BYKdb

Dataset for cluster tadcd of phylum fibrobacteres

[Download (right click)] [Edit] [Sequences] [Repertoires]

83 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3C0PHK7      MVRLENRTYDDQQCAYASGYHSGVERGFQMIGNNTTDSQLKGEI-GVKDYLNIMMRRKWI
A0A0J7HV92      -------------------------------MNGINETLISSRP-ALKDYLAIMMRRRLI
A0A1M6RVC1      -----------------------------------MASKKKEET-DLTELLKDVAKNWYI
A0A2N3RSN9      -----------------------------------MASKKKEET-DLTELLKDVAKNWYI
A0A1M5IPF7      -----------------------------------MASKKKEET-DLTELLKDVAKNWYI
A0A254RX70      -----------------------------------MASKKKEET-DLTELLKDVAKNWYI
A0A1M7GQ27      -----------------------------------MASAKKEET-DLWDLLKDLAKNWKI
A0A1X7JCK4      -----------------------------------MASAKKEET-DLWDLLKDLAKNWKI
A0A1M7HDE6      ----------------------------------MASSAKKEET-DLFDLLKDLAKNWQI
A0A2C9A7H2      ----------------------------------MASSAKKEET-DLFDLLKDLVKNWHI
A0A254SF58      ----------------------------------MAASSKKEET-DLFDLLKDLAKNWKI
A0A316ANB4      ----------------------------------MASTSKKEET-DILDLFKELLNNWKI
A0A1J5E847      ----------------------------------MASKNQDETN-ELAELASDLWKNRIA
A0A254RM08      -----------------------------------MATKKKEET-DLGEFLKELAKNWYI
A0A1M7CD42      -----------------------------------MATKKKEET-DLGEFLKELAKNWYI
A0A254SZB4      -----------------------------------MATKKKEET-DLGEFLKELAKNWYI
A0A1M5LBR0      -----------------------------------MATSKKEET-DLGEFLKILVKNWQI
A0A1M7DJN3      -----------------------------------MATSKKEET-DLGEFLKILVKNWQI
A0A1M6UFW9      -----------------------------------MATKKKEDT-DLGELLKELAKNWPI
A0A1M6I669      -----------------------------------MASAKKEET-DLFDLAKDLVKNWYI
A0A1M6WDT9      ----------------------------------MASPKKKEDI-DILDLIKTQLKNWYI
A0A254RG57      ----------------------------------MASSSKKEET-DLFDLLKNIAKNWQI
A0A254S791      ----------------------------------MASSSKKEET-DLFDLLKELAKNWKI
A0A285ZTW6      ----------------------------------MSASSKKEET-DLFDILKDLAKNWRI
A0A380S6W7      ----------------------------------MAASSKKEET-DLFDLLKDLAKNWKI
A0A1M6V3G7      ----------------------------------MAASSKKEET-DLFDLLKEFVKNWKI
A0A1N6J281      ----------------------------------MAASSKKEET-DLFDLLKEFVKNWKI
A0A285ZYD6      --------------------MAEKEEKKVVSQATIQLPPDNNTI-TLLEAMQILWEKKFT
A0A1M6S079      --------------------MDINEKNASANQTALPAQKGDDSI-DLLEVLGILWSKKFT
A0A1M6WR43      --------------------METNEQKATINLAGLLPQRAGDTI-TLIEAIGILWSKKFF
A0A2N3RVS2      --------------------METNEQKATINLAGLLPQRAGDTI-TLIEAIGILWSKKFF
A0A1M5VRV4      --------------------METNEQKATINLAGLLPQRAGDTI-TLIEAIGILWSKKFF
A0A254RLG7      --------------------METNEQKATINLAGLLPQRAGDTI-TLIEAIGILWSKKFF
A0A1M6SHG3      --------------------MMDLNSQNNVQNVTQVATAKDDEI-DLLEVLGILLKHKVF
A0A1M6WJF1      --------------------MEPNSQYSSSTSSSASHNKDDDEI-DLLEVLGILLKHKLF
A0A254RQS8      --------------------MEPNNQYNSTGSTSSAKHKDEDEI-DILEVLSLLLKHKLF
A0A1M6Z6I9      --------------------MELNNQYNSIGSTSSANHKDEDEI-DILEVLGLLLKHKLF
A0A254STU0      ------------------MKMELNNQYNSIGSTSSANHKDEDEI-DILEVLGLLLKHKLF
A0A1M5G181      --------------------MEPNNQYNSTGSTSSANHKDDDEI-DILEVLGLLLKHKFF
A0A1M6VYU0      --------------------MEPNNQYNSMGSSSPAKHKEDDEI-DILEVLGLLLKHKFF
A0A1M7DAK0      ----------------------MIIEKETKSNSSNSTHISGSAI-TMMEFLMLLWRKKFI
A0A254SNB3      ----------------------MAESEQQTIVVGAQQMQAENTI-TLLEALFILWKRRFL
A0A380RVE7      ----------------------MAESEQQTIVVGAQQMQAENTI-TLLEALFILWKRRFL
A0A1M5F234      ----------------------MADSEQQTIVVGAQAQTPNNTI-TLLEALFILWKRRYL
A0A1M6VST0      ----------------------MADSEQQTIVVGAQAQTPNNTI-TLLEALFILWKRRYL
A0A2C8Y654      --------------------------MDNKVPQGATAKPEDDEI-DILEILVFLKSKWKF
A0A1M5J685      --------------------------MDNNVSQNVAPKQEDDEI-DILEILMFLKTKWKF
A0A1M7JMJ6      --------------------------MDNNVSQNVAPKQEDDEI-DILEILMFLKTKWKF
A0A254S3F1      --------------------------MNEKMTQNMSNASADGEI-DILEIIVYLKSKWKF
A0A254SFQ7      --------------------------MNEKMTQNASNASADDEI-DILEILVYLKGKWKF
A0A380S7L2      --------------------------MNEKMTQNASNASADDEI-DILEILVYLKGKWKF
A0A1M7MCZ6      --------------------------MNEKMTQNVSNASADDEI-DILEILVYLKGKWKF
A0A1X7KIP6      --------------------------MNEKMTQNVSNASADDEI-DILEILVYLKGKWKF
A0A286A129      --------------------------MNEKMTQNVSSKSDDDEI-DILEILVYLKSKWKF
C9RRK0          --------------------------MNEKMTQNGSNASADDEI-DILEILVYLKGKWKF
A0A2M9A3A4      ------------------------MQQNNVNMDYAQQKNADDEI-DILELVGVLLAKWPI
A0A2P6UPN2      ------------------------MQTITNQDVANSTQKAEDEI-DLLELAGILIAKWPV
A0A1M6RBQ2      ----------------MKDSITAPVTPTTINLTGIQNIKPKGNF-SLVKAVDVLWKQRWL
A0A316BGL2      ----------------MKETVATPVTPTTINLTGIQNIKPNGSF-SLVKAIETLWKERWL
A0A1M6IQ57      ---------------------MEQNTQQTISVAAVAQPQSGNTI-TLLEALAILWKNKFR
A0A316ATY6      ---------------------MDSNDQKNSVNQASEPLKTDDSI-DLLEVIGILWAKKHI
A0A1T4QDW5      -----------------------MAENENTMNAPVSAAPKDDEI-SILEVCGILWEKKFF
A0A1M6VSY0      -----------------------MAENENTMNAPVSAAPKDDEI-SILEVCGILWEKKFF
A0A2A3HHG6      -----------------------MAENENTMNAPVSAAPKDDEI-SILEVCGILWGKKFF
C9RP30          -------------------MSEKEEQKVISQPTAIQVPQNANTI-TLLEALEILWDKKFI
A0A1M5V3U1      -------------------MAEEVKNVQ----------TEVDSL-TVVDFVHHLWKKKFL
A0A1M7NG89      -------------------MNENTKKIS----------SLGNSL-TIVEFALLLWKKKFL
A0A2C8YXS0      -------------------MDENIKKIQ----------PLEGSI-TLLDVAQTLWNRRWV
A0A254RLK0      ----------------------MAENEQQTIVVGAQAQSANNTI-TLLEALFILWKKRFT
A0A1M6RGU5      ----------------------MAENEQQTIVVGAQAQSTNNTI-TLLEALFILWKKRFT
A0A254SQM8      ----------------------MAENEQQTIVVGAQAQSTNNTI-TLLEALFILWKKRFT
A0A316B5S0      -------------------MDLNSQNNLQSVNQVSVVPTKDDEI-DLLEVLGILLKHKVF
A0A254RXS0      -------------------MDNSQVNTKNGSNTGSA--KNDDEI-DLLEVLGILLKHKLF
A0A1M6X012      -------------------MDNSQVNTKNGSNTGSA--KNDDEI-DLLEVLGILLKHKLF
A0A1M5TLF1      -------------------MDNSQVNTKNGSNTGSA--KNDDEI-DLLEVLGILLKHKLF
A0A2N3RVJ9      -------------------MDNSQVNAKNGSNTGSA--KNDDEI-DLLEVLGILLKHKLF
A0A1M6R2N3      -------------------MTNTTENQMNQGPVTQGGINQNDVI-DVFELFGIFRRHWFI
A0A1N6GS15      -------------------MTNTPEKQMNQLPVSQGAIKPVDVI-DVFELFSIFRRHWLI
A0A254SB44      -------------------MTVTPNNK--QQNPQQPFFMQVNTG-DSFDLLGNILRHWKL
A0A1M7LKR0      -------------------MTITPNNK--QVNPQQPMFMSAKAS-DSFDLLDSILRHWKL
A0A1X7JP42      -------------------MTITPNNK--QVNPQQPMFMSAKAG-DSFDLLDSILRHWKL
A0A1M6UBQ0      -------------------MTVTPNNN--QPNTQLPFFMPIKAG-DSFDLFSNVLHHWKL
A0A1X7IS68      -------------------MINEVNQK--QNSQCSEHSKPVDAAQDILNLLNIIRHHWII
                                                                .        .  

A0A3C0PHK7      IIASLLSVAFSTFFYVSKIKDVYESFSTIVIEEKN---------I--AISQATNTMNTGG
A0A0J7HV92      IFFAFISVAASTYFYVDSIEDVFEAYSTVVIEDQG------------VSVNPL--MQTNV
A0A1M6RVC1      MLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKN--SKN-----SMGMMGGLGALFSNA
A0A2N3RSN9      MLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKN--SKN-----SMGMMGGLGALFSNA
A0A1M5IPF7      MLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKN--SKN-----SMGMMGGLGALFSNA
A0A254RX70      MLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKN--SKN-----SMGMMGGLGALFSNA
A0A1M7GQ27      MVPCIFVAGIIGVFIAFWIRPVYKVDALLQIESKS--NK------SVGMMGGLPSLFASS
A0A1X7JCK4      MVPCIFVAGIIGVFIAFWIRPVYKVDALLQIESKS--NK------SVGMMGGLPSLFASS
A0A1M7HDE6      MLPCLILSGVVGVFVAMWIRPIYQVDALLQIESKN--NKG----MASAMMGSLGSLFASS
A0A2C9A7H2      MLPCLILSGFIGIILAMWIRPIYQVDALLQIESKS--NKG----MTGAMMGGLGSLFASS
A0A254SF58      MIPCLIVSAIIGVFVAMWIRPIYQVDALLQIESKN--NK------SMGMTGGLSSLFATT
A0A316ANB4      MIPCIFLAGVVGVIVAMWIRPIYQVDALLQIENKN--SKG----PAASMMGGLASLFASA
A0A1J5E847      VCLFLLLSGIIGVFAAYWIRPVYEVNALLQVETKG--KGA----NASAMMGDLGSLFATG
A0A254RM08      MVPCILLAGAVGAFVAQWIRPVYQVDALLQIEAKS--NKS----A--GLVGGLGNLFATN
A0A1M7CD42      MVPCILLAGAVGAFVAQWIRPVFQVDALLQIEAKN--NKS----A--GLVGGLGNLFATN
A0A254SZB4      MVPCILLAGAVGAFVAQWIRPVFQVDALLQIEAKN--NKS----A--GLVGGLGNLFATN
A0A1M5LBR0      MAPVMLLSAIIGVFVAMWARPIYQVDALLQIESKN--SKP----S--GMMGSLGALFATS
A0A1M7DJN3      MAPVMLLSAIIGVFVAMWARPIYQVDALLQIESKN--SKP----S--GMMGSLGALFATS
A0A1M6UFW9      MVPIMLLAGIIGVFVAMWVRPVYQVDALLQIESKN--SKP----S--GMMGSLGALFATS
