BYKdb

Dataset for cluster orphancd of phylum elusimicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F9Y6N7      ------------------------------------------------------------
A0A1F9VII2      MTKETQQQLNLSDMLELLIRKRNVFLVLFSVVFFSSVLAGLFMPRVYEASSLIKVRGKKI
A0A1F9YBZ2      -MDKGAKELNFKDYLDILFRSKYTVLLIFFAIIGPLVFYVRTMPDAYTTRSQLVIEDLKY
A0A1F9UED4      ------------------------------------------------------------
A0A1F9XD88      --------------------------------------------------------KESN
                                                                            

A0A1F9Y6N7      ------------------------------------------------------------
A0A1F9VII2      IDPLVSEIAVAPQIAEEINTLSKQIMAWPKLEQLVLQLNLVSV-----DASQKQMEDYIT
A0A1F9YBZ2      SSALDFTGLQGLRSSRSFNFYQGIFKSRSFLQAIHDSLGTVSFRNELRDTAQEVIRAFIG
A0A1F9UED4      ------------------------------------------------------------
A0A1F9XD88      VSSYREGVAVDISGMDYYQTQYKIIKSRSIAKRVIEELGPALN-AGNRTANGDSVNSFLG
                                                                            

A0A1F9Y6N7      ------------------------------------------------------------
A0A1F9VII2      NLRKRVNVRFVNREIIQVVYQDGNPRRAQMVANTLTQNFIEESSQGKREEAKNAIDFINE
A0A1F9YBZ2      SALSLQQTGY--ESFISLSAMARTPQLAYDLSRVATQIFKSMCREVVAEEAENMVKETEK
A0A1F9UED4      ------------------------------------------------------------
A0A1F9XD88      SIIIEPIRG---SRLVNISAESFSPELAVRMANTLSDVYVKQNLENRLFASREILKKLPA
                                                                            

A0A1F9Y6N7      ------------------------------------------------------------
A0A1F9VII2      QLKIYRAKLENSEQNFTVSK---------IDSDLRVAQNRRTLLKDRLANLQ--------
A0A1F9YBZ2      QLNLIRDKLETVEKDFNEFRERTGASTLGMADELKHLQTRYYELRSDQASKEALYEANRR
A0A1F9UED4      ------------------------------------------------------------
A0A1F9XD88      DISLASLSNKDVMESLPSVV----------------------------------------
                                                                            

A0A1F9Y6N7      ------------------------------------------------------------
A0A1F9VII2      -------KIIPSQVTTEQNPVVSQLQARAGQIESELARL------LIDAKEGNPKVQELQ
A0A1F9YBZ2      LLSVLEKRIEPKNTDNQQSGLYLKAKETLRQKEKEKKRLESLGLTLSTASQINEEITKLE
A0A1F9UED4      -------------------------------MEIKYADL------AHRYKPKHPSLQRVM
A0A1F9XD88      -----------------SNSLIQDLKAELIKYESEYANL------SQRYKEKHPSMQTLQ
                                                                            

A0A1F9Y6N7      ------------------------------------------------------------
A0A1F9VII2      TELTGLKARISSELEKTTVKESISTFNPMYLQTEQELKQMDMEISYLEKRRESLLTRSVR
A0A1F9YBZ2      QDVIRYSSK--EERVDPKVVNQWQKMRNVVVDNEMELDILKNNLAVYEKKINEY--KRSH
A0A1F9UED4      AQRQSLQAQIQTETQH--------------------------------------------
A0A1F9XD88      AKINLLKERIGTEMRN--------------------------------------------
                                                                            

A0A1F9Y6N7      ------------------------------------------------------------
A0A1F9VII2      GAKKLGEEGLANLERNKRVDEDIYQMLLRQLESAYVSERLQDSEKGNQFTVLEYARLPLK
A0A1F9YBZ2      PDELSQSLELARLERARKVYEDTYNVLLEKVELA----KIRRASETGGLTIIDPVYYPTK
A0A1F9UED4      --------------------------ILQSLKT-----QVSGQFKGNNIRVVDPAEVPLK
A0A1F9XD88      --------------------------TVESIKT-----ELSGEYKSNNVRIVDYAEVPKN
                                                                            

