BYKdb

Dataset for cluster tadcd of phylum elusimicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F9RUT7      --------------------MLRKRRRLVLAVTLLVVAVVAIATAMQEPVYLASARVLV-
A0A1F9WUH0      ---MTDKKSAVQQGYRDKLESFIRWRWFMVGPLLISVIVSIFVSIMLSPQYETSSLIQIS
A0A1F9WWA6      MSLVTGTNQFHENELLAYWNIIQRRKWVVLTVLVATVTIAAISGFKAPYVYRATAQLLIE
A0A2N2EX59      ------MIEEDEIDLRQIYALAGKHKLLIFLFFVAGIAAAIITTMIKTPVYRASTMLLIE
A0A1F9X688      ----MKTQIDQNSHLTDYIHILLKRKWIIITFFVIVVTTVVIGTFKTRPVYRATAQLLID
A0A1V5VJS3      MIKVSNTAKAQELQLEDYIQLLFRRKWIFITFFIIVVTIVAIATFRMRPVYRATATLLIE
A0A3C1EPJ8      --MNPTPDSETELDLTHYMDIILRRRWIVLSALSIVFISTMLVTFTTKPIYQASSLLVIE
A0A2N2ESN1      -MNENNNEKELEFDLTYYLDLVLRRRWIVLSVWVSVIIITALVTFNTRPVFQSQALLVIE
A0A1F9QNS6      ----MTEEKELEFDISYYLDLILRRRWVALSVFVSVVIIAAVVTFNTRPVFQAQSLLVIE
A0A1F9XM68      -MNETNSESDFEIDFAGYLEIFLRRIWVVVSVWAAVVIIAALITFNIRPVYQSSSLIVIE
A0A3C1EME8      ---MPDNEQDVEIDLARYFGILSRRKWIVLSVAASAMLGTAAYAFLATPIYRASTLLDIE
A0A1J4STN8      -MNDNNNDNELEFDLTYYLDLILRRRWVALSVFISVVIATALYTFNARPVFQAQSLLVIE
A0A3D1N2U3      -----MPDNELEFDLSYYLDLILRRRLVALSAFISVVIVTALVTFNTRPVYQASALLVIE
A0A353CQL1      ----MTEEKELEFDLTYYWDLLMRRRWVALSAWLAAIIITALVTFNMRPVYQSQALLVIE
A0A1F9RGN6      ----MAEEKELEFDLSYYTELILRRRWIVLSVFVSVMLIAALITFNTRAIYQAQALLVIE
A0A2M6Y4Q4      ----------LEFDLTYYLDMFMRRRWVVLSVWLSVLIVTAIVTFNTRPVFQAQALLVIE
A0A351UI79      MNDNNTHDEELEFDLSHYIEMFMRRRWVVLSVWVTVLIVTAIVTFNTRPVFQAQSLLVIE
                                       ..  . .      .             : : : : : 