A0A1M6I669      VLPCLILSGIIGVIVALWIRPVYQVDALLQIESKS--NKS----MAGAMMGGLGSLFASS
A0A1M6WDT9      ILPCVILAGIIGVVVSMWIRPIYKVDALLQIESKN--NKS----M--GVMGGLTNLFATS
A0A254RG57      MVPCLILAGIIGVFVAMWIRPIYKVDALLQIESKN--GKN----V--GMMAGLGNLFSTT
A0A254S791      MIPSIILSGIIGVFVAMWIRPVYKVDALLQIESKN--SKS----L--SLMGGLGNLFAST
A0A285ZTW6      MIPCIIVAGIVGVFVAMWIRPIYKVDALLQIETKS--NKS----V--GLMGGLPSLFASS
A0A380S6W7      MIPCLIVSGIIGVFVALWIRPIYQVDALLQIESKN--NKS----M--GMTGGLGNLFATT
A0A1M6V3G7      MVPCIILAGIIGVFVAMWIRPVYKVDALLQIESKN--NKS----V--GLMGGLPSLFASA
A0A1N6J281      MVPCIILAGIIGVFVAMWIRPVYKVDALLQIESKN--NKS----V--GLMGGLPSLFASA
A0A285ZYD6      LLLFILVGGLVGFSIANWLRPQYTSDILLQIDAKG--GNA----T--KAMGEMGSILDVA
A0A1M6S079      ILSFLFMGGVIGFLLMNWVRPEYTSDAMIQVDIRG--NKV----S--RAMGEMGALLDMA
A0A1M6WR43      IAAFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRG--NKA----T--RAMGEMGALLDMT
A0A2N3RVS2      IATFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRG--NKA----T--RAMGEMGALLDMT
A0A1M5VRV4      IAAFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRG--NKA----T--RAMGEMGALLDMT
A0A254RLG7      IATFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRG--NKA----T--RAMGEMGALLDMT
A0A1M6SHG3      LVFCIMVGCCVGFLASNWARPQYTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A1M6WJF1      LSVCIVFGCIVGFLVSNWMTPQYTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A254RQS8      LACCIVLGCVAGFLASNWMRPQYTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A1M6Z6I9      LAFCIVLGCAAGFLASNWMRPQFTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A254STU0      LAFCIVLGCAAGFLASNWMRPQFTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A1M5G181      LACCIAVGCAVGFLASNFMRPQYTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A1M6VYU0      LACCIAVGCAVGFLASNFMRPQYTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A1M7DAK0      ILLFVVLATIFGACYAMWVRPSFTSDVLLQVNTKGASSKS----T--KALGEMGAVLDLA
A0A254SNB3      LLLFLAFGAIVGVLIGMWIRPQFTSDALLQIDVKG--NKA----G--KAMGEMGALLEVA
A0A380RVE7      LLLFLAFGAIVGVLIGMWIRPQFTSDALLQIDVKG--NKA----G--KAMGEMGALLEVA
A0A1M5F234      LCLFLLVGAAIGVVVGQWIRPQYTSDALFQIDIKG--NKS----A--RALGEMGSLLEVA
A0A1M6VST0      LCLFLLVGAAIGVVVGQWIRPQYTSDALFQIDIKG--NKS----A--RALGEMGSLLEVA
A0A2C8Y654      LTIFLVLGLFAGGVASMWMRPAYKSDILLQVDVKG--NKS----S--KALGEMGALLDVS
A0A1M5J685      LLVFLLLGLFAGGVAAMWMRPAYKSDILLQVDVKG--NKS----S--KALGEMGALLDVS
A0A1M7JMJ6      LLVFLLLGLFAGGVAAMWMRPAYKSDILLQVDVKG--NKS----S--KALGEMGALLDVS
A0A254S3F1      LLVFLFFGVVFGCLAAMWIRPSFKSDILLQVNVKG--NKQ----G--LALGEMGALFDVS
A0A254SFQ7      LLIFLFLGVIFGGFVSMWLRPSYRSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
A0A380S7L2      LLIFLFLGVVFGGLVSMWLRPSYRSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
A0A1M7MCZ6      LLIFLFLGVVFGGLVSMWIRPAYKSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
A0A1X7KIP6      LLIFLFLGVVFGGLVSMWIRPAYKSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
A0A286A129      LLIFLILGIGFGGLFSMWLRPSFRSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
C9RRK0          LFIFLILGVVFGGLAAMWLRPSFRSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
A0A2M9A3A4      LAVFVVLGTVSGFIVSNYIRPVFSSDALLQVDLNG--NSA----S--LAMGEMGALLDAA
A0A2P6UPN2      LLLFILLGGGIGFFVANFLRPSYSSDALLQVDQNG--KTA----G--LAMGEMGALLDVA
A0A1M6RBQ2      LLTFVLVGAAVGVFVGNWIRPQYSSDALLKLEVKS--SKS----N--KSSDVLDMLFAQG
A0A316BGL2      LLMFILVGAAVGVFIGNWARPQYSSDALLKLEVKS--AKS----S--KPTDVLDFFFEKA
A0A1M6IQ57      LMLFVLFGAFIGAVVGFWIRPAFTSDALLQIDVRG--SKKGNVMS--QAMGDMGALLDVT
A0A316ATY6      IFVFLLMGGLFGFLLMNWIRPEYTSDAMIQVDIRG--NKV----S--RAMGEMGALLDMA
A0A1T4QDW5      LLFCLILGAVVGVLAAYWIRPQYTSDALLQIDVSG--SAS----A--KALGDMGALLESS
A0A1M6VSY0      LLFCLILGAVVGVLAAYWIRPQYTSDALLQIDVSG--SAS----A--KALGDMGALLESS
A0A2A3HHG6      LLFCLILGAVVGVLAAYWIRPQYTSDALLQIDVSG--SAS----A--KALGDMGALLESS
C9RP30          LALFLIVGGAVGYCVANWLRPQYTSDVLLQIDVKG--GKS-G-----KAIGDMGALLDVA
A0A1M5V3U1      VALFVVVATLIGSFYAMWVRPQFTSDALLQVNVKG--TSSKA--T--KAFGEMGAVLDLA
A0A1M7NG89      VALFVIVAAMLGATYAMWVRPLFTSDVLLQVNVKG--TSSKS--T--KALGEMGAVLDLA
A0A2C8YXS0      ILLFTLLTVVFGYAYAMWVRPQFTSDVLLQVNVKG--SSSKS--T--KALGEMGAVLDLA
A0A254RLK0      LCLFLAAGALIGLVIGQWIRPQFTSDALLQIDVKG--NKA-A--N--RAMGEMGAILDVA
A0A1M6RGU5      LCLFLAAGALIGFVIGQWIRPQFTSDALLQIDVKG--NKA-A--N--RAMGEMGAILDVA
A0A254SQM8      LCLFLAAGALIGLVIGQWIRPQFTSDALLQIDVKG--NKA-A--N--RAMGEMGAILDVA
A0A316B5S0      LILCVIVGCGIGFLASNWARPQYTSDALLQIDVKG--NKA-G-----KAMGEMGALLDVA
A0A254RXS0      LFFCLVVGAVVGFLASNWVRPQYTSDALLQIDVKG--NKA-G-----KAMGEMGALLDVA
A0A1M6X012      LFFCLVVGTVVGFLASNWVRPQYTSDALLQIDVKG--NKA-G-----KAMGEMGALLDVA
A0A1M5TLF1      LFFCLVVGAVVGFLASNWVRPQYTSDALLQIDVKG--NKA-G-----KAMGEMGALLDVA
A0A2N3RVJ9      LFFCLVVGAVVGFLASNWVRPQYTSDALLQIDVKG--NKA-G-----KAMGEMGALLDVA
A0A1M6R2N3      FALLSFIGLVVGATYARYSRDVFRSTAMLQLDTKS--RSG-------KAIADIGELFESH
A0A1N6GS15      FALLSVVGLVAGATYARYSRDVFRSTAMLQLDTKS--KSG-------KAIADIGALFESH
A0A254SB44      VAVLSIVGLLAGTVASRYVRDSFDNKTMLQLDTKS--KSG-------KAVSDFGDLFDAK
A0A1M7LKR0      VVFFSIIGLFVGVVVSRYVRDSFENKTMLQLDTKS--KSG-------KAVSDFGDLFDAK
A0A1X7JP42      VVFFSIIGLFVGVVVSRYVRDSFENKTMLQLDTKS--KSS-------KAVSDFGDLFDAK
A0A1M6UBQ0      VAFLSIVGLMAGTVFSRYVRDSFDNKTMLQLDTKS--KSG-------KAVSDIGDLFDVQ
A0A1X7IS68      IVSFTIVGLMAGLTYSRYSRNLFECTTMLQLDTKS--KNA-------KAIVDIGDLFQQQ
                .                     :     . ::  .                    .    

A0A3C0PHK7      RSVDFYQGILESRTFQEMLADSIGLNVLKANNPKLTREQAIKNLHSSLTLKSTEYASFLR
A0A0J7HV92      RPLSFYEGILNSRSFLEMLLDSIGVEIFSEVFPEYSRDQIRGYIHSNISLRRTPYSSFLR
A0A1M6RVC1      SPAETEIELIRSRQVMGAAVE-----------------------KMRLQYEAEPLNFLDR
A0A2N3RSN9      SPAETEIELIRSRQVMGAAVE-----------------------KMRLQYEAEPLNFLDR
A0A1M5IPF7      SPAETEIELIRSRQVMGAAVE-----------------------KMRLQYEAEPLNFLDR
A0A254RX70      SPAETEIELIRSRQVMGAAVE-----------------------KMRLQYEAEPLNFLDR
A0A1M7GQ27      SPAETEIELIKSRHIIGEAVE-----------------------KMHLQYTATPVNSLDR
A0A1X7JCK4      SPAETEIELIKSRHIIGEAVE-----------------------KMHLQYTATPVNSLDR
A0A1M7HDE6      SPAETEIELIKSRQIIGDAVD-----------------------KMRLLYVATPTRKLQR
A0A2C9A7H2      SPAETEIELIKSRHIIGDAVD-----------------------KMHLQYIATPTNKLDR
A0A254SF58      SPAETEIELIGSRQIIGEAVE-----------------------KMHLQYVAIPTNKLDR
A0A316ANB4      SPAETEIELINSRQVIGDAVE-----------------------KMHLQYVATPTNKLDR
A0A1J5E847      SPAETEIELVKSRRVMGAAVE-----------------------ASRLQNVAIPLGFWDR
A0A254RM08      SPAETEMELIKSRQVMGSAVE-----------------------KMRLDLVAEPLNKLDR
A0A1M7CD42      SPAETEMELIKSRQVMGSAVE-----------------------KMRLDLVAEPLNKLDR
A0A254SZB4      SPAETEMELIKSRQVMGSAVE-----------------------KMRLDLVAEPLNKLDR
A0A1M5LBR0      SPAETEMELIRSRQVMGSAVE-----------------------KMRLDLVAEPLDKMDR
A0A1M7DJN3      SPAETEMELIRSRQVMGSAVE-----------------------KMRLDLVAEPLDKMDR
A0A1M6UFW9      SPAETEMELIKSRQVMGAAVE-----------------------KMRLDLVADPQSKLDR
A0A1M6I669      SPAETEIELIKSRQIIGDAVD-----------------------KMHLQYIATPTLKLQR
A0A1M6WDT9      TPAETEIELINSRQILGDAVE-----------------------KMHLQYSANPKNVLDR
A0A254RG57      SPAETEIELIMSRQIIGEAVE-----------------------KMHLQYEATPISKINR
A0A254S791      SPAATEIELINSRQIIGEAVE-----------------------KMHLQYIADPINKLDR
A0A285ZTW6      SPAETEIELINSRQIIGDAVE-----------------------KMHLQYEANPINVMDR
A0A380S6W7      SPAETEIELIKSRQIIGEAVE-----------------------KMRLQYVATPINKLDR
A0A1M6V3G7      SPAETEIELIYSRQIIGEAVE-----------------------KLRLQYTATPINKMDR
A0A1N6J281      SPAETEIELIYSRQIIGEAVE-----------------------KLRLQYTATPINKMDR
A0A285ZYD6      SPADAEIELIKSRMVLSYVVE-----------------------AERLCFNATPVGAVDR
A0A1M6S079      SPSDAEIELVKSRSVLAYVVE-----------------------EEHLRFNATPIGKMDR
A0A1M6WR43      SPADAEIELVKSRSVLAYVVE-----------------------EEHLRFNAIPVGKMDR
A0A2N3RVS2      SPADAEIELVKSRSVLAYVVE-----------------------EEHLRFNAIPVGKMDR
A0A1M5VRV4      SPADAEIELVKSRSVLAYVVE-----------------------EEHLRFNAIPVGKMDR
A0A254RLG7      SPADAEIELVKSRSVLAYVVE-----------------------EEHLRFNAIPVGKMDR
A0A1M6SHG3      SPAEAEIELLKSRMVLSYVVN-----------------------QEHLCFNAYPKDPIKR
A0A1M6WJF1      SPAEAEIELLKSRMVLSFVVE-----------------------QEHLCFNAYPVGVLDR
A0A254RQS8      SPAEAEIELLKSRMVLTYVVE-----------------------QERLCFNAYPKGAIDR
A0A1M6Z6I9      SPAEAEIELLKSRMVLNYVVE-----------------------QERLCFNAYPKGAIDR
A0A254STU0      SPAEAEIELLKSRMVLTYVVE-----------------------QERLCFNAYPKGAIDR
