLLVASEGKTSKKNLTTAVGILQNIGV
                   * . :  :::*:**:* *.*** :**:.:.****.* *.*....*::*:. *:.**.

A0A399FAX6      RVIGVAVNNLRSGEGLTTSARGYGSYGPKYRPGSTTEERDIRQTSEW
E4U5D0          RPTGLVMNRVRNPSTVFVGGYGYGY-------GNGKRKRRVRA----
                *  *:.:*.:*. . : ... ***        *. . :* :*     

© 1998-2019