BYKdb

Dataset for cluster orphancd of phylum fibrobacteres

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1J5EXB2      ------------------------------------------------------------
A0A0J7HUK3      -MSFRKDKKDSVP--------WDHYLHLFLRNIWFILPVSLTVLVLWIVVMGRMNMFTPE
A0A3C0PF94      MNSMQSRNVLPVPKVMGMDYYIPHYLNLIWRWKWYICIVTPVIFVAWAIGVIKFGNTRPA
                                                                            

A0A1J5EXB2      --MNDTIHFSVAFLMA----KQGQEFVLSQVDPLIAFRNLSEQLSVS-------------
A0A0J7HUK3      MQARAVLRFDDPQALSGV--DERVSYESESRASLVKSRSFLEQIAAKHSLQLMTSRVQRE
A0A3C0PF94      LESSAVLQFMQSSGTTGPIDNETMLVQKSSCDAFIHSRSFIENISDKLSLRLSVKKYFRS
                     .:.*  .   :    .:      ..  .::  *.: *::: .             

A0A1J5EXB2      ------------------------------------------------------------
A0A0J7HUK3      DVFDSVWVGPDAPRGSYSLRIHNNMYRLVYSNKEQGIDNRVVQRGKLSSLGTTEFPGVYL
A0A3C0PF94      EIFDSISIDKDAAVGKYDFVVGNDGYSIYYSNKKLRINKKIVISGRLIELSSFFLPSILL
                                                                            

A0A1J5EXB2      -------------------------------------EKGKKTGILQMTYANRYPDRAAS
A0A0J7HUK3      SFSPSFKEEPFEVNFSVIRLRDAVDFILNNLEVR---QSEPLGTILSITLSGRDYPLITQ
A0A3C0PF94      KLTNDFVSEPHSFTFFISTQRQAVDNVLKYLSTKFPGSGERDNSIMAITLQEHDYPLGTQ
                                                     .      *: :*   .     :.

A0A1J5EXB2      ILNTIANAYVRQNVAMLSAEAEKTLLFLEGQLPALRMKLDSSEKALTEYRHSVGTVDLTG
A0A0J7HUK3      VLNSIVEDFVHNKSNLRYSRTEEIISILQEQLSVAETEMRKAESELRAFRNANPSVGLPD
A0A3C0PF94      VVNEIADEFVQHNSEQRLNTKNENVEVLEKQLQEARNNLAGADNALRQFREVNSNVGVTN
                ::* *.: :*.::        :: : .*: **     ::  ::. *  :*    .*.:..

A0A1J5EXB2      E--------------------------ARVVLEK--------------------------
A0A0J7HUK3      AMLPPSSIPDLIENE---AGYRSYVLQARSLRERYNHVSSNDI----IPMLNEMVAFIST
A0A3C0PF94      S--AASSVSELVTLENSVNSLKSSITEANVLQARCQIANSDDISDDKMTALNEAITYLAS
                                           *. :  .                          

A0A1J5EXB2      -----QVDLQQQLLTLARQKQEMTRLFKEDHPSVIAISEQEATLRKEMGK----------
A0A0J7HUK3      HRAPTAAGLQRELDYLTERERMFRQDYSPSHPHAIENRNRLRALGRKVNSALGTVISDFE
A0A3C0PF94      RQSVAAPALQSDFNEASADKKRVDAEYAPQHPRVIENRKKIARIAANISKALSDAVAKMR
                        ** ::   :  :. .   :  .** .*   :.   :  ::..          

A0A1J5EXB2      ------------VAISAKELPLTQQEVIKLQEDVNINNALYSSMLNNIQELRVVRAGEIG
A0A0J7HUK3      RRIAENQNRINNLNNDLAALPAKEIQLSNLQRQFEVNADIYSTILGRYKEARIASSIELG
A0A3C0PF94      ADAVGAVNRKDALTSENQRLPAQELRYSDLMRKRDNAEELFTNLLSRYNISKMSAASQSS
                            :  .   **  :    .*  . :    :::.:*.. :  .:  : : .

A0A1J5EXB2      NVRIVDYASHEIFPIKPRRKLIFAGI-LLGSLLLGAGFIFLLRMTMRGVRSSSEIERDTG
A0A0J7HUK3      DVSIIDHAVQPERKYNFRNLVLIFGAGLLLSMTAGFGPVMAVDHFDRKARTEKDLSRLTS
A0A3C0PF94      FVTIMDHAVVPNSPSRLQSMLRVLLIGLVIALVFGFGLPAGIDYLDKRARNEGDCRRFSA
                 * *:*:*       . .  : .    *: ::  * *    :    . .*.. :  * :.

A0A1J5EXB2      VSVYAKIPE----SEHDTGSRKKGSNVQTLMEADPDDFACEALRTLRTALDFSFLERGQK
A0A0J7HUK3      LLLLESVPVKGKWSGPGWRPENGEVDPKLVSADYSRNFVDETFRSLRAKVLLSLFDEKKK
A0A3C0PF94      LPFLEGIPKKND-SEKNNVSKKEKIDDKLVAAGFEPDTFDEMYRSLRTKILLHLHGEAHK
                : .   :*     *  .  . :   : : :      :   *  *:**: : : :    :*

A0A1J5EXB2      VLVITGLLPSVGKSFVSENLSVLFAGMKKNVLLIDADLRRG----RISHRNKKGLTDVLH
A0A0J7HUK3      RIVISSLNMSEGKSFTAANLAVTMAQQNIRTLLIDGDMRRGLQHESFGLSRKPGLSNILM
A0A3C0PF94      MLVVTSLNAGEGKSLTASNLAIVMAQQKLRTLLIDGDMRRGVQHNSFVLEKKPGLSEIIS
                 :*::.*  . ***:.: **:: :*  : ..****.*:***     :   .* **:::: 

A0A1J5EXB2      GHASLDEV-----IEKKNNGGISVLGAGSIPTNPSELLASDMFANIIAKVRENYDLIVID
A0A0J7HUK3      STEPLSSSLLKRKIRPSHISNLSLLPCGSSIPNSAELLNTQRFRDLLDLCSEQFDMLIMD
A0A3C0PF94      SPDELTTMPVSSFIQKAHIPDLSLLSCGMPIPNPAECMNSSKFRDLTAMLAEWFDVIVLD
                .   *        *   :  .:*:* .*   .*.:* : :. * ::     *.:*::::*

A0A1J5EXB2      TPPILLVTDAQLVCKYADFALMIVRYGAHNMEAIKEGMQLIDRSGIHNK--AIVLNRCQY
A0A0J7HUK3      TPPLSVTTDAVGVMDSFNKYLVVVRSAHTNISHLNK--KISEFPGLRKKILGIVFNGAPY
A0A3C0PF94      TPPLRVAVDAAILPEAFSHYIIVVRAVKTNIVALEK--KIVDFPGLYQKVLGIVLNGAPI
                ***: :..**  : .  .  :::**    *:  :::  :: : .*: :*  .**:* .  

A0A1J5EXB2      EGGRYGYGYGYGYRYHGKYGYKPSVNV
A0A0J7HUK3      -RRPEYYQYSS-YRY------------
A0A3C0PF94      DKKMHNYTYSY-YRH------------
                      * *.  **:            

© 1998-2019