A0A1M5G181      SPAEAEIELLKSRMVLNYVVD-----------------------KEHLCFNAYPKGLIDR
A0A1M6VYU0      SPAEAEIELLKSRMVLNYVVE-----------------------KEHLCFNAYPKGIIDR
A0A1M7DAK0      SPADAEIELIKSRMVLNYVVS-----------------------VEHLHLKAIPIGFWDR
A0A254SNB3      SPADAEIELIKSRMVLSYVVS-----------------------QEHLDYSAAPLSAMNR
A0A380RVE7      SPADAEIELIKSRMVLSYVVS-----------------------QEHLDYSAAPLSAMNR
A0A1M5F234      SPADAEIELIKSRLVLNYVVD-----------------------QEHLMYSATPQGALNR
A0A1M6VST0      SPADAEIELIKSRLVLNYVVD-----------------------QEHLMYSATPQGALNR
A0A2C8Y654      TPSEAEMQLIKSRMVLSTVVD-----------------------EQRLCYSAVPLDKVDR
A0A1M5J685      TPSEAEMQLIKSRMVLSSVVE-----------------------EQRLCYSAVPLDKVDR
A0A1M7JMJ6      TPSEAEMQLIKSRMVLSSVVE-----------------------EQRLCYSAVPLDKVDR
A0A254S3F1      TPSAAEMELIKSRVILDQVVQ-----------------------DERLCYSAVPLNKLDR
A0A254SFQ7      TPSAAEMELIKSRVVLDHVVN-----------------------EERLCFSATPLNKQDR
A0A380S7L2      TPSAAEMELIKSRVVLDHVVN-----------------------EEKLCFSAIPLNKQDR
A0A1M7MCZ6      TPSAAEMELIKSRGVLDQVVQ-----------------------DERLCYSAIPLNKKDR
A0A1X7KIP6      TPSAAEMELIKSRGVLDQVVQ-----------------------DERLCYSAIPLNKKDR
A0A286A129      TPSAAEMELLKSRVVLDQVVE-----------------------DERLCFSAVPLNKMDR
C9RRK0          TPSAAEMELIKSRVVLDHVVK-----------------------EERLCYSAIPLDKADR
A0A2M9A3A4      SPADAEIQLIRSRRVLSVVVD-----------------------KEHLSYGATPVALLPR
A0A2P6UPN2      SPSDAEIELIKSRRVLDEVVE-----------------------LEHLAYSAKPVAFLPR
A0A1M6RBQ2      SPADAEIEMIKSRRVLSYVVD-----------------------AEGLCYKANPIGLVDR
A0A316BGL2      SPADAEIEMIKSRKVLSYVVD-----------------------AEGLCFNAVPVGIVDR
A0A1M6IQ57      TPADAEIELLKSRMVLSYVVD-----------------------EEHLAFSATPTSKLNR
A0A316ATY6      SPSDAEIELVKSRSVLAYVVE-----------------------EEHLRFNAVPIGKMDR
A0A1T4QDW5      SPADAEIELIKSRMVLNDVVE-----------------------QEKLCYSATPIGKMNR
A0A1M6VSY0      SPADAEIELIKSRMVLNDVVE-----------------------HEKLCYSATPIGKMNR
A0A2A3HHG6      SPADAEIELIKSRMVLNDVVE-----------------------QEKLCYSATPIGKMNR
C9RP30          SPADAEIELLKSRMILSYVVD-----------------------VEHLCFQATPIGAADR
A0A1M5V3U1      SPADAEIELIKSRMVLSYVTM-----------------------AEHLYLWTVPVGFWDR
A0A1M7NG89      SPADAEIELIKSRMVLSDVVA-----------------------KEHLYVWTVPIGFWDR
A0A2C8YXS0      SPADAEIELIKSRMVLSEVVA-----------------------IEHLHIWTIPIGVSDR
A0A254RLK0      SPADAEIELIKSRLVLNYVVS-----------------------EEHLNYSATPTSALNR
A0A1M6RGU5      SPADAEIELIKSRLVLNYVVS-----------------------EEHLNYSATPTSALNR
A0A254SQM8      SPADAEIELIKSRLVLNYVVS-----------------------EEHLNYSATPTSALNR
A0A316B5S0      NPAEAEIELLKSRMVLSYVVQ-----------------------KENLCFNAYPKDPIKR
A0A254RXS0      SPAEAEIELLKSRMVLSYVVE-----------------------QERLCFNAYPKGPMKR
A0A1M6X012      SPAEAEIELLKSRMVLSYVVE-----------------------QERLCFNAYPKGPMKR
A0A1M5TLF1      SPAEAEIELLKSRMVLSYVVE-----------------------QERLCFNAYPKGPMKR
A0A2N3RVJ9      SPAEAEIELLKSRMVLSYVVE-----------------------QERLCFNAYPKGPMKR
A0A1M6R2N3      SPAKSEIYLIKSLSVLMPVVE-----------------------KMHLNYGAEPVGVMDR
A0A1N6GS15      SPALAEIHLIKSLNVLMPVVE-----------------------KLRLNYGAEPIGLVDR
A0A254SB44      SPAVAEIHLIKSLSVLMPVVE-----------------------QLHLNYMAEPQGIVDR
A0A1M7LKR0      SPAVAEIHLIKSLSVLMPVVE-----------------------QLHLNYTAEPQGIVDR
A0A1X7JP42      SPAVAEIHLIKSLSVLMPVVE-----------------------QLHLNYTAEPQGIVDR
A0A1M6UBQ0      SPAVAEIHLIKSLSVLMPVVE-----------------------QLRLNYMAEPQGVVDR
A0A1X7IS68      SPAKAEILLIQSMSVMLPVVE-----------------------KLHLNYTAKPLGIIDR
                 .      :: *  .                                :           *

A0A3C0PHK7      LNARSETQELAFLTASIGTDVFRKR-----------CEEVESEESRRSMIEIDNQLKLVR
A0A0J7HV92      LNARGKTKEMAYMIAGIG------------------TELLRDR--CQEVESEESRRAL-K
A0A1M6RVC1      LLHREGRLDLAQIEVPWD-SVPKTDKIKEW------EVEIKDSTGRFDLYDHLDKVVL-S
A0A2N3RSN9      LLHREGRLDLAQIEVPWD-SVPKTDKIKEW------EVEIKDSTGRFDLYDHLDKVVL-S
A0A1M5IPF7      LLHREGRLDLAQIEVPWD-SVPKTDKIKEW------EVEIKDSTGRFDLYDHLDKVVL-S
A0A254RX70      LLHREGRLDLAQIEVPWD-SVPKTDKIKEW------EVEIKDSTGRFDLYDHLDKVVL-S
A0A1M7GQ27      LLHREGRMEISRFEVPWT-LIPKNEKIVPW------IAEATDSTT-FNLYDHNNKLVL-S
A0A1X7JCK4      LLHREGRMEISRFEVPWT-LIPKNEKIVPW------IAEATDSTT-FNLYDHNNKLVL-S
A0A1M7HDE6      LLHKEGRMELNQLEIPWD-NLPEEERGGAW------TAVANDSLS-FELYDHNNKKVMSN
A0A2C9A7H2      LLHKEGRMELNQLEIPWA-LFPREERNKPW------IAVIMDSLT-FKLYDHNKKLIADN
A0A254SF58      LMHREGRMELSLFEFPWK-TIPKEKRKGSW------TTEALDSTTQYNLYDNKKQKVL-S
A0A316ANB4      LLHKEGRMELNQFIVPGN-VMPKEEKHDPW------IAKVIDSTT-FEVYDHNHQKVVTS
A0A1J5E847      LLHREGRLNLLDFRIPLE-NIPEEFRSEPW------TLVAEDSV-NFKLLDYADNFVL-R
A0A254RM08      LLHKEGRVDLMNFSYNKE-LLPTDFRDEPW------FLEMRDSLGNFNLYDYKDSLVL-S
A0A1M7CD42      LLHKEGRVDLMNFSYNKD-LLPSDFRDEPW------FLEMKDSLGNFDLYDYKDSLVL-S
A0A254SZB4      LLHKEGRVDLMNFSYNKD-LLPSDFRDEPW------FLEMKDSLGNFDLYDYKDSLVL-S
A0A1M5LBR0      LLHKEGRLELNNFNVPWD-NVPKEERGMPW------TVVAKDSLGNFELYDHNKNLVL-S
A0A1M7DJN3      LLHKEGRLELNNFNVPWD-NVPKEERGMPW------TVVAKDSLGNFELYDHNKNLVL-S
A0A1M6UFW9      LMHKEGRLELSNFNVPWN-NVPKEKRNLPW------TVVAKDSLGNFELFDQDKKLVL-T
A0A1M6I669      LFHKEGRMELVQLEIPWD-NLPEEERGKPW------VAVVKDSL-TFKLLDHNKKLIVDN
A0A1M6WDT9      LLQKEGRMDINQFEVPWD-KLPADEKTGPW------VAITKDSL-SFDLYDHKGAFVL-T
A0A254RG57      ILHQEGRMELSAFEVPWS-KLPPDEETGPW------HAVVIDSN-HYYLLDHNKKKFL-E
A0A254S791      LTHHEGRMELSAFEVPWD-SIPTDEKIKPW------IAKAIDSL-SFELYDHNDKKIL-T
A0A285ZTW6      LLHREGRMELNQYEIPWD-KIPEDEKIKPW------IAEATDST-SFKLIDHNDKEVL-S
A0A380S6W7      LLHHEGRMELNNFDFPWE-TLPKEEKIKPW------IAEVTDSL-TYDLYDHHNKKIL-S
A0A1M6V3G7      LLHHEGRMELSQFEVPWK-SIPKDEKRGPW------IATAVDST-SFDLYDHNNNKIL-T
A0A1N6J281      LLHHEGRMELSQFEVPWK-SIPKDEKRGPW------IATAVDSS-SFDLYDHNNNKIL-T
A0A285ZYD6      FTHKEGRMDLDSLYIPTL------ARAEKW------MARAVDEN-TYEVISPEEQVIL-E
A0A1M6S079      LLHREGRMDIDELDIPQI------ARKERW------IAQITGIN-SYEVITPEGAVLA-K
A0A1M6WR43      LLHREGRMDIDELDIPEI------ARRDRW------TATVTGAN-SYAVITPEGAKLV-E
A0A2N3RVS2      LLHREGRMDIDELDIPEI------ARRDRW------TATVTGAN-SYAVITPEGAKLV-E
A0A1M5VRV4      LLHREGRMDIDELDIPEI------ARRDRW------TATVTGAN-SYAVITPEGAKLV-E
A0A254RLG7      LLHREGRMDIDELDIPEI------ARRDRW------TATVTGAN-SYAVITPEGAKLV-E
A0A1M6SHG3      LTHKEGRMDLEELHIPEI------AITDKW------LAKTIDDT-TYAIITPEETELA-R
A0A1M6WJF1      LLHKQGRMDIENLYIPEI------ARIEKW------TAEVVSEN-EIAVYTPEGVKLL-Q
A0A254RQS8      LLHQEGRMDLEDLYIPEI------ARIEKW------TAEVVGEN-EFAVYTPEGVKLL-Q
A0A1M6Z6I9      LLHQEGRMDLEDLYIPEI------ARIEKW------TAEVVGDN-EFAVYTPEGVKLL-Q
A0A254STU0      LLHQEGRMDLEDLYIPEI------ARIEKW------TAEVVGDN-EFAVYTPEGVKLL-Q
A0A1M5G181      LLHTEGRMDLEDLYIPEI------ARDEKW------MAHVVGEN-EIAVFTPEGVKLL-Q
A0A1M6VYU0      LLHTEGRMDLEDLYIPEI------ARDEKW------MAHVVGED-EIAVFTPEGVKLL-Q
A0A1M7DAK0      FTHSEGRLDLDSLIIPEK------ARNGKW------TAIVKSDE-SYSVVAPDGKEVL-N
A0A254SNB3      LLHKEGRMDIDYLEIPEL------ARAERW------IAVVTGAD-TYDVYTPEETKLV-G
A0A380RVE7      LLHKEGRMDIDYLEIPEL------ARAERW------IAVVTGAD-TYDVYTPEETKLV-G
A0A1M5F234      LLHREGRMDIDFLNIPEL------ARADRW------EAVVTGDN-SYAIYTPEETKLV-E
A0A1M6VST0      LLHREGRMDIDFLDIPEL------ARADRW------EAVVTGEN-TYAIYTPEETKLV-E
A0A2C8Y654      LLHREGRMDLEFLSIPRA------VTEAKIKIK---ARVLPDST-KFELLGEDDAVLL-K
A0A1M5J685      LLHREGRMDLEFLSIPRA------VSEAKIKIK---ARVLPDST-KFELLGEDDAVLL-K
A0A1M7JMJ6      LLHREGRMDLEFLSIPRA------VSEAKIKIK---ARVLPDST-KFELLGEDDAVLL-K
A0A254S3F1      LMHREGRMDLELLVIPRA------FEEAKGELV---ARVTADSS-AYEVIGLEGEVVL-S
A0A254SFQ7      LLHHEGRMDLELLVIPRA------FQEAKGKLV---ARVTADSS-AYEVIGLEGEVVL-S
A0A380S7L2      LLHHEGRMDLELLVIPRA------FQEAKGKLV---ARVTADSS-AYEVIGLEGEVVL-S
A0A1M7MCZ6      LLHKEGRMDIELLSIPRA------FEEADGKLI---ARVTADSS-AYEVLGLEDEVVL-S
A0A1X7KIP6      LLHKEGRMDIELLSIPRA------FEEADGKFI---ARVTADSS-AYEVLGLEDEVVL-S
A0A286A129      LKHREGRMDLELLSIPRA------FVEAKGELI---ARVTADSS-AYEVLGLEGEVVL-S
C9RRK0          LMHREGRMDLELLEIPRA------FQEAKGKLI---ARVTADSS-AYEVIGLEGEVVL-A
A0A2M9A3A4      LLHKEGRVDVGLLHFPEV------YEPDANWFLVASSDSSLSNS-HYQIVDPMQKVIL-E
A0A2P6UPN2      LLHTEGRVDVEFLHIPEI------ARTE-KWMLMASADSALSNS-EFSIIDPMEKVIL-Q
A0A1M6RBQ2      LRHHEGRMDVQSLVLPTH-------IRDGW------TAKIVNDR-SYVVYSPDGRSVM-K
A0A316BGL2      LRNNEGRMDVQSLVLPAE-------RRKGW------TAKIVNDR-SYVVYGPDGNSVM-K
A0A1M6IQ57      LLHREGRMDVDKLNIPAA------ARAEEL------TAVATGDN-TYKVVNPQNTVLV-Q
A0A316ATY6      LLHREGRMDIDELDIPEI------ARKEKW------IAQVTGVN-SYEVITPEGAVLA-K
