BYKdb

Dataset for cluster tadcd of phylum environmental-samples

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K2E015          MMDSNTTRQHQLSHSG-------------------EYEIDLRALLNLLKHSYKLILLIVS
A0A1S5Y018      MSFEQND----------------------------GPEFSLRDVMDTLRRRKWVIIQAFV
K2AZG2          MNETNSGNQPASTALLFFP----------------HDGVDIRKILMELYHYKWIILAVSM
K2AGP2          MNRVDLEKNQQSS--FFLP----------------EDALDFKKIATKLYQNIWIVLGVSF
K2BAV7          MNNQNSELRNIIS--LSNL----------------EGTIDIHKILRDLYHYKLIILLVSF
A0A0B4R738      MAEHKSDHHLPAVAEAFPVTPYIPLAAPAADAEGEEGAVPLTHYLWLLKRHRWKMLAFVA
K1XX15          -------------MKNYPVQERLV-------EEEVEQEVNLREYFFIIQKRKFIVLSILT
                                                      . :      : .    ::    

K2E015          LFLCAGIYYASTRSPVYRSTALMEVKSANMSSVLGIMSADHFGRASSSA-DIETTLLSTP
A0A1S5Y018      FVSIIGAVTAVLSPPVYSTGARLLVETP----------------------ETRAILISS-
K2AZG2          TSFFIAFLYTFTIQPTYQTTALLQVHPQ--SANAGVLSKLGYKSSADSALETQQALIRTR
K2AGP2          STAFIAFLQTFSYVPMYQTSALLQVKKS--SNSS-IFSKLSMNANGDSALETQEALIRTR
K2BAV7          CTTLIAFLYTFTIQPQYKTSALIQLNPQ--SGNS-IVNSLGLRTSQSSITETELALIRTR
A0A0B4R738      ATVAATVIVSSRLTPVYESTATVDVDRQTPTGVIGQEATRSVTNDADQFLATQVKLIQSD
K1XX15          IVFLLTIITTFSKVPIYTSSAEVLIERN--RGASGLENTYYSNYDPE-FLATQSAIITSL
                         :    * * : * : :                              :: : 

K2E015          YILGDVVRQFGFDISVSPHYFGFFEKRRIEHTGQVPRAK----------------IDVLS
A0A1S5Y018      -----------------------------------GDTSPLYRMRSKQNVETQLEVLRSG
K2AZG2          YILEPVIIQTGLNISVTPHYYPLFGAWMARHHSGDSLARPLFRLKSYAWGGEKIEVSQFT
K2AGP2          YILEPVIAENGLNISASPQYFPLIGSRIARMHSSEKLAKPFLGLKQYAWGGEKLLIQKLT
K2BAV7          YILEPVIRENNLNIKISADYFPVFGEWMARHYQDSGLAKPFLGLKSYAWGGEKVQIKYFT
A0A0B4R738      SVLRPVVE------------------------------------RYGLR-----------
K1XX15          KVARRVVDSQKLATTYRKYFI-----------KDAEESSFLASLKTGIKTGVKDFLGKMT
                                                                            

K2E015          VPNILLGKKLRLVIKTATQYDLFSPDNNKILSGVVGQLMQSTYLGEPVKIQVGQLQGLLG
A0A1S5Y018      LFRERLNKV----------------------------------------MPRSEAAIPPQ
K2AZG2          VPEEYVGQTFKLIAGKNNSYQLFSPEGELLLTGKAGELSTSAKT-NALTLKLGKFQANPG
K2AGP2          PANTTASQNFRLVVREKNTFDFYSADGKFILKGKLGELLTG----PGIQLKIDEMKARPG
K2BAV7          VPSEYEGQNFQLIVGKNDTYQLYLPEKNLVLTGRVGERAVSHSY-PGVALFLTTLKAHPG
A0A0B4R738      ------GRD-------------------------------------------GEVEESGG
K1XX15          GIMKSPAPD-------------------------------------------GDVPDDAA
                                                                            