A0A1F9RUT7      DRYRIDP--LQQIEIDRPDMTNFYETQFELIRSRPVIQRAIDGLQ--LATRRPGLAGAPD
A0A1F9WUH0      DKQIVDP--LVEGLAVSPKPKEQIEALLKYVQSWPRLQKLVENLN--LDT------GSSD
A0A1F9WWA6      KESNVSS--YREGVAVDISGMDYYQTQYKIIKSRSIAKRVIEELGPALNA-GNRTANGDS
A0A2N2EX59      KKSGGGL---QEAIGFEMTQSDYYQTQYSIITSRSIAEKVAAAVN--ARK-KNGSAR--D
A0A1F9X688      KENTATP--YQEGISINISDVDYYQSQYKIMKSRTLARKVIDDLN--LKE-EEEFIGSND
A0A1V5VJS3      KESTPNP--YQENVMVDVSQLDYYMSQYKIMKSRTLAKKVIDELK--LEK-HEEFIESKN
A0A3C1EPJ8      KERSSSNAVYTNGALIESSNDDYYQTQYKLLQSKSLTQKVFDDLH--LSN-AADFADPRG
A0A2N2ESN1      KERGNNV-IYQGVGTVERGNDDYYQTQYKLLKSEALLKTVHKRLD--LGR-YPEFSDPYG
A0A1F9QNS6      KERGNNT-IYQGGPTVERGNDDYYQTQYKLLKSEALLKTVYKRLN--LET-IPEFAGVYG
A0A1F9XM68      KERGGSANVYQGGPTVERSNEDYYQTQYKLLKSETLLKAVYQKLN--LAI-VEDFAG--G
A0A3C1EME8      PV--AKA-IRSETESGRDMDEEYADTQHRLITSNTLLERVYNDLD--LAS-TGEFSK--G
A0A1J4STN8      KERGNNT-IYQGGPTVERGNDDYYQTQYKLLKSEALLKTVHKRLN--LDR-YPEFAGVYG
A0A3D1N2U3      KERGNNT-IYQGGPTVERGNDDYYQTQYKLLKSEALLKTVHKRLN--LDS-VSEFAGVYG
A0A353CQL1      KERGNNV-VYQGGPSVERSNEDYYQTQYKLLKSEALLKTVHNRLD--LAK-HEEFKDPYG
A0A1F9RGN6      KERGNNV-VYQGGPTVERSNEDYYQTQYKLLKSEALLKTVYKRLE--LEK-VPEFAGVYG
A0A2M6Y4Q4      KERGNNV-IYQGGPTVERGNDDYYQTQYKLLKSEALLKTVHGRLN--LDK-YPEFAGVYG
A0A351UI79      KERGNNV-IYQGGPTVERGNDDYYQTQYKLLKSEALLKTVHKRLN--LDR-YPEFAGVYG
                                     :   :    : * .        :               .

A0A1F9RUT7      PAK-----AVLGGVKVEVVRGTRLVDIRVEDGDPVFAADLANAIANGFVRHVSDLRLEGS
A0A1F9WUH0      KERERYILSLRKRIKIE-MKGSDLVQVSYFDPDPVAAQKVVNTITRDFIEENMRIKKEEA
A0A1F9WWA6      V-N-----SFLGSIIIEPIRGSRLVNISAESFSPELAVRMANTLSDVYVKQNLENRLFAS
A0A2N2EX59      LTT-----GFMSNVSVEPVKSSRLVRISYDSIYPAEASEVANTLAEVYISENLKSRLLLS
A0A1F9X688      IVS-----SFLGKILIQPVRGSRLVNLSAESYYPELAAKMANKLVEIYVKQNLENRFFAS
A0A1V5VJS3      IID-----SFLKRIYVEPDRGTRLVKLSAESYYPNLAAKMANTLADAYMEQNLENKLFAS
A0A3C1EPJ8      I-E-----KFRNALTISPVLRSRLVYVRVQSHNPHLAAKAANALSETFVDQNLSNQLFIS
A0A2N2ESN1      Y-R-----KLLKPVAVAPVPRSRLVYVKADAYDPLLSSKIANMVANVYIEQNLSNQLFIS
A0A1F9QNS6      Y-R-----KLIKPVAIAPVPRSRLVYVKVDSYDPRLAANIANTVAQVFIEQNLSNQLFIS
A0A1F9XM68      P-G-----TLNSAVIIAPVPRSRLVYIRANSHDPRVSADIANAVASVYIDQNLSNQLFIS
A0A3C1EME8      L-K-----ILQASVSVAPIPNTHLCYVHAESMHPALATNISTTLSRYYVEQNLNSQLFMS
A0A1J4STN8      Y-R-----KLIKPVAIAPVPRSRLVYVKVDSYDPLLAANIANTVANVFIEQNLSNQLFIS
A0A3D1N2U3      Y-R-----RLLGPVAIAPVPRSRLVYVKVNSYDPLLAAKIANTVATVFIEQNLSNQLFIS
A0A353CQL1      Y-R-----KLIKPVTIAPVPRSRLVYIKVDSYDRLLASKIANTIAQVFIEQNLSNQLFIS
A0A1F9RGN6      Y-R-----KLIKPVTIAPVPRSRLVYIKVDFYDPRLAANIANTIAAVYIEQNLSNQLFIS
A0A2M6Y4Q4      Y-R-----SLIKPVTIAPVPRSRLVYVKANSYNPLLASRIANTIANVFIEQNLSNQLFIS
A0A351UI79      Y-M-----KLNKPVVIAPVPRSRLVYVKVDSFDPLLSANIANAIANVFIEQNLSNQLFIS
                         .   : :     : *  :         :    . :   ::      .   :