A0A1T4QDW5      LLHREGRMDLDSLYIPEF------ARTEEW------KAVVLSPD-SFAVLDPEEKQVL-R
A0A1M6VSY0      LLHREGRMDLDSLYIPEF------ARTEEW------KAVVLSPD-SFAVLDPEEKQVL-R
A0A2A3HHG6      LLHREGRMDLDSLYIPEF------ARTEEW------KAVVLSPD-SFAVLDPEEKQVL-R
C9RP30          FLHHEGRMDLDSLYIPQI------ARAEKW------MARVTGDD-TYEVISPEEQVIL-E
A0A1M5V3U1      LLHREGRMDLDSLRIPLK------VRAKKW------MAEVTGKD-SYSVISPDGKKIL-D
A0A1M7NG89      LTHKEGRMDVDSLRIPEK------VRAKKW------MAVAKSDS-AYSVVSSDEKNVL-D
A0A2C8YXS0      FTHKEGRMDVDSLIIPEK------LRVKKW------IAVVKDEN-SYAVIAPDGKVAL-E
A0A254RLK0      LLHREGRMDLDYLFIPDM------ARTEKW------MAVVTGDD-TYAIYNEDETKLI-E
A0A1M6RGU5      LLHREGRMDLDYLFIPDM------ARTEKW------RAVVTGDD-TYAVYNEDETRLV-E
A0A254SQM8      LLHREGRMDLDYLFIPDM------ARTEKW------WAVVTGDD-TYAVYNEDETRLV-E
A0A316B5S0      LTHTEGRMDLENLHIPEI------AITEKW------MARTIDDS-TYAIITPEETELA-R
A0A254RXS0      LTHKEGRMDLENLHIPEI------AITEKW------YALVTGQD-EFIVITPEDTELV-K
A0A1M6X012      LTHKEGRMDLENLHIPEI------AITEKW------YALVTGQD-EFIVITPEDTELV-K
A0A1M5TLF1      LTHKEGRMDLENLHIPEI------AITEKW------YALVTGQD-EFIVITPEDTELV-K
A0A2N3RVJ9      LTHKEGRMDLENLHIPEI------AITEKW------YALVTGQD-EFIVITPEDTELV-K
A0A1M6R2N3      LMHREGRMDLDLFEPPRV----FDEDDGNW------VAEVKSED-SYELFTPLGTSVV-V
A0A1N6GS15      LMHREGRMDLDLFEPPKV----FDDDDGDW------VAEVKSED-SYELFTPLGSSVV-V
A0A254SB44      LMRREGRMDLDLFEPPKAGMLGIDKKDEKW------IAVVRSQD-TYELFSPMGQSLV-V
A0A1M7LKR0      LMRREGRMDLDLFEPPKMDREDKSLKGKKW------IAVVQSQD-SYELFSPMGQSLV-V
A0A1X7JP42      LMRREGRMDLDLFEPPKMDREDKSLKGKKW------IAVVQSQD-TYELFSPMGQSLV-V
A0A1M6UBQ0      LMRREGRMDLELFEPPRM-DEELVKKGKKW------IAVIQSED-SYELFSPMGQSLV-V
A0A1X7IS68      LLQREGRMDLKLFEPPKP-KDD---EKIEW------ITEILSDS-TYDLRSPFGGSLV-I
                :       ::                               .      :           

A0A3C0PHK7      DKLEQAER-----DYQTYKERTGNIAGGTTPELKTLQEASATNIAQLGLKEADLTAEKKQ
A0A0J7HV92      EIENQLGLIRDNLEEAEYEYRKFKDRTGQ-----------IQDGTTPGL---KTLQEAYG
A0A1M6RVC1      GEPGHTYKFPYAGDSAAFGIISCDVRPGQRFVVRKRKRLDAISSFRSAF---DVKEKGKK
A0A2N3RSN9      GEPGHTYKFPYAGDSAAFGIISCDVRPGQRFVVRKRKRLDAISSFRSAF---DVKEKGKK
A0A1M5IPF7      GEPGHTYKFPYAGDSAAFGIISCDVRPGQRFVVRKRKRLDAISSFRSAF---DVKEKGKK
A0A254RX70      GEPGHTYKFPYAGDSAAFGIISCDVRPGQRFVVRKRKRLDAISSFRSAF---DVKEKGKK
A0A1M7GQ27      GSVGNTYHFPYAGDTAVFCVHRMEATAGQKFELQELNRLDAIAAFKKAF---EIKEKGKK
A0A1X7JCK4      GSVGNTYHFPYAGDTAVFCVHRMEATAGQKFELQELNRLDAIAAFKKAF---DIKEKGKK
A0A1M7HDE6      CHAGETYRIPYAGDTATFSVLKMDIKKGQRFSLYKMNRLDAIDAFKSAF---DIKEKGKK
A0A2C9A7H2      CHAGITYKFPYMGDSVTFSVLKMNVKKGQTFNLTKIDRLDAINAFRDVF---DITEKGKK
A0A254SF58      GIVGKTYHVPYLSDTLTFRIERMEAAPGQKFKIGKMERLDAIEAFKGAF---NIKERGKK
A0A316ANB4      GKVSQTYHIPYGQDTVVLSVYRMIARAGQEFELSQVERLESIEAFKHAF---GVKERGKK
A0A1J5E847      GHAGETVVAPYAGDSVRIGVLRMMAHKGQTFAVSNRLRLDAISAFESAF---SVAERGKK
A0A254RM08      GAVGQTYHFEYAGDSAAFGIFKAEVREGQRFAVSKLKRLDAIGLFRSAF---DVKEKGKK
A0A1M7CD42      GAVGQTYHFAYAGDSAAFGIFKAEVREGQRFAVSKLKRLDAIEQFRSAF---DVKEKGKK
A0A254SZB4      GAVGQTYHFAYAGDSAAFGIFKAEVREGQRFAVSKLKRLDAIEQFRSAF---DVKEKGKK
A0A1M5LBR0      GVAGQTYRFPYAGDTASFGIFRAVVREGQRFAVSKMKRLEAIEAFRSAF---KVSEKGKK
A0A1M7DJN3      GAAGQTYRFPYAGDTASFGIFRAVVREGQRFAVSKMKRLEAIEAFRSAF---KVSEKGKK
A0A1M6UFW9      GSAGQTYHFTYAGDTASFGIFRAEVRPGQTFSVYKLKRLDAIEKFRGAF---NVSEKGKK
A0A1M6I669      CHAGETYKIPYAGDTVTFSVLRMNVKKGQFFNLYKKNRLDAIDAFKSAF---EIKEKGKK
A0A1M6WDT9      GVPGQTYKVPYAGDSVTFSVFKMKVKANQKFEINKSERLDAIDAFRGAF---EVKERGKK
A0A254RG57      CTVSQTCRAPYAGDTVTINVFYMDAEPKQKFKLQKMERLDAIASFKSKF---KVKERGKK
A0A254S791      GVIGQTYRIPYARDTVIFSVFNMEAVAGQKFELTKLDRLDAIAKFKGAF---EVKERGKK
A0A285ZTW6      GTVGKTYHFIYAGDTATFSVFNMKARAGQRFELFKRTRLDAIAKFKSAF---DVGEKGKK
A0A380S6W7      GQIGQTYRVPYANDTLIFSVLNMKATAGQRFELGKMERLDAIDKFKGAF---DVKEKGKK
A0A1M6V3G7      GTVGQTYRVPYAGDTLIFSVFHMDATAGQKFKLNKLERLDAIAKFKKAF---EVKEKSRK
A0A1N6J281      GTVGQTYRVPYAGDTLIFSVFHMDATAGQKFKLNKLERLDAIAKFKKAF---EVKEKSRK
A0A285ZYD6      GKVGELYKAPYAGDTLDIHVSKMLAQPGQEFVLSQSGMLGAIAALKGGL---KVAEKGKK
A0A1M6S079      AEIGETIRAPYAGDTLVMRVRLMRGIEGQQFILRQLTPLSAIRGLASKL---SVAEKGKQ
A0A1M6WR43      AEVGETVRAPYAGDTLVMRVRLIRAAVGQEFVLQQLKPLAAIRSLARKL---SVSEKGKQ
A0A2N3RVS2      AEVGETVRAPYAGDTLVMRVRLIRAAVGQEFVLQQLKPLAAIRSLARKL---SVSEKGKQ
A0A1M5VRV4      AEVGETVRAPYAGDTLVMRVRLIRAAVGQEFVLQQLKPLAAIRSLARKL---SVSEKGKQ
A0A254RLG7      AEVGETVRAPYAGDTLVMRVRLIRAAVGQEFVLQQLKPLAAIRSLARKL---SVSEKGKQ
A0A1M6SHG3      GVIGQPLVASYAGDSLTILVKRMRAEPGQVFVLVQTDPLDAMRGLVKKL---NVAEKGKQ
A0A1M6WJF1      GPVGERLTAAYGGDTLVIQVKRLLATPGQKFVIAQSEPLDAVRGLVKSL---DVAEKGKQ
A0A254RQS8      GKVGEALAAPYGGDTLRINVKHLLARPGQLFVLAQSEPLDAVRGLVKKL---DVGEKGKQ
A0A1M6Z6I9      GKVGESLSAPYGGDTLRVHVKHLLARPGQRFVLVQSEPLDAVRALVKKL---DVAEKGKQ
A0A254STU0      GKVGESLSAPYGGDTLRVHVKHLLARPGQRFVLVQSEPLDAVRGLVKKL---DVAEKGKQ
A0A1M5G181      GKVGESLSAPYGGDTLRIHVKHLHARPGQVFVIVQSEPLDAVRGLVKQL---DVSERGKQ
A0A1M6VYU0      GKVGEALSAPYGGDTLRIHVKHLLARPGQVFAIVQSEPLDAVRGLVKQL---DVSERGKQ
A0A1M7DAK0      GKVGHVYKTKYAEDSLTIRVSYMDAKVGQRFKLLQGSLLKTEQILMRSL---NVNERGKQ
A0A254SNB3      GKVGDLLKAPYAGDTLCIRVNLMRATVGERFAIGQSNTLLAVRGLASAL---KVAEKGKQ
A0A380RVE7      GKVGDLLKAPYAGDTLCIRVNLMRATVGERFAIGQSNTLLAVRGLASSL---KVAEKGKQ
A0A1M5F234      GMVGDLLSAPYAGDTLRIRVKLMRATLGEKFVIKQGNPLLAVRGLAGSL---KVAEKGKQ
A0A1M6VST0      GKVGDLLSAPYAGDTLRMRVKLMRATLGEKFVIKQGNPLLAVRGLAGSL---KVAEKGKQ
A0A2C8Y654      GEVGETYRQPYAGDTLAICVRSMKARPGQVFLLGATHPQMAVAGLLGGL---SVSEEGKN
A0A1M5J685      GEVGETYRQPYAGDTLAICVRSMKARPGQTFLLGATHPQMAVAGLLGGL---SVSEEGKN
A0A1M7JMJ6      GEVGETYRQPYAGDTLAICVRSMKARPGQTFLLGATHPQMAVAGLLGGL---SVSEEGKN
A0A254S3F1      GKVGETYRKPFAGDTLAICVKNLTATVGQTFLLTAVHPQVAAGNLLKGL---SISEEGKS
A0A254SFQ7      GSVGETYRKPFAGDTLVICVKSLTATVGQTFLLSAVHPQIAAASLLKGL---SISEEGKN
A0A380S7L2      GSVGETYRKPFAGDTLVICVRSLTATVGQTFLLSAVHPQIAAASLLKGL---SISEEGKN
A0A1M7MCZ6      GKVGETYRKPFAGDTLVICVKSMTATVGQTFLLVAVHPQIAVNNLLSGL---GISEEGKN
A0A1X7KIP6      GKVGETYRKPFAGDTLVICVKSMTATVGQTFLLVAVHPQIAVNNLLSGL---GISEEGKN
A0A286A129      GSVGETYRKPFAGDTLVICVKSLTATVGQTFLLNAVHPQTASASLLKGI---SISEEGKN
C9RRK0          GAVGETYRKPFAGDTLVICVKSLTATVGQTFLLSAVHPQTAAAGLLKGL---GISEEGKN
A0A2M9A3A4      GIVGDTYRVPVAGDTFAIQILNMMASPSEKFRLFESDPRQALDALRNQL---SVTEQGKK
A0A2P6UPN2      GKVGDTYRIPVMGDTFAIRISQMNALPEEKFELTELDPRTALDILKKQL---VVSEMGKK
A0A1M6RBQ2      GVVGKESSATYKGESVSILVSKISGVPGQRFDLEITSSLKAARSLANKL---IIEERGKQ
A0A316BGL2      GEVGKESVGKFKGDSVSILVSKIKGQPGQEFDLQITTPLKAARSLAQQL---KIEEKGKL
A0A1M6IQ57      GKVGDVLKALYAGDTLVIRVKFLSAKVGEEFALRQGNPLSVVRALSKSI---KASEKGKQ
A0A316ATY6      ADIGETIRAPYAGDTLVMRVRLMRGIEGQQFVLRQLTPLSAIRSLAHKL---SVSEKGKQ
A0A1T4QDW5      GEVRKLLVAPYAGDTLAIRVSLLRAEAGEEFALAQSSPLNVARALATGL---EIAEKGKK
A0A1M6VSY0      GEVRKLLVAPYAGDTLAIRVSLLRAEAGEEFALAQSSPLNVARALATGL---EIAEKGKK
A0A2A3HHG6      GEVRKLLVAPYAGDTLAIRVSLLRAEAGEEFALAQSSPLNVARALATGL---EIAEKGKK
C9RP30          GKVGEMHRAAYAGDTFDIQVSRMLAQPEQMFILSQISDLGAMGALKASL---KVAEKGKQ
A0A1M5V3U1      GVVGEVAFAEFADDTLSIRVNFMDAKQGQKFIIAQGSPINAERSLAGGL---SVMEKGKQ
A0A1M7NG89      GVVGEVAFKEYAGDTLAIRVNFMDARKGQKFALVRGTPLKAERALAAGL---NVMEKGKQ
A0A2C8YXS0      GRVGEVYSAVFAGDTLTIRVNYMQARKGQKFQIVQGSPLKAERALKASL---NVAEKGKQ
A0A254RLK0      GKVGQMLKVLYAGDTLQIRVSRMRATIGEEFRINMSNPLIAVRSLAAGL---KVAEKGKQ
A0A1M6RGU5      GKVGQMLKVLYAGDTLQIRVSRMRATVGEEFRINMTNPLIAVRSLAAGL---KVAEKGKQ
A0A254SQM8      GKVGQMLKVLYAGDTLQIRVSRMRATVGEEFRISMTNPLIAVRSLAAGL---KVAEKGKQ
A0A316B5S0      GVLGKELVAPYGGDSLVILVKRMRAEPDQMFVLVESDPLDAVRSLVKQL---NVAEKGKQ
A0A254RXS0      GRVGEPVSAPYAGDSLVIQVKALRAEPGQMFVLVESDPLAAVRELVKQL---NVAERGKQ
A0A1M6X012      GRVGEPVSAPYAGDSLVIQVKALRAEPGQMFVLVESDPLAAVRELVKQL---NVAERGKQ
A0A1M5TLF1      GRVGEPVSAPYAGDSLVIQVKALRAEPGQMFVLVESDPLAAVRELVKQL---NVAERGKQ
A0A2N3RVJ9      GRVGEPVSAPYAGDSLVIQVKALRAEPGQMFVLVESDPLAAVRELVKQL---NVAERGKQ
A0A1M6R2N3      GKVGETYRVHVEGDSVAICVRSMDALPGQKFVLHRLSVLRMAEILQKIV---QADELGKN
A0A1N6GS15      GKVGETYRVPVEGDSVAICVRSMDALPGQKFVLYRLSVLRMAEILQKTV---LADEKGKN
A0A254SB44      GKVGETYRIPMGADSVAICVRAFSAEPGQSFRLFRSSVLSVAEGLQAAI---NAYEKEKN
A0A1M7LKR0      GKIGETYRIPMGADTVAICVKAIYAAPGQSFSLSKSSVLNVAEGLQSAI---NAYEKEKN
A0A1X7JP42      GKIGETYRIPMGADTVAICVKAIYAAPGQSFSLSKSSVLNVAEGLQSAI---NAYEKEKN
A0A1M6UBQ0      GKVGETYRIPMDADTVAICVKAINAEPGQSFSLSRASVLSVAEGLQASI---NAYEKEKN
A0A1X7IS68      GKIGETYRVPFADDTVAISVESISAKPGQKFSLTRIPALYAAKNLSLAI---NAIEKEKN
                             :                                  .           

