BYKdb

Dataset for cluster orphancd of phylum environmental-samples

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K1ZAW7          ------------------------------------------------------------
K1YLM0          MPVASSILTIFGDGWQEFIDPIDVFKEIEHSKQNKMKISEALEKAGYGED-----LEKRA
X2LJV2          -----------------MSRLFEASQRAVTDTEADPGVSATAPIAGAGDATQVFPLERRL
A0A1L5KMJ5      ----------MEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQ
W0NTY4          ----------------MVEQSKRFRRGMRQRPAKAPEEAPVDPPVEASVEV---------
K1YRR9          ------------------------------------------------------------
W0FPE0          ------------------------------------------------------------
                                                                            

K1ZAW7          -KDAPKDNIFDKQKVQPSK-----------------------------------------
K1YLM0          EEGPEKEFDHDRIVVSQTRAGQEEHSANNNSVQKSI------------------------
X2LJV2          RPSPTESSALARV---PTHAGVALPAPPPVGAQKEI------------------------
A0A1L5KMJ5      ELSISKSSAIGNVRIIDPAVTQPQPV-KPKKALNVVLGFILGLFISVGAVLARAMLRRGV
W0NTY4          PADVTETAPVQRRGLLSGSGRSAEEIAREDRALRSAFPF-LDLDDVEAESPERAEEVAPV
K1YRR9          ------------------------------------------------------------
W0FPE0          ------------------------------------------------------------
                                                                            

K1ZAW7          ----------------------------------------------------------PA
K1YLM0          ----------------------------------------------------------S-
X2LJV2          ----------------------------------------------------------AI
A0A1L5KMJ5      EAPEQL----------------------EEHGISVYATIPMSEWLDKRTRLRKKNLFSNQ
W0NTY4          AAPEPLILNPESEVMPEPEAEQPSEQPPEDDGWNDLGPMPV-----QRQQMMRNLIITAS
K1YRR9          ------------------------------------------------------------
W0FPE0          ----------------------------------------------------------MA
                                                                            

K1ZAW7          PKDIALDDRLVSYFDPSSMVAEQFKRLRTYVIKP-GTENSP-KTILVTSTMEGEGKSMIA
K1YLM0          ---GKWDERLFKAVNDSSYVPEIFKTLRSRILHP-LSGEAIPKTILITSAIPREGKSFVA
X2LJV2          ASDGPGALKLVTAGLEQASFNE-YRQLAATLLQT-NADKPV-LVVAVTSALPGEGKTLTS
A0A1L5KMJ5      QRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFA-MMETEN-NILMITGATPDSGKTFVS
W0NTY4          RK------------NPVHAAFD---VLRARLVQA-LSDNGW-RRVAITSPTRDCGKTFVS
K1YRR9          -----------------------------------SSAEQPPKTILVTSMDAKEGKTSTT
W0FPE0          KKRKTTDGFDHIGNLLNFSGKEAYNLLRTNLMFSIRKEEDRARIVGVTSSIHGEGKSLTA
                                                            : :*.     **:  :

K1ZAW7          INLAITIAVDLNSNALIVDCDLRNPSLSRWFGFREQRGLSNYLLGEAQLPELLV---KTS
K1YLM0          ANLGISLAHGLDQHSLLVDCDLRKPAMAKMFGLDNSPGLVDYLRDGVALSKLIQ---KTP
X2LJV2          ANLALILADAYRRRVLLVDGDMRRPTLHTLFGAANSLGLGDCLKA----AHLVP---GST
A0A1L5KMJ5      STLAAVIAQSDQ-KVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGG
W0NTY4          VNLAVALSRYENCRTVLMDMDMRNPSVAKTLGLRDVGSMGAYLRGEIETRDQFFKFDQND
K1YRR9          INIARVLSQGGK-KVLIIDCDLRRPRVHAVFAMQNDRGLSNFLTG-NLQENIIH-----K
W0FPE0          INTAYSLAENGY-KVLIIDCDMRLPTLDKKLGLKKSAGLSNILAGMDTDDDILF-----K
                 . .  ::     . :::* *:*       :   .  .:   *         .       

K1ZAW7          VD---KLTILPGGTVRDNPVELIGSKKMKSLVADLKMRYDDRYIILDSSPLLATTEPRVL
K1YLM0          IA---ALSVLTSGIPPENPAELLGSSKMSALVEELSSRYDDRIIIFDSPPMLVAAEASVL
X2LJV2          VEIGRGLTLLPAGRPDRDPVGQLSSPRFKEFLDHASKTFD--CIVFDTPPAVLLPDAELI
A0A1L5KMJ5      FD------VITRGQVPPNPSELLMRDRMRQLLEWAND--HYDLVIVDTPPMLAVSDAAVV
W0NTY4          MSLGDNLAIAMNDRVEPFASELMQQPATRDRLTRMEAELHPDVVLFDLPPALANDDVIAF
K1YRR9          -IPGEEIYVISSGTIPPNPSELVSSRKLKTLVEKMAEDFD--FVLLDSPPIQSVTDSLAL
W0FPE0          DVIVKGLNVVQAGDIPPNPSELLGSAQFKSLIENLGGYYD--FIILDLPPVGEVSDALVA
                        :   .     .   :        :           ::.* .*     :    

K1ZAW7          SDMADGILFVIKSADTPRESVQQALKLIDK--KCIIGVVLNQVEFKTEALIRRYFGTDR-
K1YLM0          AGQVDAMVLVVRQSTSGKAQIQKLIDIVGT--ERILGIVFNDQKTNLLQKRIIKGYASN-
X2LJV2          ASAVHTVLLVVQAAKTPYQDVQRAVAALGR--ERIAGVVLNRVAQD---TRRASGYHQY-
A0A1L5KMJ5      GRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKR---ASTAYSYGYN-
W0NTY4          KSNFDGVLIVIDGTRTSGAEVREVMRRLGE-DVPLLGVVLNKAEDA---TGDEYGY----
K1YRR9          TQIVDGTVVVIRVGVTTYEMLQSGLKKLKDVQCHLLGCVLNGQRKNNSSGSYYYGYTTY-
W0FPE0          SKRVDGMVVVVRQDYTNQADLAYTMRQLELVNAKVIGFVCN----YASGKDHKYGYGKYG
                       :.*     .    :   :  :      : * : *                   

K1ZAW7          -YSDYRYSAKQSEPSSSRQSASRTRIRK
K1YLM0          -HGAYYE---------------------
X2LJV2          -YAGFHDASEP-----------------
A0A1L5KMJ5      -YYGYSYSEKE-----------------
W0NTY4          ----------------------------
K1YRR9          ------YAKDSEG---------------
W0FPE0          KYKKYKYAQKPAK---------------
                                            

© 1998-2019