A0A1F9RUT7      RNAYEYLTNEVKNMKDSLNRAEMALGRYKEEHQLILLPQRANAAASKMSDFHAAYVDAQT
A0A1F9WUH0      RKAIEFIGEQLNIYRKKLEDSEKNFATHKIDADL---------------------RTSLN
A0A1F9WWA6      REILKKLPADIS-------------------------------------------LASLS
A0A2N2EX59      HSILDKISLAKG--------------------------------------------ASVS
A0A1F9X688      REILKKLPKGSS-------------------------------------------IENLS
A0A1V5VJS3      KEILKRLPDSAS-------------------------------------------DNWDS
A0A3C1EPJ8      KEVLQALQVNED--------------------------------------------SPKA
A0A2N2ESN1      KDVLSALQGGKN--------------------------------------------GNQ-
A0A1F9QNS6      KDVLNALQADRA--------------------------------------------GNQS
A0A1F9XM68      KDVLNALQNNQS--------------------------------------------MAES
A0A3C1EME8      KDVLDALQMKTN--------------------------------------------GADS
A0A1J4STN8      KDVLNALQSEKP--------------------------------------------GGQS
A0A3D1N2U3      KDVLNALQIERS--------------------------------------------GNQS
A0A353CQL1      KDVLTALQDDK---------------------------------------------GGKS
A0A1F9RGN6      KDVLTALQNEK---------------------------------------------GSGS
A0A2M6Y4Q4      KDVLAALQGEKT-------------------------------------------GGSNS
A0A351UI79      KDVLSALQGEKT-------------------------------------------GGGNS
                ..    :                                                     

A0A1F9RUT7      RRLELEAQLRTVREGGPNSAALEAKSEALAGLRAQEAAAQTELNNLLKTYKDKHPAVVRA
A0A1F9WUH0      RKKLLSDQLSSLQKIIPSQVKME-HSPVFSRLQSHLAELEIERARLKMDSKAEHPRLVEL
A0A1F9WWA6      N-KDVMESLPSVV-----------SNSLIQDLKAELIKYESEYANLSQRYKEKHPSMQTL
A0A2N2EX59      EDDSDINSLPQIL-----------NNPLLQRLKGDLISLQVKLASLSTKYKDNYPEIIGL
A0A1F9X688      IKEDFVRSLPSVV-----------NNGLIQNLKAEYINLETQYAELSRRYRDKHPKIISL
A0A1V5VJS3      GKEDRLDSLPSVV-----------NNTLIQSLKANYIKLETEYADLSKRYKDKHPSLVSL
A0A3C1EPJ8      --RQMYEALPAVV-----------SNPLIQTLKGEHAKLEAQCAEMSQKFTAKYPAMIAL
A0A2N2ESN1      --RAVYDSLPAVV-----------NNVLIQDLKREGAKLQSLLAEATGRYTAKHPQVVSL
A0A1F9QNS6      --RAIYESLPAVV-----------NNALIMDLKRESAKLQAQVAEASGRYTAKHPQVLSL
A0A1F9XM68      --RKLFESLPAVV-----------NNILIQQFKKDASNLRAQSAELSSRYMPRHPQLLSI
A0A3C1EME8      --VKVSESLPTVV-----------NNRLIQSIKEQIFTAEAQLTDLRMKYTDSHPAVIAM
A0A1J4STN8      --RAIYESLPAVV-----------NNTLIMDLKRESAKLQSQVAEASGHYTAKHPQVLAL
A0A3D1N2U3      --RAIYESLPAVV-----------NNTLIQDLKRETAKLQAQVAEASGRYTPRHPQLLAM
A0A353CQL1      --RAIYESLPAVV-----------NNPLIQQLKQDTAKLQAQVAEASNRYTAKHPQLMAM
A0A1F9RGN6      --RALYESLPAVV-----------NNVLIQDLKREVVKLQSQLAEASGRYTPKHPQVVSL
A0A2M6Y4Q4      --RAMYESLPAVV-----------NNVLVQQMKQDAARLQAQAAEASGRYTAKHPQVVAM
A0A351UI79      --RAMYESLPAVV-----------NNVLVQQLKQDAARLQAQVAEATGRYTPKHPQVVAM
                        *  :             .  .  :.                    :* :   