A0A3C0PHK7      LALMEATITPAEEERSPE------------------FLKLRSRLHELEQEKMRLENLGIN
A0A0J7HV92      SSLANLGLKEADLEAERNQLANLENKITPDRQRSPEFLRLRSRLRELETERMRLENLGIR
A0A1M6RVC1      TGILEFTYQDIYPDRGMAVLNEVASS----------YLRQNVEERNAEAQK----TLEFL
A0A2N3RSN9      TGILEFTYQDIYPDRGMAVLNEVASS----------YLRQNVEERNAEAQK----TLEFL
A0A1M5IPF7      TGILEFTYQDIYPDRGMAVLNEVASS----------YLRQNVEERNAEAQK----TLEFL
A0A254RX70      TGILEFTYQDIYPDRGMAVLNEVASS----------YLRQNVEERNAEAQK----TLEFL
A0A1M7GQ27      TGILEFSYQDIYPDRATQILNEIATS----------YLRQNVEQRNAEAQK----TLEFL
A0A1X7JCK4      TGILEFSYQDIYPDRATQILNEIATS----------YLRQNVEQRNAEAQK----TLEFL
A0A1M7HDE6      TGILEFSYQDIYPDRATEILNEIANA----------YLRQNVERSNAEAQK----TLEFL
A0A2C9A7H2      TGILEFSYQDIYPDRATEILNEISTA----------YLRQNVERSNEEAQK----TLEFL
A0A254SF58      TGILEFSYQDIYPDRATKVLNEIATS----------YLRQNVEQRNAEAQK----TLEFL
A0A316ANB4      TGILEFSYQDIYPDRATEVLNEIATN----------YLRQNVEQRNAEAQK----TLEFL
A0A1J5E847      TGILEFTYQDIYPDRAMNVVNQVANA----------YLRQNVEQRSAEAEK----TLAFL
A0A254RM08      TGILEFSYQDIYADRAVEILNEVASS----------YLRQNVEERNAEAQK----TLEFL
A0A1M7CD42      TGILEFSYQDIYADRAVEILNEVASS----------YLRQNVEERNAEAQK----TLEFL
A0A254SZB4      TGILEFSYQDIYADRAVEILNEVASS----------YLRQNVEERNAEAQK----TLEFL
A0A1M5LBR0      TGILEFSYQDIYPDRAVEILNEVASS----------YLRQNVEERNAEAQK----TLEFL
A0A1M7DJN3      TGILEFSYQDIYPDRAVEILNEVASS----------YLRQNVEERNAEAQK----TLEFL
A0A1M6UFW9      TGILEFSYQDIYPDRGVEILNEVASS----------YLRQNVEERNAEAQK----TLEFL
A0A1M6I669      TGILEFTYQDIYPDRATEILNEIAAT----------YLRQNVERSNAEAQK----TLEFL
A0A1M6WDT9      TGILEFSYKDIYPDRATEILNEVASS----------YLQQNVEQRNAEAQK----TLEFL
A0A254RG57      TGILEFSYQDIYPDRATSILNEIATT----------YLRQNVEQRNAEAQK----TLEFL
A0A254S791      TGILEFSYQDIYPDRATKIVNEIATT----------YLRQNVEQRNAEAQK----TLEFL
A0A285ZTW6      TGILEFSYQDIYPDRATKILNEIATS----------YLRQNVEQRNAEAQK----TLEFL
A0A380S6W7      TGILEFSYQDIYPDRATKILNEIATS----------YLRQNVEQRNAEAQK----TLEFL
A0A1M6V3G7      TGILEFSYQDIYPDRATKILNEIATS----------YLRQNVEQRNAEAQK----TLEFL
A0A1N6J281      TGILEFSYQDIYPDRATKILNEIATS----------YLRQNVEQRNAEAQK----TLEFL
A0A285ZYD6      SGIIEASFNHRYPDRAASILNTVAKT----------YLRQNVEMRSAEAAK----TLEFL
A0A1M6S079      TGIIAVSLKHRYADRSAAILNTIADT----------YVRRNVEKRSAEAEK----TLEFL
A0A1M6WR43      TGILAVSLKHRYADRSATILNAIANT----------YVRHNVEKRSAEAEK----TLEFL
A0A2N3RVS2      TGILAVSLKHRYADRSATILNAIANT----------YVRHNVEKRSAEAEK----TLEFL
A0A1M5VRV4      TGILAVSLKHRYADRSATILNAIANT----------YVRHNVEKRSAEAEK----TLEFL
A0A254RLG7      TGILAVSLKHRYADRSATILNAIANT----------YVRHNVEKRSAEAEK----TLEFL
A0A1M6SHG3      TGIIGVSFTHQYPDRAAAILNSIANV----------YLRQNVEMRSAEAEK----TLEFL
A0A1M6WJF1      TGIIGVSYTNRYADKAASVLNSIANI----------YLRQNVEMRSAEAEK----TLEFL
A0A254RQS8      TGIIGVSYTDRYADKAASVLNTIANI----------YLRQNVEMRSAEAEK----TLEFL
A0A1M6Z6I9      TGIIGVSYTDRYADKAASVLNTIANI----------YLRQNVEMRSAEAEK----TLEFL
A0A254STU0      TGIIGVSYTDRYADKAASVLNTIANI----------YLRQNVEMRSAEAEK----TLEFL
A0A1M5G181      TGIIGVSYTNRYADKAASVLNTIANI----------YLRQNVEMRSAEAEK----TLEFL
A0A1M6VYU0      TGIIGVSYTNRYADKAASVLNTIANI----------YLRQNVEMRSAEAEK----TLEFL
A0A1M7DAK0      TGIISVRYSHRYPDRAASILNTIAKT----------YLRQNVEMRSAEAEK----TLEFL
A0A254SNB3      TGIIGVSYSHRYADRAASILNTIANT----------YVRQNVEMRSAEAEK----TLEFL
A0A380RVE7      TGIIGVSYSHRYADRAASILNTIANT----------YVRQNVEMRSAEAEK----TLEFL
A0A1M5F234      TGVIGISYSHRYADRAASILNTIANT----------YVRQNVEMRSAEAEK----TLEFL
A0A1M6VST0      TGVIGISYSHRYADRAASILNTIANT----------YVRQNVEMRSAEAEK----TLEFL
A0A2C8Y654      SGIIRVSMQHAYPDRVADILNSIANT----------YLKQNIEMRSAEAKK----TLDFL
A0A1M5J685      SGIIRVSMQHAYPDRVADILNSIANT----------YLKQNIEMRSAEAKK----TLDFL
A0A1M7JMJ6      SGIIRVSMQHAYPDRVADILNSIANT----------YLKQNIEMRSAEAKK----TLDFL
A0A254S3F1      SGIIRVSLENRYADRVAAILNTVANT----------YLKQNIEMRSAEAKK----TLMFL
A0A254SFQ7      SGIIRVSLENRYADRVAAILNTIANT----------YLKQNIEMRSAEAKK----TLAFL
A0A380S7L2      SGIIRVSLENRYADRVAAILNTIANT----------YLKQNIEMRSAEAKK----TLAFL
A0A1M7MCZ6      SGIIRVSLEDRYADRVAAILNTIANT----------YLKQNIEMRSAEAKK----TLMFL
A0A1X7KIP6      SGIIRVSLEDRYADRVAAILNTIANT----------YLKQNIEMRSAEAKK----TLMFL
A0A286A129      SGIIRVSFEHRYADRVAAILNTIANT----------YLKQNIEMRSAEAKK----TLAFL
C9RRK0          SGIIRVSLEDRYADRVAAILNTIANT----------YLKQNIEMRSAEAKK----TLSFL
A0A2M9A3A4      TGIIQMQIHHRYADRAAHILNSIADT----------YVRQNVESRSEEATK----TLEFL
A0A2P6UPN2      TGIIQMQIAHRYPDRAASILNSIADT----------YVRQNVEARSEEATK----TLAFL
A0A1M6RBQ2      TGIIGITYAHRYPDRAVSILNSLADV----------YLNQNIEMRSAEAAK----TLQFL
A0A316BGL2      TGIIGITYAHRYPDRAMSVLNSLTDV----------YLNQNIEMRSAEAAK----TLQFL
A0A1M6IQ57      SGIIAVSYSHRYADRAAGILNTVLNT----------YVRQNVEMRSAEAEK----TLEFL
A0A316ATY6      TGIITVSLKHRYADRSASILNAIADT----------YVRRNVEKRNAEAEK----SLKFL
A0A1T4QDW5      TGILTMNFSHRYPDRAAAILNAVANA----------YFRQNVEMRSAEAEK----TLAFL
A0A1M6VSY0      TGILTMNFSHRYPDRAAAILNAVANA----------YFRQNVEMRSAEAEK----TLAFL
A0A2A3HHG6      TGILTMNFSHRYPDRAAAILNAVANA----------YFRQNVEMRSAEAEK----TLAFL
C9RP30          TGIIEASYNHRYPDRAAAILNTIAKT----------YLRQNVEMRSAEAAK----TLEFL
A0A1M5V3U1      TGIIAVRYSHRYPDRAASILNTIAKT----------YLRQNVEMRSAEAEK----TLEFL
A0A1M7NG89      TGIISVRYSHRHPDRAASILNTIAKT----------YLRQNVEMRSAEAEK----TLEFL
A0A2C8YXS0      TGIISVRYSHRYPDRAASILNTIAKT----------YLRQNVEMRSAEAEK----TLEFL
A0A254RLK0      TGVIGVSFSHRYADRAASILNTIANT----------YVRQNVEMRSAEAEK----TLEFL
A0A1M6RGU5      TGVIGVSFSHRYADRAASILNTIANT----------YVRQNVEMRSAEAEK----TLEFL
A0A254SQM8      TGVIGVSFSHRYADRAASILNTIANT----------YVRQNVEMRSAEAEK----TLEFL
A0A316B5S0      TGIIGVSFTHQYPDRAAAILNSIANV----------YLRQNVEMRSAEAEK----TLEFL
A0A254RXS0      TGIIGVSYTHQYADRAASILNTIANI----------YLRQNVEMRSAEAEK----TLEFL
A0A1M6X012      TGIIGVSYTHQYADRAASILNTIANI----------YLRQNVEMRSAEAEK----TLEFL
A0A1M5TLF1      TGIIGVSYTHQYADRAASILNTIANI----------YLRQNVEMRSAEAEK----TLEFL
A0A2N3RVJ9      TGIIGVSYTHQYADRAASILNTIANI----------YLRQNVEMRSAEAEK----TLEFL
A0A1M6R2N3      TNIIEIAYQDRYPDRAAKVLNAVAQM----------YVRQNVEMRSAEAEK----SLEFL
A0A1N6GS15      TNIIEIAYQDRYPDRAAKVLNAVAQM----------YVRQNVEMRSAEAEK----SLEFL
A0A254SB44      SNILEISYSGRYPDRVADVLNAVAQA----------YVRQNVEMRSAEAEK----SLEFL
A0A1M7LKR0      SNILEVSFSGRYPDRVANVLNAIAQA----------YVRQNVEMRSAEAEK----SLEFL
A0A1X7JP42      SNILEVSFSGRYPDRVANVLNAIAQA----------YVRQNVEMRSAEAEK----SLEFL
A0A1M6UBQ0      SNILEISYSDRYPDRVAEVLNAIAQT----------YVRQNVEMRSAEAEK----SLDFL
A0A1X7IS68      TNIIEISYMDRYPDRAAAVLNAIAET----------YVRQNVEMRSAEAEK----SLEFL
                  :          :                      :.. .    . *  .    .* : 

A0A3C0PHK7      MVGSSTVDREIQEVERQLLQYKKSKEPVAIDPRVVVQWQ---ELRKSVLNKEND------
A0A0J7HV92      FSGLSNIDREIKDTERQLLQFQRQTSSVD-----PAVMRQWQELRKSVINKEAELELFKR
A0A1M6RVC1      EKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQLVLQRRMKLQQDILALQQRKQEAIR
A0A2N3RSN9      EKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQLVLQRRMKLQQDILALQQRKQEAIR
A0A1M5IPF7      EKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQLVLQRRMKLQQDILALQQRKQEAIR
A0A254RX70      EKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQLVLQRRMKLQQDILALQQRKQEAIR
A0A1M7GQ27      EKQLPAVKEQMDSSLLKFNTYRNKVGSVDIGAETQIILEKRNVLQQKLLDLQQKKQSAIR
A0A1X7JCK4      EKQLPAVKEQMDSSLLKFNTYRNKVGSVDIGAETQIILEKRNVLQQKLLDLQQKKQSAIR
A0A1M7HDE6      EKQLPEVKAQMDSAMLRFNSYRNRVGSVDINAETRLVLERRNKLQQDLLNLQQKKQDAIR
A0A2C9A7H2      EKQLPDVKMQMDSAMLRFNNYRNRVGSVDINAETRLVLERRNKLQQDLLSLQQKKQDAIR
A0A254SF58      EKQLPIVKAQMDSTLLKYNTYRNKVGSVDIYAETKLVLEKRNKLQQSLLELQQKKQSAIR
A0A316ANB4      EKQLPEVKAQMDSSLLKFNTYRNRVGSVDINAETRIVLEKRAKLQQDLLSLQQKKQDAIR
A0A1J5E847      EQQIPDVKLKLDSAEAELSAYRYQVGSVDINTETRIVLEGEMRLQQQILSLEQRREDAVR
A0A254RM08      EKQLPDVKAQMDSSLLNLNTYRNQVGSVDINAETQLVLQRRMRLQQDILSLQQKKQEAIR
A0A1M7CD42      EKQLPDVKAQMDSSLLNLNTYRNQVGSVDINAETQLVLQRRMRLQQDILSLQQKKQEAIR
A0A254SZB4      EKQLPDVKAQMDSSLLNLNTYRNQVGSVDINAETQLVLQRRMRLQQDILSLQQKKQEAIR