K2E015          AQLTVVKQPVLNVASSLSDSLTIQSK---------GTTGVLELAYDSSTPEQAQKILNAV
A0A1S5Y018      LTFAAQ-----------------------------EKTNIIAIAAEGTNPKACAVWANTA
K2AZG2          TQFSISYKAPIYLVNSLANNLRITDVYGNDPA---QNTGIFQLTLTDSDPARVVKLLNGI
K2AGP2          NVFFIHYSSPVNFTSSLSRKINIIDVAGNDPT---QSTGLFELLLTDSDPQRAMNILNQI
K2BAV7          TDFVLSNQSPTQMVNQLSRQLHLKKVESDTSSELNQDTGIIQLQLVGSDPEQIKHILNAI
A0A0B4R738      LA-----EERAAEAPVMLKRLKVTRP---------PNTYLLLISYRSSEPRLAAQVANGI
K1XX15          LIVSEPLTDEDIIAGMIKGNLAVVPS---------KDSKIVRITSSHESPVMAKLVADAV
                                                     : :. :      *       :  

K2E015          LFTALRRDQEQKALEANHMLQFLDTQLPILQSQLDATQDKISKYGVKTGIFNIRSTEQML
A0A1S5Y018      AKEYIKLTSETNSGNLTSTIRQYTRLQGIAKRELDVAEQALLLYQQTHQLSSDPNAQNMV
K2AZG2          AHYTVIKNRQQNAEEAQETLEFLNRRLPELRNKLASAEDAVNQYHIQNNTLSMSMISQLL
K2AGP2          ANYVVLKNREQSVKEAKNTLDFLQQRLAEIKAKLGSTENNINRYHSDNETLSIPMTNQLI
K2BAV7          VNYSIEKNIQLKSREAQKTLDFLHQRLPDFKKGLERVENALNQYHARSGTLSMSITSQLL
A0A0B4R738      AQSYLEHTYHIRYRSSLGLSSFMEKQLDELKAKMERSSGALMAFERELNVINPEEKTSIL
K1XX15          TKAYVDEILDMKLTTSRYALQWMTAKADEERKKLENSEKAMQQYMRENDLVTVENKLTIA
                    :                         .  :   .  :  :       .      : 

K2E015          TANLMNLHQSLQKMDAEK------------------------------------------
A0A1S5Y018      REAAIKAQAEATKIKGDLASMETRIKVLNARLSKAPPLVTETKQINNPEMESFRNRIATL
K2AZG2          LHQLTTLEQAIDKLKTER------------------------------------------
K2AGP2          INKLLRSEMDLEKLKLQK------------------------------------------
K2BAV7          IQELNNVIISLDKLKAQK------------------------------------------
A0A0B4R738      SSRLLQLNTEYTSAQADR-----VRKEAAAASVKGGTLAAAQVSSQGESLRKLTERRDET
K1XX15          PQKMSGFSTQLSKAQTDRKALEDLSKQIAAAGSNIHLLENIPVFAENGVLKSLRETIFKA
                            . . :                                           

K2E015          ----IALLENFTSRHPLVIA----------------------------------------
A0A1S5Y018      KAERAVKLGTFTPESDEIKAIDEEIASLESEKAKVNPFVLETYEKPNPDIDAWKIELAKL
K2AZG2          ----EELLQLYMPEHPQVLA----------------------------------------
K2AGP2          ----DALLQLYTTEHPNVIA----------------------------------------
K2BAV7          ----KEILQIYTPLYPQVIA----------------------------------------
A0A0B4R738      QERFAEVKTHYGAGHPEYRKAAAQLGEVERLLEETRSNI-----------------GQRV
K1XX15          RQNIAELSKKYGEKHPMMIKANDELSQLISQQQSEVNRV-----------------IATT
                          :                                                 