A0A1F9RUT7      RAQLDDIRARLKTEHGR-----VFQALEGQYKIQKAREAAMLQAFERYKKETQDLARKEV
A0A1F9WUH0      NREIEELRRNIDAELKKDMVRESVSMVNPSYFESEQELKKLEMDLDYLAKRKKELEESGI
A0A1F9WWA6      QAKINLLKERIGTEMRN-------------------------------------------
A0A2N2EX59      KKAVDFMEEKIREETLN-------------------------------------------
A0A1F9X688      KSSIEALQSRIDAEIEK-------------------------------------------
A0A1V5VJS3      RAEMEQLKNRIDIEIKN-------------------------------------------
A0A3C1EPJ8      RSNLNALKGQIQAETDK-------------------------------------------
A0A2N2ESN1      AANLKAVQEQIKAETDK-------------------------------------------
A0A1F9QNS6      TANLQAVQGQIKTETDK-------------------------------------------
A0A1F9XM68      NANLQAVEDQIRNETDK-------------------------------------------
A0A3C1EME8      RSRIESMKKVQLNEIDN-------------------------------------------
A0A1J4STN8      NANLAAVQSQIKVETDK-------------------------------------------
A0A3D1N2U3      AATLQTLQRQIKEETDK-------------------------------------------
A0A353CQL1      TANYEALRGQLKAETDK-------------------------------------------
A0A1F9RGN6      SANLTTLQGQLKSETDK-------------------------------------------
A0A2M6Y4Q4      TANLKAIQGQIKAETDK-------------------------------------------
A0A351UI79      TANLAAIQGQIKTETDK-------------------------------------------
                      :      *  .                                           

A0A1F9RUT7      QFN---------VLQREATVGRDMLDFLIKRLRETGLSSELNTNT----VRVAEAATVPT
A0A1F9WUH0      RFDRQLSEEELATLQTGKKVDEDIYQVLLKQMEAAYVSERLQDSDKAARLTVIEYARLPI
A0A1F9WWA6      ----------------------------TVESIKTELSGEYKSNN----VRIVDYAEVPK
A0A2N2EX59      ----------------------------IISSIKSELEGKLTVNN----IRVIDTAETPK
A0A1F9X688      ----------------------------IIASVKVELSGDLKANN----VRIIDPAEIPD
A0A1V5VJS3      ----------------------------IVESIKFELSGQLKTNN----VRIIDPAEVPQ
A0A3C1EPJ8      ----------------------------VVQSLKTELSGQLRGNN----VRIVDSATVPE
A0A2N2ESN1      ----------------------------IIQSLKIDLSGQLMGNN----IRLVDAAMPPL
A0A1F9QNS6      ----------------------------VIQSLKIDLSGQLMGNN----IRLIDAAMPPL
A0A1F9XM68      ----------------------------IIQSLKIDLSGQLMGNN----IRLIDPAAPVP
A0A3C1EME8      ----------------------------IVRSLKTDLSGQLQGNN----VRVVDPARLPD
A0A1J4STN8      ----------------------------VIQSLKIDLSGQLMGNN----IRLIDAAMPPL
A0A3D1N2U3      ----------------------------VIQSLKIDLSGQLMGNN----IRLIDAAVPPL
A0A353CQL1      ----------------------------IIQSLKIDLSGQLMGNN----IRLIDAAIPPL
A0A1F9RGN6      ----------------------------IIQSLKIDLSGQLMGNN----IRLIDAAVPPL
A0A2M6Y4Q4      ----------------------------IIQSLKIDLSGQLMGNN----IRLIDAAMPPL
A0A351UI79      ----------------------------IIQSLKIDLSGQLMGNN----IRLIDAAMPPL
                                                    :.     .     : : : *    