A0A1M5LBR0      EKQLPDVKAQMDSSLLNLNTYRNRVGSVDINAETQLVLQQRMKLQQDILALQQRKQSAIR
A0A1M7DJN3      EKQLPDVKAQMDSSLLNLNTYRNRVGSVDINAETQLVLQQRMKLQQDILALQQRKQSAIR
A0A1M6UFW9      EKQLPDVKAQMDSSLMNLNTYRNRVGSVDINAETQLVLQRRMKLQQDILALQQRKQEAIR
A0A1M6I669      EKQLPEVKSQMDSAMLRFNNYRNRVGSVDINAETRLVLEKRTKLQQDLLVLQQKKQDAIR
A0A1M6WDT9      EKQLPEIKARMDSSLLKYNTYRNKVGSVDINAETRIVLERRTKLQQDLLALQQKKQDAVR
A0A254RG57      EKQLPDVKAQMDSSLLKYNTYRNRVGSIDINAETRLVLEKRTKLQQNLLDLQQKKQSAIR
A0A254S791      EKQLPDVKAQMDSSLLKFNTYRNKVGSIDIDAETRLVLEKRTRLQQSLLELQQKKQSAIR
A0A285ZTW6      EKQLPDVKAQMDSSLLKFNTYRNKVGSVDIDAETRLILEKRNRLQQNLLDLQQKKQSAIR
A0A380S6W7      EKQLPDIKAQMDSSLLKFNTYRNKVGSVDIGAETQIILEKRNKLQQSLLDLQQRKQSAIR
A0A1M6V3G7      EKQLPDVKAQMDSSLLKFNTYRNKVGSIDIGAETQLILEKRNKLQQSLLDLQQKKQSAVR
A0A1N6J281      EKQLPDVKAQMDSSLLKFNTYRNKVGSIDIGAETQLILEKRNKLQQSLLDLQQKKQSAVR
A0A285ZYD6      EKQLPGVKAKLDSVEKILADYRYSIGSVDMTGETHAHLNKESEIQRQILDLEQQKQAAMR
A0A1M6S079      EKQLPGVRAKLDTAERILADYRHKIGSVDMTGETQVHLQKEVDLQKQLLRLEQERQEATR
A0A1M6WR43      EKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQVHLQKEVDLQKQLLKLQQEYQEATR
A0A2N3RVS2      EKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQVHLQKEVDLQKQLLKLQQEYQEATR
A0A1M5VRV4      EKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQVHLQKEVDLQKQLLKLQQEYQEATR
A0A254RLG7      EKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQVHLQKEVDLQKQLLKLQQEYQEATR
A0A1M6SHG3      EQQLPGVKAKLDSAEKNLADYRHKIGSVDMTGETRAHLEKDAALQRQILELEQQRQETTR
A0A1M6WJF1      EAQLPGVKAKLDTAEKALADYRLKIGSVDMSGETRSHLEKVAELEKQILELDQQRQEATR
A0A254RQS8      EEQLPGVKAKLDTAEKKLADYRLKIGSVDMTGETRVHLEKVSELEKQVLELEQQRQEATR
A0A1M6Z6I9      EEQLPGVKAKLDTAEKKLADYRLKIGSVDMTGETRVHLEKVTELEKQVLELEQQRQEATR
A0A254STU0      EDQLPGVKAKLDSAEKKLADYRLKIGSVDMTGETRVHLEKVSELEKQVLELEQQRQEATR
A0A1M5G181      EDQLPGVKAKLDTAEKKLADYRLKIGSVDMTGETKAHLEKVSELEKQVLELEQQRQEATR
A0A1M6VYU0      EEQLPGVKAKLDTAEKNLADYRLKIGSVDMTGETRVHLEKVSELEKQVLELEQQRQEATR
A0A1M7DAK0      EGQLPAVKAKLDSAEKILADYRYSIGSVDMTGETKAHLDKEGQLQRQIMQLEQERQAALR
A0A254SNB3      ESQLPGVKSKLDSAEKVLADYRHQIGSVDMTGETQAHLSKEMDLQRQLLQLEQQRQEATR
A0A380RVE7      ESQLPGVKSKLDSAEKVLADYRHQIGSVDMTGETQAHLSKEMDLQRQLLQLEQQRQEATR
A0A1M5F234      ETQLPGIKAKLDSSEKVLSDYRHSVGSVDMTGETRAHLDKEVDLQRQLLQLEQQRQQATR
A0A1M6VST0      ETRLPGIKATLDSSEKVLSDYRHSVGSVDMTGETRAHLDKEVDLQRQLLQLEQQRQEATR
A0A2C8Y654      EEQLPSVKAKLDSSEQKLTSFRNANGTIDLSGETRVHLEKDVSLQQRLLELEQKKQEALR
A0A1M5J685      EEQLPSVKAKLDSSEQKLTSFRNANGTIDLSGETRVHLEKDVSLQQRLLELEQKKQEALR
A0A1M7JMJ6      EEQLPSVKAKLDSSEQKLTSFRNANGTIDLSGETRVHLEKDVSLQQRLLELEQKKQEALR
A0A254S3F1      EEQLPGVKAKLDSAEQKLTSFRNAKGTIDLSGETRLHLEKDVTLQQRIIELEQKKQEVLR
A0A254SFQ7      EEQLPGVKAKLDSAEQKLTSFRNSKGTIDLTGETRVHLEKDVSLQQRLIELEQKKQEALR
A0A380S7L2      EEQLPGVKAKLDSAEQKLTSFRNSKGTIDLTGETRVHLEKDVSLQQRLIELEQKKQEALR
A0A1M7MCZ6      EEQLPGVKAKLDSAEQKLTSFRHANGTIDLTGETRVHLEKDVSLQQRLLELEQKKQEALR
A0A1X7KIP6      EEQLPGVKAKLDSAEQKLTSFRHANGTIDLTGETRVHLEKDVSLQQRLLELEQKKQEALR
A0A286A129      EEQLPGVKAKLDSAEQKLTSFRHANGTIDLSGETRVHLEKDVSLQQRLLELEQKKQEALR
C9RRK0          EEQLPGVKAKLDSAEQKLTSFRNSKGTIDLTGETRVHLEKDVSLQQRLIELEQKKQEALR
A0A2M9A3A4      EKQLPGVKAKLDSAEQILSSYRQEEGSIDLSGEARGVLEKRMQLEKSLLELQQKYEETTR
A0A2P6UPN2      EKQLPGVKAKLDSSEQVLSTYRKDEGSVDLNGEARNALEKRMELEKQLLELQQKHQEVSR
A0A1M6RBQ2      EEQLPGVKARLDSAEKKLADYRQSVGAVDLSVESQSLLKKEQDLTRQISALEQKRQETTR
A0A316BGL2      EEQLPSVKARLDSSEKKLADYRQSIGSVDVSVESQALMKKEHDLNVQIMNLEAKRQEATR
A0A1M6IQ57      EEQLPGVKAKLDSAEKVLADYRHSIGSVDMTGETRAHLDKEVNLQSQIIALEQERQKATR
A0A316ATY6      EKQLPSIKAKLDSSEKILADYRHKIGSVDLTGETQVHLQKEVDLQKQLLKLDQQYQEATR
A0A1T4QDW5      EEQLPAVKAKLDTSEKVLADYRFQVGSVDMTGETHALLEKETNLQKQLLELGAERQRLVR
A0A1M6VSY0      EEQLPAVKAKLDTSEKVLADYRFQVGSVDMTGETHALLEKETNLQKQLLELGAERQRLVR
A0A2A3HHG6      EEQLPAVKAKLDTSEKVLADYRFQVGSVDMTGETHALLEKETNLQKQLLELGAERQRLVR
C9RP30          EKQLPGVKAKLDSVEKILADYRYSIGSVDMTGETHAHLNKESEIQRQILDLEQQKQAAMR
A0A1M5V3U1      EAQLPGVKAKLDSAEKVLADYRYKIGSVDMTGETKAHLDKEGQLQRQIMQLEQERQAAMR
A0A1M7NG89      EGQLPGVKAKLDSAEKILADYRYKVGSVDISGETKAHLDKEGQLQRQIMQLEQERQSALR
A0A2C8YXS0      EGQLPGVKAKLDSAEKVLADYRHKVGSVDIGGETKAHLDKEGQLQRQIMQLEQERQSALR
A0A254RLK0      ESQLPGVKAKLDSSEKILADYRHSIGSVDMTGETQAHLNKEVDLQRQLLQLEQERQQATR
A0A1M6RGU5      ESQLPGVKAKLDSSEKVLADYRHSIGSVDMTGETQAHLNKEVDLQRQLLHLEQERQQATR
A0A254SQM8      ESQLPGVKAKLDSSEKVLADYRHSIGSVDMTGETQAHLNKEVDLQRQLLHLEQERQQATR
A0A316B5S0      EQQLPGVKAKLDSAEKNLADYRHKIGSVDMTGETRAHLEKDAALQRQILELEQQRQEATR
A0A254RXS0      ENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRTHLEKEANLEKQILELEQKRQEQTR
A0A1M6X012      ENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRTHLEKEANLEKQILELEQKRQEQTR
A0A1M5TLF1      ENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRTHLEKEANLEKQILELEQKRQEQTR
A0A2N3RVJ9      ENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRTHLEKEANLEKQILELEQKRQEQTR
A0A1M6R2N3      EKQLPTIKAKLDSAQQLLTNYRNKVGTVDLGAEAQGTLKRQVDLKTQLLALEQEYQEKSR
A0A1N6GS15      EKQLPTIKAKLDSAQQLLTSYRNKVGTVDLGAEARGTLDRQVQLKTQLLSLQQQYQEKSR
A0A254SB44      EEQLPSIKAKLDSSERLLTNYRNKMGTVDLGAEAKGTLERQVELKTQLLSLQQQYQEKAR
A0A1M7LKR0      EEQLPSIKAKLDSSERLLTDYRNKMGTIDLGAEAKGTLERQIALKTQLLSLQQEYQEKAR
A0A1X7JP42      EEQLPSIKAKLDSSERLLTNYRNKMGTIDLGAEAQGTLKRQVDLKAQLLMLQQEYQEKAR
A0A1M6UBQ0      EEQLPSIKAKLDSSERLLTNYRNKMGTVDLGAEAKGTLERQVELKTQLLSLQQQYHEKAR
A0A1X7IS68      EQQLPSIKAKLDSAQQLLTNYRNTVGTVDLGAEAQGTLKRQVELRTMLLASQQDYQEKSR
                    . :   :.        :.    .:               :   :            

A0A3C0PHK7      --------LELFKRRLESYNNAIKKYKNKNPDILTNSLELLRLQRSSEVYQNVYNVLLEK
A0A0J7HV92      RLDSYENAIQTYKQGNPHMLSE--------------SLELIRLQRSREVYENIYNILLSK
A0A1M6RVC1      LFHSEHPTVKTLEDQEDALKRELAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNN
A0A2N3RSN9      LFHSEHPTVKTLEDQEDALKRELAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNN
A0A1M5IPF7      LFHSEHPTVKTLEDQEDALKRELAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNN
A0A254RX70      LFHSEHPTVKTLEDQEDALKRELAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNN
A0A1M7GQ27      LFQPEHPTIKTLEEQENNLKRELANNTAATKRLPNTQQEVLKLTNEVDMSKHMYTTMLNN
A0A1X7JCK4      LFQPEHPTIKTLEEQENNLKRELANNTAATKRLPNTQQEVLKLTNEVDMSKHMYTTMLNN
A0A1M7HDE6      LFQPEHPTIKTYEEQEATIKRELAHNTSESKKLPATQQEVLKLNNEVDLTKIMYTTMLNN
A0A2C9A7H2      LFQPEHPTIKTYEEQEAAIKRELAHNTSESKRLPATQQEVLKLNNEVDLTKIMYTTMLNN
A0A254SF58      LFQPEHPTIKTLEEQENNLKRELANNTAATKKLPNTQQEVLKLTNEVDMSKLMYTTMLNN
A0A316ANB4      LFQPEHPTVKTLEEQENALKRELSTNSSEARRLPATQQEVLKLTNEVDMSKIMYTSMLNN
A0A1J5E847      LFHEEHPSVKTLDEQINNLRKELAESSHQARKLPSTQQEILRLASEVELDKLLYTNMLNS
A0A254RM08      LFHSEHPTVKTLEDQENALRRELAGTSSEVKKLPATQQEVLKLQNEVELTKVMYTSLLNN
A0A1M7CD42      LFHSEHPTVKTLEDQENALRRELAGTSSEVKKLPATQQEVLKLQNEVELTKVMYTSLLNN
A0A254SZB4      LFHSEHPTVKTLEDQENALRRELAGTSSEVKKLPATQQEVLKLQNEVELTKVMYTSLLNN
A0A1M5LBR0      LFHAEHPSVKTLEEQENALKRELAGTSSAVKKLPATQQEVLKLQNEVELAKVMYTTMLNN
A0A1M7DJN3      LFHAEHPSVKTLEEQENALKRELAGTSSAVKKLPATQQEVLKLQNEVELAKVMYTTMLNN
A0A1M6UFW9      LFHSEHPTVKTLEDQEDALRRELAGTSSEVKKLPATQQEVLKLQNQVELTKVMYTTMLNN
A0A1M6I669      LFQPEHPTIKTYEEQENALKRELASNTSESKKLPATQQEVLKLSNEVELTKVMYTTMLNN
A0A1M6WDT9      LFQPEHPTVKTLEDQEAALKRELYSNSSEAKKLPATQQEVLKMTNEVDISKVMYTSMLNN
A0A254RG57      LFQPEHPTIKTLEEQENALKRELASNYNETKKLPSTQQEVLKLTNEVDMSKIMYTTMLNN
A0A254S791      LFQPEHPTIKTLEEQEAAIKRELALNSNETKKLPATQQEVLKLTNEVDMSKIMYTTMLNN
A0A285ZTW6      LFQPEHPTIKTLEEQENNLKRELASTSIATKKLPNTQQEVLKLTNEVDMSKIMYTTMLNN
A0A380S6W7      LFQPEHPTIKTLEDQENNIKRELASNYAATKKLPNTQQEVLKLTNEVEMSKHLYTTMLNN
A0A1M6V3G7      LFQPEHPTIKTLEDQESNLKRELASNYAATKKLPNTQQEVLKLTNEVDMSKHMYTTMLNN
A0A1N6J281      LFQPEHPTIKTLEDQESNLKRELASNYAATKKLPNTQQEVLKLTNEVDMSKHMYTTMLNN
A0A285ZYD6      LFKEEHPSVQTLIRQQNRLRAELAKLKKTAEKMPLTQQEVARLKEDVAVNNEIYTTMLNN
A0A1M6S079      LFKEEHPSVQTLTKQQDKLRRELAKLKSSAEKMPLTQQEVMRLQEDVQVNNAIYNTMLNN