K2E015          ------ENEQELQLKNQIADTQAMLNKIPFTAEKETDLLRDLTIQEKLYFNMLGSIQKMQ
A0A1S5Y018      ELDRDALSSLQSTLAPVADIQVQHVEQFAPGQVELNRLKRRLDNAEKDYLNYSERLRSLS
K2AZG2          ------NISKEDALQKRIDELKGEIRKFPLINQEEINLVREAKIKNSMYLYLLNSEQQLE
K2AGP2          ------NENKINSLQKRMLELKEKVKKLPFINQQEINLQRDAKITVSAYLYLLNQQQQLE
K2BAV7          ------VEQQQKELEEKLQEIKKQITNFPAARQEEINLERDVKIKTKMYESLLSNLHQLE
A0A0B4R738      EIEYRQSAERERMLARAVGETKAEFDRLNARSFEYQALKREAEADKQLYEELVRKIKEAG
K1XX15          KNSYELAKSQEESLQQMLDSSKNELLNLNEKFIQYSIMKRDVDANRVVYEALTANIKKEG
                        .    *          . .:     :   : *        *       ..  

K2E015          MMK-AGIISTVRILDQASYPTAPIAAKTISIVFASIVFGLIAGVSVVFIRHVLSPVIEDP
A0A1S5Y018      TGLIENVNASAQMLEEAGVPGAPIRPHKAQQVALSMVMGLMLGVGFAFLQEFLDDRVNTS
K2AZG2          IAK-AGLSSDVIVLSDAIPAGK-IPSHKMMIIFMGFFMGAFLSIAVLLLKNALNKTIEDS
K2AGP2          ITE-AGLSSNVAILSDAIPAFQ-LPSHKFFTVIAGFLLGLFSSVVFIIIRDILKKIVESS
K2BAV7          IVK-AGLVGDIIALDNATPSVK-ESSNKLSIILVGFFIGLWLSTIMIIIKSVLTKTIEDS
A0A0B4R738      INA-SFQNSSIRIADAARPALKPVFPNLKLNVLLALLLSTLAAVGAAVVSDVLDNTVRDP
K1XX15          VTE-QSQSVNVWVIRNAFLPDAPSKPNKKRNLMLGLILGLMGGIGCAFLIEYLDNTVKSE
                                *  .     .:    :  .:.:.   .    .:   *   :   

K2E015          DVVERALGIPVSAIVPYSKKQVEHNKLAVRSPNYLSAN---PHLLALKDPKDIS--IEGL
A0A1S5Y018      DDVERITSLPVLGVVPTIPDDNNRLLIGQ---------------------DAFSPITESY
K2AZG2          EQIEDAIKLPVQCVLPFSRKQKRLEKAHKKGMNTFGTGLSAPLILAKQEPDDIT--IESL
K2AGP2          EQVENEFKIPVQVVLPFSRKQKQMEKLQSEGQRTLGTALSTQLILAKQEPNDIT--IESL
K2BAV7          DKLENELQIPVKAIVPFSNKQKQLEKISTKGVDVPDDMPRLPLILAQHDPKDIS--VESL
A0A0B4R738      EQVARLLRTEVIGSLPVVKNWRGRLGPVATNGNGNGNGHGMALAPVEAAAHTLTGYDEAI
K1XX15          KDLEARYGLTVLGSVELVKEKGASIESFIIQ-------------------KPLSPLAESY
                . :       *   :    .                                ::   *. 

K2E015          RSLRTAIQMLLLDAADNVIAITGCSPSVGKSFISSNLAVLLSDLNKRVLIIDSDIRLGKL
A0A1S5Y018      RSLRTAVQYSTVDRKVQFVGVSSAHPGEGKSVTSANLGIAMALQGKRVILIDADLRRPSV
K2AZG2          RSLRISLNMLSPSAHHQAIALMGSLPGIGKSFVSLNLSQVIADSGKRTLLIDGDIRKGLL
K2AGP2          RSLRVSLHVMSQHGSH-VIAIMGSLSNIGKSFVSLNLTQIFADAKKKTILVDCDVRKGRL
K2BAV7          QSLRISLYITHSSTHH-VIAIMGSLSGIGKSFVSLNLAQVLADSGKRTLLIDADIRKGRL
A0A0B4R738      RTLRNSILLTDFDRRLRSVLVTSASPGEGKSTIAAHLAVAHAEQGHKTLLIDGDLRRPSV
K1XX15          RLIRTGLLLSAAEHPPRSILITSMGPQEGKTSTTINVARVLSQGNKKVLIIDCDLRRPRV
                . :* .:           : : .  .  **:  : ::    :   :..:::* *:*   :