A0A1F9RUT7      FPIRPRRLQNLLMGLLAGLVGGLVIAFVLEFAEDSVQNPDDVAQLLGAPLLGTVPVLQAV
A0A1F9WUH0      SPMKPIRGKVMFVGIFMGLLAGMGLVFTMEYLDRSFRTVEDAKSVLNLPVLGSISRLIAC
A0A1F9WWA6      NPVRPQRKRNIIIAFVLGLSLGAGLAFLVEYLDNTFKSGSDIEQYLDVPFLGIVPIVK--
A0A2N2EX59      KPILPNKRKNLMLGSFSGLALGILAAFLLEFLDNSIKTKDDIEHYLSVPFLGYIPRVA--
A0A1F9X688      EPVRPNKRLNISLGIFAGLLMGAGLALFFDYMDNTIKSEQDIEKYLNLALIGLIPKVK--
A0A1V5VJS3      NPIKPKKKLNILLAIIVGLLGGSGLAFFVDYTDNTIKTQQDIEQYLIIPFLGFIPKLT--
A0A3C1EPJ8      SPIKPTKRTNALLGLIGGLGLGLALAFLVEMIDQSVRTQEDIEEKLGQPFLGIIPQS---
A0A2N2ESN1      QPIKPRKLFNMLLSLMGGFVLGLFAAVLVEFIDQTIRSQEDVENKLGLPFLGVVPMTP--
A0A1F9QNS6      QPIKPRKMFNMLLALIGGLVLGLFGAALVEFIDQTVRTQEDVENKLGLPFLGIVPLTR--
A0A1F9XM68      TPIKPRKLFNMLLAFFGGLVLGLFAAMLVEIVDQTLRTQEDVEHKLKLPFLGIVPFTQ--
A0A3C1EME8      RPIRPKKLLVIIFGILGGAFLGAFAAVFIEFLDQTVRTQDDVEKRMKVPFLGTIPHCR--
A0A1J4STN8      SPIKPRKMFNMLLSVIGGLVLGLFAAVLVEFIDQTVRTQEDVENKLGLPFLGIVPLTR--
A0A3D1N2U3      GPIKPRKMFNMLLSLIGGLVLGLFAAVAVDFIDQTVRTQEDVENKLGLPFLGVVPFTR--
A0A353CQL1      KPIKPRKLFNMLLAVIGGFVLAIFAAVLVEFIDQTVRTQEDVENKLGLPFLGSVPLTR--
A0A1F9RGN6      KPIKPRKGFNMLLALIGGFVLGLFAAALVEFIDQTIRTQEDVENKLGLPFLGIVPLTR--
A0A2M6Y4Q4      GPIKPRKVFNMLLAAIGGLVLGFFAAVLVEFIDQTVRTQEDVENKLGLPFLGVVPLTP--
A0A351UI79      SPIKPRKKFNMLLAFIGGLVLGMFAAVIVEFIDQTVRTQEDVENKLGLPFLGVVPMTP--
                 *: * .     .. . *   .   .  .:  : :... .*    :  ..:* :.     

A0A1F9RUT7      SPS--------------------------------ALKDAPDKARHRLVETDGADTRAVE
A0A1F9WUH0      AGGAKTMRRRWGEMLRRYLQKHKMLSELRFISPHIAKKSFHSPVSEHAILYHEPKCAIAE
A0A1F9WWA6      -----------------------------------EKGENNM------FVLDGVKSPQGE
A0A2N2EX59      -----------------------------------DGFKNVIDLTK--DLDSRQHSHFAE
A0A1F9X688      -----------------------------------DKEK-KKYGGRSIFVLTQPKSPATE
A0A1V5VJS3      -----------------------------------AKNKNEKKGERKLFVVSNPHSPESE
A0A3C1EPJ8      -----------------------------------IIRNNTIIE----AMLAKELSLTSE
A0A2N2ESN1      -----------------------------------FSKKNTAYN----HLLLQEHSLIAE
A0A1F9QNS6      -----------------------------------QTKEATAYN----HLILQEHSLISE
A0A1F9XM68      -----------------------------------QSKSKTVYG----HMLLAEHSLTSE
A0A3C1EME8      -----------------------------------HKKHAKIFE----PLVSGDVSLTSE
A0A1J4STN8      -----------------------------------QNKEQTAYN----HLILQEHSLISE
A0A3D1N2U3      -----------------------------------QTKEQTAYH----HLLLPEHSLIGE
A0A353CQL1      -----------------------------------QTKTHTAYN----HLLLQEHSLISE
A0A1F9RGN6      -----------------------------------QIKDQSAYN----HLLLQEHSLISE
A0A2M6Y4Q4      -----------------------------------FGKKLTAYN----HLLLREHSLIAE
A0A351UI79      -----------------------------------FNKKQTAYN----HLLLQEHSLIAE
                                                                           *