A0A1M6WR43      LFKDEHPAVRTIAKQQDKLKGELSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNN
A0A2N3RVS2      LFKDEHPAVRTIAKQQDKLKGELSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNN
A0A1M5VRV4      LFKDEHPAVRTIAKQQDKLKGELSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNN
A0A254RLG7      LFKDEHPAVRTIAKQQDKLKGELSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNN
A0A1M6SHG3      LFKEEHPSVQTIVKQQNRLRAELSKLKNSAEKMPLTQQEVLRLQEEVAVQNAQYTSMLNN
A0A1M6WJF1      LFKEEHPAVQTIMQQQGRLRSELSRLKKSAENMPRTQQDVLSLQEEVAVNNAQYTAMLNN
A0A254RQS8      LFKEEHPAVQTIMQQQSRLRSELSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNN
A0A1M6Z6I9      LFKEEHPAVQTIMQQQSRLRSELSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNN
A0A254STU0      LFKEEHPAVQTIMQQQSRLRSELSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNN
A0A1M5G181      LFKEEHPAVQTIMQQQSRLRSELSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNN
A0A1M6VYU0      LFKEEHPSVQTIVQQQNRLRAELSRLKKSAENMPKTQQDVRSLQEEVAVNNAQYTAMLNN
A0A1M7DAK0      LFKEEHPNVQTIVKQQSKLRAELAALKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNN
A0A254SNB3      LFKEEHPAVVTIVKQEAKLRRELSRLKKNAESMPITQQEVLRLQEDVAVNNAQYTSMLNN
A0A380RVE7      LFKEEHPAVVTIVKQEAKLRRELSRLKKNAESMPITQQEVLRLQEDVAVNNALYTNMLNN
A0A1M5F234      LFKEEHPSVQTIVKQQDRLRGELARLKKSAESMPVTQQEMIRLQEDVALNNAQYTAMLNN
A0A1M6VST0      LFKEEHPSVQTIVKQQDKLRGELARLKKSAESMPVTQQEMIRLQEDVSLNNAQYTAMLNN
A0A2C8Y654      LFQAEHPTVRTIEQQQARLYGELAKQKKAADKLPKTQQEFLSLQEEVEVNNKLYTNLLNN
A0A1M5J685      LFQAEHPTVRTIEQQQARLYGEIAKQKKAADKLPKTQQEFLSLQEEVEVNNKLYTNLLNN
A0A1M7JMJ6      LFQAEHPTVRTIEQQQARLYGEIAKQKKAADKLPKTQQEFLSLQEEVEVNNKLYTNLLNN
A0A254S3F1      LFRAEHPTVRTIEEQQARLRRELARQQRSASSLPVLQQEVLSLQEEVEVNNKLYTNLLNN
A0A254SFQ7      LFRAEHPTVRTIEEQQSRLRRELAKQQRSAATLPVVQQEVLSLQEEVEVNNKLYTNLLNN
A0A380S7L2      LFRAEHPTVRTIEEQQSRLRRELAKQQRSAATLPVVQQEVLSLQEEVEVNNKLYTNLLNN
A0A1M7MCZ6      LFRAEHPTVRTIEEQQSKLRREIAKQQRSAASLPVVQQEVLSLQEEVEVNNKLYTNLLNN
A0A1X7KIP6      LFRAEHPTVRTIEEQQSKLRREIAKQQRSAASLPVVQQEVLSLQEEVEVNNKLYTNLLNN
A0A286A129      LFRAEHPTVRTIEEQQSRLRREIAKQQRSAASLPVVQQEVLSLQEEVEVNNKLYTNLLNN
C9RRK0          LFRAEHPTVRTIEEQQSRLRRELAKQQRSAANLPVVQQEVLSLQEEVEVNNKLYTNLLNN
A0A2M9A3A4      LFKEDHPTVLSLKKQQNQLRREMAKLSEETKDLPTKQQEILRLQGDVNVNNAIYTNMLNN
A0A2P6UPN2      LFKEDHPNVISLKKQQAQIRREMAKLSDETKDLPEKQQEILRLQGDVEVNNSIYTNMLNN
A0A1M6RBQ2      LFKAEHPSVQAITRQLSKARSELNKLKNDAGKMPATQQEMLALQEQVATNNAQYTSMLNN
A0A316BGL2      LFKSEHPSVQTITRQLSRLRNELSKLKTDAEKMPLTQQEILTMQEEVAANNAQYTSMLNN
A0A1M6IQ57      LFKEEHPSVQTIKKQQDKLRGELAKLKRSAEKMPLTQQEVMRLQEEVQVNNQVYTTMLNN
A0A316ATY6      LFKQEHPAVQTIAKQQNKLRAELAKLKANAEKMPLTQQEVLRLQEDVQVNNAIYNTMLNN
A0A1T4QDW5      LFTEEHPNVQTIVAQQQRIQNELNRLKKNAEKMPKTQQEILRLQADLSVNNTVYLDMLNK
A0A1M6VSY0      LFTEEHPNVQTIVAQQQRIQNELNRLKKNAEKMPKTQQEILRLQADLSVNNTVYLDMLNK
A0A2A3HHG6      LFTEEHPNVQTIVAQQQRIQNELNRLKKNAEKMPKTQQEILRLQADLSVNNTVYLDMLNK
C9RP30          LFKEEHPSVQTLIRQQNRLRAELAKLKKTAEKMPLTQQEVARLKEDVAVNNEIYTTMLNN
A0A1M5V3U1      LFKAEHPNVQTIVKQQNKLRVELAALKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNN
A0A1M7NG89      LFKAEHPNVQTIVKQQNKLRAELAALKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNN
A0A2C8YXS0      LFKAEHPNVQTIVKQQNKVKAELAQLKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNN
A0A254RLK0      LFKEEHPSVQTIVKQQNRLRGELARLKKTAESMPVTQQEIIRLQEEVSVNNAQYTAMLNN
A0A1M6RGU5      LFKEEHPSVQTIVKQQNRLRGELARLKKTAESMPVTQQEMIRLQEEVSVNNAQYTAMLNN
A0A254SQM8      LFKEEHPSVQTIVKQQNRLRGELARLKKTAESMPVTQQEMIRLQEEVSVNNAQYTAMLNN
A0A316B5S0      LFKEEHPSVQTIVKQQNRLRAELSKLKNSAEKMPLTQQEVLRLQEEVAVQNAQYTSMLNN
A0A254RXS0      LFKDEHPAVVTIVKQQDRLRTELARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNN
A0A1M6X012      LFKDEHPAVVTIVKQQDRLRAELARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNN
A0A1M5TLF1      LFKDEHPAVVTIVKQQDRLRAELARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNN
A0A2N3RVJ9      LFKDEHPAVVTIVKQQDRLRAELARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNN
A0A1M6R2N3      LFKQDHPAMQAILSQQGRIRKEISKEEGKVKALPVTQQDVLKLKQDVELNNELYTSILNN
A0A1N6GS15      LFKQDHPAMQAILSQQERIRKEIGKEEGKVKALPVTQQDVLKLQQDVELNNELYTSVLNN
A0A254SB44      LFKEDHPAMQALLQQQQRLNREIGKEESKTKKLPITQQDVLKLQQDVEINNQLYTSVLNN
A0A1M7LKR0      LFKEDHPAMQAIVQQQQRLSREIGKEENKTKKLPTTQQDVLKLQQDVEINNQLYTSVLNN
A0A1X7JP42      LFKEDHPAMQAILQQQQRLGKEIAMEEGKTKKLPTTQQDVLKLQQDVEINNQLYTSVLNN
A0A1M6UBQ0      LFKEDHPAMQAILQQQQRLSHEIGKEESKTKKLPITQQDVLKLQQDVEINNQLYTSVLNN
A0A1X7IS68      LFKQDHPVMQALLQQQARLKKEIGIEENKTKKLPTTQQDVLKLQQDVEINNELYTSVLNN
                        :                           . :.  :  .    :  *  :*..

A0A3C0PHK7      AEEERMLNTSSSAGIKIVDIARKPDNPMPKNENRYYAVGIILGLFLGIALAMILEFNDT-
A0A0J7HV92      AEEQRIKSRSSGMGLKIVDMPEMPQAPMPKNEAGYYTLGILLGLGLGISLAFLAEYNDT-
A0A1M6RVC1      IQQLRLVSAGEVGSVRIVDFAEKALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSS-
A0A2N3RSN9      IQQLRLVSAGEVGSVRIVDFAEKALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSS-
A0A1M5IPF7      IQQLRLVSAGEVGSVRIVDFAEKALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSS-
A0A254RX70      IQQLRLVSAGEVGSVRIVDFAEKALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSS-
A0A1M7GQ27      IQQLKLVSAGEVGSVRIIDFAEEVSRPMKPKKSMIIFAMLFLGLLTGATFVTLRSKFSN-
A0A1X7JCK4      IQQLKLVSAGEVGSVRIIDFAEEVSRPMKPKKSMIIFAMLFLGLLTGATFVTLRSKFSN-
A0A1M7HDE6      IQQLKLVSAGEVGTVRIIDYAEQVRKPTKPKKKIILCVALFLGFLFGAALVSIKSKFSN-
A0A2C9A7H2      IQQLKLVSAGEVGTVRIIDYAEQVTRPAKPKKKIIVCIALILGLLFGFALISLKKKMSS-
A0A254SF58      IQQLKLVSAGEVGSVRIIDFAEEVFRPIKPKKSLIVCIALFLGFLIGASISTLKSKISN-
A0A316ANB4      IQQLKLVSAGEVGSVRIIDFAEPVNKPTKPKKKIILLVALFIGFLVGATIVSIKSKLSS-
A0A1J5E847      IQQLRLVAAGEVGSVRIVDYAEQETKPVQPRKKMILMVALFLGFCASVVYVSVKKKFHS-
A0A254RM08      IQQLRLVSAGEVGSVRVVDFAEQVTKPAKPKKRVILCMALFLGFLLGAMLVSIKSKFSS-
A0A1M7CD42      IQQLRLVSAGEVGSVRVVDFAEQVTKPAKPKKRVILCMALFLGFLLGAMLVSIKSKFSS-
A0A254SZB4      IQQLRLVSAGEVGSVRVVDFAEQVTKPAKPKKRVILCMALFLGFLLGAMLVSIKSKFSS-
A0A1M5LBR0      IQQLRLVSAGEVGSVRIIDFAEQVTKPTKPKKKIILCVALFLGFLLGAAIVSIKSKVSS-
A0A1M7DJN3      IQQLRLVSAGEVGSVRIIDFAEQVTKPTKPKKKIILCVALFLGFLLGAAIVSIKSKVSS-
A0A1M6UFW9      IQQLRLVSAGEVGSVRIIDFAEQVTVPTKPKKKVILCVALFLGFLLGATIVSIKSKFSS-
A0A1M6I669      IQQLKLVSAGEVGSVRIIDFAEQVSRPTKPKKKMIVLIALFFGLLLGAAIVSIKSKFSN-
A0A1M6WDT9      IQQLKLVSAGEVGSVRIIDFAEQVTQPAKPNKKMIIVAFLFMGLLLGCAIVTIKSKFSN-
A0A254RG57      IQQLKLVSAGEVGSVRIIDFAEPALRPAKPKKPLIISAALFIGLLFGFALISIKSKLSS-
A0A254S791      IQQLKLVSAGEVGSVRIIDFAEEVKKPSKPRKTVIVCIALFFGVLLGACIALLKSKFSN-
A0A285ZTW6      IQQLKLVSAGEVGSVRIIDFAEEVTRPAKPKKSLIICVALFLGFLLGACIATLKSKLSN-
A0A380S6W7      IQQLKLVSAGEVGSVRIIDFAEEVSRPFKPKKGMVVFISLFLGLIFGAVIISIKSKLNS-
A0A1M6V3G7      IQQLKLVSAGEVGSVRIIDFAEEVSSPIKPKKSMIVCVALFIGLLFGTLIISIKSKFNN-
A0A1N6J281      IQQLKLVSAGEVGSVRIIDFAEEVSSPIKPKKSMIVCVALFIGLLFGTLIISIKSKFNN-
A0A285ZYD6      IQQLRVVRAGEVGNVRIVDFAQINGAPSKPKKMNIIICSVAASFMLGVLLVFLLRMMHN-
A0A1M6S079      IEQLRVVRAGEVGNVRVVDYAMVEDRPSKPKKMRILLGAIAASFVLASLLIYLLRMLHN-
A0A1M6WR43      IQQLRVVRAGEVGNVRVVDYAMVEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHN-
A0A2N3RVS2      IQQLRVVRAGEVGNVRVVDYAMVEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHN-
A0A1M5VRV4      IQQLRVVRAGEVGNVRVVDYAMVEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHN-
A0A254RLG7      IQQLRVVRAGEVGNVRVVDYAMVEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHN-
A0A1M6SHG3      IQQLRVVRAGEVGTVRVVDYAQIERLPSKPNKKMIFLGCVAGAFLLGALLIYLLQMTKR-
A0A1M6WJF1      IQQLRVVRAGEVGNVRIVDYAQIEREPSKPNKKVIFAGCVGGCFLLGALLIYLLQMTKR-
A0A254RQS8      IQQLRVVRAGEVGNVRIVDYAQIERRPSKPNKKMIFLACVGGAFLLGALLIYLLQMTKR-
A0A1M6Z6I9      IQQLRVVRAGEVGNVRIVDYAQIERKPSKPNKKVIFAGCVGGAFLLGALLIYLLQMTKR-
A0A254STU0      IQQLRVVRAGEVGNVRIVDYAQIERKPSKPNKKVIFAGCVGGAFLLGALLIYLLQMTKR-
A0A1M5G181      IQQLRVVRAGEVGNVRIVDYAQVERKPSKPNKKVVFAGCVGGSFLLGALLLYLLQMTKR-