A0A1F9Y6N7      ------------------------------------------------------------
A0A1F9VII2      PVKPNFMKILLFGFFGGLMLGGGGVFLLENIFKTFHTPEQAQAVLGFTGLGSVGTIAMET
A0A1F9YBZ2      PIPRKEAAYYIVGLFVSLLLAVGFVFFREFLDTTVKSNTDLENAFEIPIIGTIPHIDFAK
A0A1F9UED4      PVRPILWMNLLMASFLGLFGGWGLALLVNYWDTTIKTQEDVEKFLEVPFFGYIPSIKLGK
A0A1F9XD88      PVRPQRKRNIIIAFVLGLSLGAGLAFLVEYLDNTFKSGSDIEQYLDVPFLGIVPIVKEKG
                                                                            

A0A1F9Y6N7      ------------------------------------------------------------
A0A1F9VII2      QNKDKKEFRAAVRDFLRNNKLFSKIRIAVPHIALKRLDPSVAAELVVYHDPRSRIADDYR
A0A1F9YBZ2      KSEMEIKRRSSTGGDKETTTIYPK-------------------ELINFYKDESVVAESYR
A0A1F9UED4      KDSLKG-------------------------------------YLYSREAPESPVTEAFR
A0A1F9XD88      ENN-----------------------------------------MFVLDGVKSPQGEAVK
                                                                            

A0A1F9Y6N7      -------------------MITSSVHSEGKSTTSMNLAIALADSGMNTLLIDADLRRGIL
A0A1F9VII2      MLKTNIFHGLNDSGKIKKLLITSAIHGEGKSTTSANLAAAIAAGGSKVLLVDCDLRKGLL
A0A1F9YBZ2      ALRTNLFFASPDN-PIRTLGVTSSGPHEGKSLTVSNICLACAQMGKRTLLIDSDLRRPVI
A0A1F9UED4      GVRTRLLQMAKTR-SPKTLLVTSAGVKEGKTLFSSNLAIILAAGGLRILLVDADLRRPQL
A0A1F9XD88      TIRTNLIFSAAEG-KLKTILVTSCVPGEGKTFSSMNIAASFSQAGKKTLLVDTDLRRSSL
                                    :**.   ***:    *:.   :  * . **:* ***.  :

A0A1F9Y6N7      HEHL-SVPQSPGLSTLLHGSMLMEAAFARTQIKNLTLIPCGTRPVRPAELLGSRAMEQLL
A0A1F9VII2      HAFF-SAPVNPGVSDILLNSIDPQKACRQTPVNNLWFLPCGAAKGNPTELMGSPSFKELI
A0A1F9YBZ2      HHLF-HLPRENGFTDLFIGK-ELEAVVKKTAMENLDIMTAGRFTPNPSELLASKKMEKIL
A0A1F9UED4      GAVWGKPDHNLGFQDLLAGEAPLGAVVQETSVKNVSLVPAGFNCPHPAEILGSKRMGGVL
A0A1F9XD88      TKCM-KMDIGNGLSNYLIGEADCDNITRETEVKNLYFISSGLHSPDPAELLGSQRMKEFV
                           *.   : ..         * ::*: ::..*     *:*::.*  :  .:

A0A1F9Y6N7      NKGSTSFDAVIVDAPPVLNLPDASILSRLCDGVVLIVQAERTQREEALRAHGMLAQARAN
A0A1F9VII2      NSLSSQFEIIVMDSPPVLNMPDAMMLSKFSDAVVVAIESGKTHQKDVINIKSSLRQVGAK
A0A1F9YBZ2      ETMKAQYDIILFDTPPVMAVTDAPIISTKVDGMLMVVKSYSTDKNVLERALINLENINAR
A0A1F9UED4      AEMTSQFDLVIFDTPPLSYVTDAMILAPQMDGVLMVVRYGKTHPPIAKRHVERFQETNTP
A0A1F9XD88      AQVSAKFDRVIFDSAPVLPVSDTLNIANLMDGVVMVVYSGKLSRAMVNMGKQKLQGVKAK
                   .:.:: ::.*:.*:  :.*:  ::   *.::: :                :    : 

A0A1F9Y6N7      IIGFVLTNVQY----YIPKYLYDYYYGR--------------------
A0A1F9VII2      VLGFVMTRQD---H-YMPRYMHDYYYS---------------------
A0A1F9YBZ2      IVGFVLNDIDLTHR-YASYGYYKYYYHYYRSQKD--------------
A0A1F9UED4      LLGVVINDFQATPGTYSPYGYGCGYYSPYSHRGNGGKSDVRRPSPLSV
A0A1F9XD88      VVGALLNYVNVKARGYHGYSYYSYSYNEYY------------------
                ::* ::.  :     *         *                      

© 1998-2019