A0A1F9RUT7      SLNLIGVALRSDSNGSLPRRILVTSATPQEGKSTIAANLAVTLARLGTRVLLVDTDLRHP
A0A1F9WUH0      EFRIVRTNIQHYSEQAALRKLMVTSSVHSEGKSTTSMNLAIALADSGKNTLLIDADLRRG
A0A1F9WWA6      AVKTIRTNLIFSAAEGKLKTILVTSCVPGEGKTFSSMNIAASFSQAGKKTLLVDTDLRRS
A0A2N2EX59      SLRNIRVSINFAG---EIRSLLVTSTMPGEGKTSFAVALAHILAHAENSVVLIDTDLRKP
A0A1F9X688      SVKSIRSNILFSAPKDNLKVILITSAGPEEGKTLTSTNLAVTFAQYGEKTLLIDMDLRRS
A0A1V5VJS3      SLKSIRSNVTLTLPDKKFKTLLITSAGPEEGKTIISSNLSVSFANMGERTLLVDCDLRRP
A0A3C1EPJ8      AFRNMRTMVDFAGIGGKAKTVLLTSTVQGEGKTYIASNLAVAWAQIGESVLLIDGDLRRP
A0A2N2ESN1      SIRNLRTMIDFAIVGQKSKSFMVTSTVQGEGKSYVCSNIAVAIAQAGEKVLLVDGDLRRS
A0A1F9QNS6      SIRNLRTMVDFAEVGRKNKALIVSSTVQGEGKSYVAANLAVAIAQAGEKVIVVDGDLRRS
A0A1F9XM68      AVRNLRTMVDFAEVSQKNKSFMITSAIQGEGKSYIGVNLAVAIAQAGEKVLIVDGDLRRS
A0A3C1EME8      AFRNLRTMIGYSGSTREDASFLVTSTVQSEGKSYVATGLGVVLAQLGQKVLIVDGDLRRP
A0A1J4STN8      SIRNLRTMVDFAEVGSKTKSLIVSSTVQGEGKSYVGGNLAAAIAQTGEKVLIVDGDLRRS
A0A3D1N2U3      SIRNLRTMVHFAEVGRKNKALIVSSTVQGEGKSYVAANLAVAIAQAGEKVLVMDGDLRRS
A0A353CQL1      SVRNLRTMVDFAEVGQKSKSFMITSSVQGEGKSYVGANLATAFAQAGERVLIVDGDLRRS
A0A1F9RGN6      SIRNLRTMVDFAEVGKKNKALIVTSTVQGEGKSYVAANLAVAVAQAGEKVLIVDGDLRRS
A0A2M6Y4Q4      SVRNLRTMVDFAEVSQKSKSLIITSSVQGEGKSYVCANLTVAVAQAGEKVLLVDGDLRRS
A0A351UI79      SVRNLRTMVDFAEVSQKSKSLIVTSSVQGEGKSYVCGNLAVAVAQAGEKVLLVDGDLRRS
                 .. :   :           .:::*    ***:     :    :     .:::* ***. 