K2E015          HHAFGKTKSPGLSTFLQGEANLEQIIQTMI-PGRLDIITAGVYPANPSELLSLKSLGDLI
A0A1S5Y018      HRMFRIEAEPGLTSVLAGEVSLEDALHSTT-IEGFFVLPSGPLPPNPPELLNSQAMMDLL
K2AZG2          HRALNQPKSNGLSEYLEGKCQYEELARHIN--ENLFYIPCGNHTAHPIQLFQSNRFQELI
K2AGP2          HTALNQNKSKGLGEYLENKYSYDEIIRPIS--DQFYFISCGIPDSHPIQLFQSERFKDLI
K2BAV7          HRAFFQAKNGGLSEYLAGDITFEDSIRHIH--DNLFFIPCGNHLRHPIELLKSSRVNDLI
A0A0B4R738      HRRFEIPSVLGLSNVLVAELPWRDALVRLERLPELDILPAGPPSRRASDLV-GRGLEQVL
K1XX15          HSIFAMQNDKGLSNFLTGNT--QENIICKIPGEDIFVVPSGTIPPNPSELLSSRKLKTFV
                *  :      **   *  .    :          :  :..*    .. :*.    .  .:

K2E015          STLKVAYDLVIIDTPPVLAVTDPALILRHSSTNFIVIGVGKNHIKEVQHAKSMLEKGGVK
A0A1S5Y018      QLLKEHADVVIFDTPPTVPVTDAQVLGTHLDGMVLVVEAGQARKAAVKHARELLNQTHTR
K2AZG2          KKTKQDFDQVIIDTPPILPVIDSVLISKYCEIKLFVVSAGKDTIGDVKLAVKKARACHIE
K2AGP2          QKLKQDFEQIILDTPPVIPVTDSIIIAQYCDVKLFVIGAGRDTIDDVKQAIKKVQSHQIQ
K2BAV7          QRARSEFDQVIVDTSPILPVIDAILITQYCDTKLFVVGGSSDQFDEVKQAVKKAQAHGIN
A0A0B4R738      GEASFQYDLIILDAPPLLGFAEPLQMATAVDGVVVVTRAGETSRKAVASVLATLGRLRAT
K1XX15          EKMVENFDFVLIDSPPIQSVTDSLALTRVVDGTIVVVRAGKTTYEMLQSGLKKLRDVQCP
                       : ::.*:.*   . :.  :    .  ..*   .      :             

K2E015          LTGMIFNHTK---QHKAGFGYQYGYGKYSYYYAYDK------------------------
A0A1S5Y018      LLGVVLNKID---QSSKGYYHYYYYRSGYGKYGYRKRGYGYGGYGRGYGYGYGYGYGPEG
K2AZG2          INGIVLNHSKPL-KNAARYEYRYTYGDVNTSSATT-------------------------
K2AGP2          VDGFVLNHRKSLVPYGSRYYQRYGYGDSKTMTSL--------------------------
K2BAV7          IDGFVFNHCKPIARYGAKKYAYYRYGT---------------------------------
A0A0B4R738      VVGLVLNEVHK--EMSDSYYYYGHYGKYYRTPSNA-------------------------
K1XX15          LLGCVLNGQKR--SHTSGSYYYG-YTTYYAKDGEA-------------------------
                : * ::*                 *                                   

K2E015          ----------------------------------------------------
A0A1S5Y018      YGPEGSYGGGYGGYGYGRKGRKLGVGPETEETANVGAEQDQPKLPERLRDWE
K2AZG2          ----------------------------------------------------
K2AGP2          ----------------------------------------------------
K2BAV7          ----------------------------------------------------
A0A0B4R738      ----------------------------------------------------
K1XX15          ----------------------------------------------------
                                                                    

© 1998-2019