A0A1F9RUT7      TLDRFFG--VRTPSDIGEAARRGTPLGEA---VRPTAVPGLSLLPVGRVTGSPLALIKSA
A0A1F9WUH0      MLHEHLS--VPQSPGLSTLLHGSMLMEAA---FARTEIRNLTLIPCGTRPVRPAELLGSR
A0A1F9WWA6      SLTKCMK--MDIGNGLSNYLIGEADCDNI---TRETEVKNLYFISSGLHSPDPAELLGSQ
A0A2N2EX59      KIQGIFD--IDTSPGLSGYLSGQAGLEKI---IHKTEIPNLAIIPAGVIPPNPSELLERD
A0A1F9X688      SLHKVFKIGDSNRKGMSNCLIGEERIEDV---IQKTEIENLDIIFAGPHPPNPAELLNPN
A0A1V5VJS3      AVSKVFQ--KLHNRGMGDYLTEEAGIDDI---VHKTDIENFSVIFAGKHKHGHREILHPL
A0A3C1EPJ8      KIHKAFH--LSAEKGLSDFLVSGRHTEDVANLVQQCVVPGLSLLPCGQRPPNPSELLNTP
A0A2N2ESN1      NLHKNFR--VSNTRGLSEFLAGGKHTDDLKHLIQPTDVENLSILTCGPRPPNPAELLNTP
A0A1F9QNS6      NLHKLFR--VSNAKGLSDFLAGGRNIEDLRPLIQATDVPNLSILTCGPRPPNPAELLNTP
A0A1F9XM68      TLHRVFR--VSNAGGLSNFLAAGRNVEDLSRLVQPTDVENLSLLTCGPRPPNPAELLNTP
A0A3C1EME8      RQHRHMG--SSAERGLSDYLSGA--VRDPAELLQETGIPALDVITCGPRPPNPAELLNTD
A0A1J4STN8      NLHKVFR--VSNAKGLSDFLGGGRSTEDLQPLIQPTDVKNLSILTCGPRPPNPAELLNTP
A0A3D1N2U3      NLHKLFG--VSNSKGLSDFLASGNNVEELRPHIQSSDVSNLSILTCGPRPPNPAELLNTP
A0A353CQL1      NLHKLFR--VSNSKGLSDYLAGGRNVEDVAPLIQETDVKGLSILTCGPRPPNPAELLNTP
A0A1F9RGN6      NLHKVFR--VSNAKGLSDFLATGKNSEDLRPLIQPTDVPGLFILTCGPRPPNPAELLNTP
A0A2M6Y4Q4      NIHKVFK--VSNAKGLSDFLAGGRSVEDLVPLIQATEVPNLCLLTCGPRPPNPAELLNTP
A0A351UI79      NMHKVFK--VSNAKGLSDFLAGGKNVEDIPPLIQATDIPNLSILTCGPRPPNPAELLNTP
                     :        .:.                    :  : .:  *        ::   

A0A1F9RUT7      YFSAQLDALAEEFDLILFDSPPITLVADSMALAPLTEGIVLVVRHGHGSQWRLRKMVGQL
A0A1F9WUH0      AMEQLLSKGAASFDVVIIDAPPVLNLPDASILSRLCDGVVLIVQAERTQREEALRAHGML
A0A1F9WWA6      RMKEFVAQVSAKFDRVIFDSAPVLPVSDTLNIANLMDGVVMVVYSGKLSRAMVNMGKQKL
A0A2N2EX59      TFGKLLKKLREQFRWVIFDSPPIFPVSDAVIISKLTEGTVFLINFGKTKKEPAKEGKEKL
A0A1F9X688      KIKEYFLKLRNMYDRIILDSPPVMPVSDSINLSSMADGVIQVVRYGKLSRQVVMRSKGML
A0A1V5VJS3      KIKKFIEEVKTKYDVVVFDSPPVMSVNDSMNIAICVDGIVQVIRYGKLNRKLVERCTQVL
A0A3C1EPJ8      RLGAMIAWAQEHYDRVVVDSTPMFPINDTLLWGRHIPSSIFVVRYGETRTPLIRSACQKL
A0A2N2ESN1      RLSAFLAWAGEYYDRVIIDCPPMFPISDALLWGKYINSVVYVTSFGKTRVPIIKNGAKRL
A0A1F9QNS6      RLSAFLAWAGEDYDRVIIDCPPMFPISDALLWGKYISNCVFVAAFGKTRVPLIKTATKRL
A0A1F9XM68      RLSAFLSWAGAQYDRIIIDCPPIFPISDALLWGKYVNSVVFVSKFGKTRVPLIKTAIKQL
A0A3C1EME8      KLEALAAWARQRYARVVIDCTPVFPISDAMLWGRVVKSAVFVVRFGRTRLPLIQTAIRRL
A0A1J4STN8      RLSAFLTWATTEYDRVIIDCPPMFPISDALLWGKYIKNCVFVAAFGKTRVPLIKTAVKRL
A0A3D1N2U3      RLSAALAWAQQAYDRVIVDCPPMFPISDALLWGKHINSCIFVAAFGKTRVPLIKTAAKRM
A0A353CQL1      RLSAFLNWASTEYDRLIIDCPPMFPISDALLWGKYIKGCVFVTAFGKTRVPLIKNAARRL
A0A1F9RGN6      RLSAFLAWAGEDYDRVIVDCPPMFPISDVLLWGKYISNCIFVTAFGKTRVPIIRTAVKRI
A0A2M6Y4Q4      RLSAFLSWAQQSYDRVIIDCPPMFPISDALLWGKYIPSVMYVVNFGRTRVPLIKNAIKRL
A0A351UI79      RLSAFLSWAQQTYDRVIIDCPPMFPISDALLWGKYIPSAMYVINFGKTRVPLIKNAVKRL
                 :          :  ::.*..*:  : *    .    . : :                 :

A0A1F9RUT7      DRIRVPVLGFVYDG---------YTPRDDKHYSYYY---------------GAPRKRTSR
A0A1F9WUH0      AQARANIIGFVLTNVQY------YIPK--YLYDYYY---------------GR-------
A0A1F9WWA6      QGVKAKVVGALLNYVNVKARGYHGYSYYSYSYNEYY------------------------
A0A2N2EX59      EKVGAKIIGAVINNIDIEKHKYYY---PYYSYYHYY---------------GGGEKGEYS
A0A1F9X688      ADVGAKYIGVILN-----NIDIESGGHYYYPYQYYYY----Y---------GNDKK----
A0A1V5VJS3      SDTGTKIIGAVLN-----GVDTESRGHYYYYYYYNYYGKYGY---------GNIKSDKER
A0A3C1EPJ8      ITSSIKPLGVAINAAKAGGLSYASYGYYYQQYYQQY--------------------HQES
A0A2N2ESN1      QTAGLKILGSVVNMSKFGGLSYSYYGYYQYKYNYHY---------------GYAPDEKDT
A0A1F9QNS6      LNAGIKVLGTVVNMSKFGGLSYSYYG--YYQYNYNY---------------GPDAPEGEK
A0A1F9XM68      NSSGIKVLGVVVNMSKFGGLTYSYYGSHYYKYNYHY---------------GAEDSEKSE
A0A3C1EME8      EGGGLKVLGGVINGARLSTMSYADGR-YYEQYYRDY--------------------TDTE
A0A1J4STN8      ATSGIKILGAVVNMSKFGGLSYSYYG-Y-YQYNYNY---------------GPDADAQGG
A0A3D1N2U3      TAAGLKILGTVVNMSKFGGLSYSYYG-Y-YQYDYHY---------------GPDKPETEK
A0A353CQL1      TQAGIKVLGNVVNMAKFGGLSYSYYG-YSYQYNYHY---------------GPDAEE---
A0A1F9RGN6      ISSGIKVLGSVVNMSKFGGLSYSYYG-Y-YQYNYNY---------------GPDAVDGEK
A0A2M6Y4Q4      TGSKIKILGAVVNMSKFGGLSYSYYG-Y-YQYKYNYNYNYAYAPDDDQPSDGPEPKD--K
A0A351UI79      TSSNIKILGAVVNMSKFGGLSYSYYG-Y-YQYKYNYNYNYAYAPDEPAEGESPVDKDKQK
                       :*                      *   *                        

A0A1F9RUT7      GRAGNQTVGRGS-----------
A0A1F9WUH0      -----------------------
A0A1F9WWA6      -----------------------
A0A2N2EX59      K----------------------
A0A1F9X688      -----------------------
A0A1V5VJS3      DSTMSKPAVSQKA----------
A0A3C1EPJ8      ELSKKST----------------
A0A2N2ESN1      PETPPVADSKKKPQKELV-----
A0A1F9QNS6      KHHHKVPALKS------------
A0A1F9XM68      SSTRKSPSAKA------------
A0A3C1EME8      PPQSRKS----------------
A0A1J4STN8      EKTRRRKKADLKPEPAQTTVSGK
A0A3D1N2U3      HQEPRHK----KPTPKKELV---
A0A353CQL1      --KTKKA-------PVKA-----
A0A1F9RGN6      GHTRKRT-------PVKA-----
A0A2M6Y4Q4      DHHAKKT-------AKKELV---
A0A351UI79      DHHSKKS-------SKKELV---
                                       

© 1998-2019