A0A1M6VYU0      IQQLRVVRAGEVGNVRIVDYAQIERRPSKPNKKVVFAGCVGGSFLLGALLLYLLQMTKR-
A0A1M7DAK0      IQQLRVVRAGEVGNVRIVDFAQIEQSQSKPNKSRIVLVSAVAGFMLGVLFVLLTYLLRN-
A0A254SNB3      IQQLRVVRAGEVGNVRIVDFAQIEPIQSKPKKLNILICSMAASFMLGVLLVFLLRMMKN-
A0A380RVE7      IQQLRVVRAGEVGNVRIVDFAQIEPIQSKPKKLNILICSMAASFMLGVLLVFLLRMMKN-
A0A1M5F234      IQQLRVVRAGEVGNVRVVDFAQIEPIQSKPKKLNILVCCMAASFMVGVLLVFMLRMMRN-
A0A1M6VST0      IQQLRVVRAGEVGNVRVVDFAQIEPIQSKPKKFNILVCSMAASFMVGVLLVFLLRMMRN-
A0A2C8Y654      IQQLRVVQAGEVGNVRIVDQAYVPIKPAKPNRKLIFGGVALAFLLLGCAIVLVRRMSHN-
A0A1M5J685      IQQLRVVQAGEVGNVRIVDQAYVPIKPAKPNRKLIFGGVALAFLLLGCAIVLVRRMSHN-
A0A1M7JMJ6      IQQLRVVQAGEVGNVRIVDQAYVPIKPAKPNRKLIFGGVALAFLLLGCAIVLVRRMSHN-
A0A254S3F1      IQQLRVVQAGEVGNVRIVDQAYEPLKPNKPNRKLIFLGVMGAFLLLGCFIVYIRRLLSN-
A0A254SFQ7      IQQLRVVQAGEVGNVRIVDQAYAPLLPSKPNRKLIFLGVVAAFLLLGCFIVYIRRMLAN-
A0A380S7L2      IQQLRVVQAGEVGNVRVVDKAYEPLKPSKPNRKLIFLGVVAAFLLLGCFIVYIRRMLAN-
A0A1M7MCZ6      IQQLRVVQAGEVGNVRIVDQAYVPLKPSKPKRKLVFLGVVFAFLLLGCFIVYIRRILSN-
A0A1X7KIP6      IQQLRVVQAGEVGNVRIVDQAYVPLKPSKPKRKLVFVGVVFAFLLLGCFIVYIRRILSN-
A0A286A129      IQQLRVVQAGEVGNVRIVDQAYVPLKPAKPNRKLVFLGVVFAFLLLGCFIVYVRRMLSN-
C9RRK0          IQQLRVVQAGEVGNVRIVDQAYVPLKPSKPNRKLVFVGVVFAFLLLGCLIVYVRRMLSN-
A0A2M9A3A4      IQQLRVVQAGEVGNVRVVDYARIEIKPVKPRKLVILLGFIAGGFILGACLIFVLRLLSSR
A0A2P6UPN2      IQQLRVVQAGEVGNARIVDRARMEIRPVKPQKSVILLGSIVGGFILGAVFVFLYRMIFNR
A0A1M6RBQ2      IQQLRTVRAGEVGTVTVVDYAVEDNEQIKPRKARIFFWSVGIFLFAGVMLVLLMRLFR-N
A0A316BGL2      IQQLRTVRAGEVGTASVVDYAVEDSEQIKPRKAVIFLWSVAIAFAIGVLLVVFIRLFR-N
A0A1M6IQ57      IQQLRVVRAGEVGNVRIVDAAQIEPIQSKPKKFNIFVCSIAASFMVGVLLVFVLRMFK-N
A0A316ATY6      IEQLRVVRAGEVGNVRVVDYAMVEDRPSKPKKTHILMGAIAASFVMAALLIYLLRMLH-N
A0A1T4QDW5      IQQFRVVRAGAIGNVRIVDYAQVETKPSKPKKTMIVLGSVAGGFVLGVLIIFFLRALSPR
A0A1M6VSY0      IQQFRVVRAGAIGNVRIVDYAQVETKPSKPKKTMIVLGSVAGGFVLGVLIIFFLRALSPR
A0A2A3HHG6      IQQFRVVRAGAIGNVRIVDYAQVETKPSKPKKTMIVLGSVAGGFVLGVLIIFFLRALSPR
C9RP30          IQQLRVVRAGEVGNVRIVDFAQINGAPSKPKKMNIIICSVAASFMLGVLLVFLLRMMH-N
A0A1M5V3U1      IQQLRVVRAGEVGNVRIVDFAQAEQSQTKPNKSRIIMASIVFGFIFGVLFVFLMYILR-N
A0A1M7NG89      IQQLRVVRAGEVGNVRIVDFAQVEQSQTKPNKSRILMASVVFGFIFGVLFVFLMYILR-N
A0A2C8YXS0      IQQLRVVRAGEVGNVRIVDFAQIEPSQSKPNKSRIIIASVAFGFALGILFVVLMRILK-N
A0A254RLK0      IQQLRVVRAGEVGNVRIVDFAQIEPIQSKPKKFNILVCSMAAAFMLGVLWVFMLRMMR-N
A0A1M6RGU5      IQQLRVVRAGEVGNVRIVDFAQVEPIQSKPKKFNILICSMAAAFMLGVLWVFMLRMMH-N
A0A254SQM8      IQQLRVVRAGEVGNVRIVDFAQVEPIQSKPKKFNILICSMAAAFMLGVLWVFMLRMMR-N
A0A316B5S0      IQQLRVVRAGEVGNVRVVDYAQIERKPSKPNKKMIFLGCVAGAFLLGALLIYLLQMTK-R
A0A254RXS0      IQQLRVVRAGEVGNVRIVDYAQIERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTK-R
A0A1M6X012      IQQLRVVRAGEVGNVRIVDYAQIERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTK-R
A0A1M5TLF1      IQQLRVVRAGEVGNVRIVDYAQIERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTK-R
A0A2N3RVJ9      IQQLRVVRAGEVGNVRIVDYAQIERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTK-R
A0A1M6R2N3      IQQLRVVRASEIGNVRIVDPAYIHWKPVKPKRKMIVLAGLGGGFGFAWVLVLLLHRIRNR
A0A1N6GS15      IQQLRVVRASEIGNVRIVDPAYIHRKPIKPKRKMIALAGLGGGFAFAWVLVLMLHRMRNR
A0A254SB44      IQQLRVVRASEIGNVRVVDPAYIHEKPSKPNRKKIMAAGLGGGFAFSVVLIYLLHLIGGR
A0A1M7LKR0      IQQLRVVRASEIGNVRIVDPAYVREKPSKPNRKKIMLAGFGGGFAFSVILIYLLHTMRNR
A0A1X7JP42      IQQLRVVRASEIGNVRIVDPAYVREKPSKPNRKKIMLAGFGGGFAFSVILIYLLHTMRNR
A0A1M6UBQ0      IQQLRVVRASEIGNVRIVDPAYIHVKPSKPNRKKIMAAGFGGGFALSLVLIYLLHTLSNR
A0A1X7IS68      MQQLRVVRASEIGNVRIVDKAYIDAKPAKPNRKKITLAGFAGGLGFGCILVILLQRIRNR
                 :: .    .      ::* .         .            .  .     .       

A0A3C0PHK7      TIKSNEDVERYLGESILGTIPHIAHNKKDDIQIKRRSAKSKHAMSVVQYPRQILNFSGDD
A0A0J7HV92      TIKTNEDVEKYLRLSVLGTIPHIVCNKKKDIEVRRFSSKKKDKLTVNQYPRQVFTFTGDD
A0A1M6RVC1      GVKSASFIEKETGFTVYAKVP-------------KGNPQGTKGTRP-------LAVVEPD
A0A2N3RSN9      GVKSASFIEKETGFTVYAKVP-------------KGNPQGTKGTRP-------LAVVEPD
A0A1M5IPF7      GVKSASFIEKETGFTVYAKVP-------------KGNPQGTKGTRP-------LAVVEPD
A0A254RX70      GVKSASFIEKETGFTVYAKVP-------------KGNPQGTKGTRP-------LAVVEPD
A0A1M7GQ27      GVRDANFIERETGFSVYAKVP-------------KGNPNGTKGTRP-------LAVVEPD
A0A1X7JCK4      GVRDANFIERETGFSVYAKVP-------------KGNPNGTKGTRP-------LAVVEPD
A0A1M7HDE6      GVRDPNFIEKETGFSVYAKIP-------------KGNPNGTKGTRP-------LAVVEPD
A0A2C9A7H2      GVRDANFIEKETGFSVFAKIP-------------KGNPNGTKGTRP-------LAVVEPD
A0A254SF58      GVRDAHFIERETGYSVYAKVP-------------KGNPKGTKGTRP-------LAVVEPD
A0A316ANB4      GVKDANFIERETGYSVYAKVP-------------KGNPNGTKGTRP-------LAVVEPD
A0A1J5E847      GIKDSRVIERELGISVYAKIP-------------KGAASGTLGTLP-------LAVAFPD
A0A254RM08      GVKSASFIEKETGYTVYAKVP-------------KGNPKGTKGTRP-------LAVVEPD
A0A1M7CD42      GVKSASFIEKETGYTVYAKVP-------------KGNPKGTKGTRP-------LAVVEPD
A0A254SZB4      GVKSASFIEKETGYTVYAKVP-------------KGNPKGTKGTRP-------LAVVEPD
A0A1M5LBR0      GVKSANFIEKETGFTVYAKVP-------------KGNPKGTKGTRP-------LAVVEPD
A0A1M7DJN3      GVKSANFIEKETGFTVYAKVP-------------KGNPKGTKGTRP-------LAVVEPD
A0A1M6UFW9      GVKSANFIEKETGFTVYAKVP-------------KGNPKGTKGTRP-------LAVVEPD
A0A1M6I669      GVRDAHFIERETGYSVYAKVP-------------KGNPKGTKGTRP-------LAVVEPD
A0A1M6WDT9      GVRDAHFIERETGFSVYAKIP-------------KGNPNGTKGTRP-------LAVVEPD
A0A254RG57      GVRDANFIERETGFSVYAKVP-------------KGNPKGTKGTRP-------LAVVEPD
A0A254S791      GVRDAHFIERETGFSVYAKVP-------------KGNPKGTKGTCP-------LAVVEPD
A0A285ZTW6      GVRDAHFIERETGYSVYAKVP-------------KGNPKGTKGTRP-------LAVVEPD
A0A380S6W7      GVRDANLIERETGFSVYAKVP-------------KGNPNGTKGTRP-------LAVVEPD
A0A1M6V3G7      GVRDANFIERETGFSVYAKVP-------------KGNPNGTKGTRP-------LAVVEPD
A0A1N6J281      GVRDANFIERETGYSVYAKVP-------------KGNPNGTKGTRP-------LAVVEPD
A0A285ZYD6      GVRSVTEIERETNTSVLAKVP-------------QYPDTGLNLKFR-KTRKT-HVQTDPD
A0A1M6S079      GVRSSNDVENTTGVSVYAKIP-------------EHHGKTSKSKK--R--IP-VVISEPE
A0A1M6WR43      GVRSTTEVEKATSISVFAKIP-------------ERRGKVMKARR--RNLVP-LVVSQPE
A0A2N3RVS2      GVRSTTEVEKATSISVFAKIP-------------ERHGKVMKARR--RNLVP-LVVSQPE
A0A1M5VRV4      GVRSTTEVEKATSISVFAKIP-------------ERRGKVMKARR--RNLVP-LVVSQPE
A0A254RLG7      GVRSTTEVEKATSISVFAKIP-------------ERRGKVMKARR--RNLVP-LVVSQPE
A0A1M6SHG3      GVRSSLEIERETGVSVYAKIP-------------ESDNSLLSRRKKGKNTLP-LVDESPD
A0A1M6WJF1      GVRSSLEIERETGISVYAKIP-------------KAENAILSKRNKGKYTKP-LVEDDPE
A0A254RQS8      GVRSSLEIERETGISVYAKIP-------------KAENAILSKRNKGKNTKP-LVEDDPD
A0A1M6Z6I9      GVRSSLEIERETGISVYAKIP-------------KAENAILLKRNKGKNTKP-LVEDDPD
A0A254STU0      GVRSSLEIERETGISVYAKIP-------------KAENAILLKRNKGKNTKP-LVEDDPD
A0A1M5G181      GVRSSLEIERETGISVYAKIP-------------KAENAILLKRNKGKNTKP-LVEDDPD
A0A1M6VYU0      GVRSSLEIERETGISVYAKIP-------------KAENAILLKRNKGKNTKP-LVEDDPD
A0A1M7DAK0      GVKSASEIERETGLSVFAKIP-------------QSRNRLLRGHRHLHHGAP-FVLQNID
A0A254SNB3      GVRSSQELEHATDVSVFAKIP-------------VSKNKVVRNK---HNAMT-LVESSPN
A0A380RVE7      GVRSSQELEHATDVSVFAKIP-------------VSKNKVVRNK---HNAMT-LVESSPN
A0A1M5F234      GIRSSQELEHATNVSVFAKIP-------------ESKNRLVKDK---RRKLT-LVESSPN
A0A1M6VST0      GIRSSQELEHATNVSVFAKIP-------------ESKNRLVKDK---RRKLT-LVESSPN
A0A2C8Y654      GVASSTEVEQATGIGVYGKLP-------------MLGKGTENNV---LD--P-VVHEKPD
A0A1M5J685      GVASSTEVEQATGIGVYGKLP-------------MLGKGTENNV---LD--P-VVHEKPD
A0A1M7JMJ6      GVASSTEVEQATGIGVYGKLP-------------MLGKGTENNV---LD--P-VVHEKPD
A0A254S3F1      GVCSSSEVEQATGVGVYGKLP-------------MLDGKTLNDV---YK--P-CVATNPD
A0A254SFQ7      GVCSSSEVEQATGVGVYGKLP-------------MLDGKTQNDV---MK--P-CVSVKPD
A0A380S7L2      GVCSSSEVEQATGVGVYGKLP-------------MLDGKTQNDV---MK--P-CVSVKPD
A0A1M7MCZ6      GVCSSSEVEQATGIGVYGKLP-------------MLDGRTQNDV---TK--P-CVSTNPD
A0A1X7KIP6      GVCSSSEVEQATGIGVYGKLP-------------MLDGRTQNDV---TK--P-CVSTNPD
A0A286A129      GVCSSSEVEQATGIGVYGKLP-------------MLDGKTQNDV---YK--P-CVSTNPD
C9RRK0          GVCSSSEVEQATGVGVYGKLP-------------MLDRKTQNDV---TK--P-CVVTNPD
A0A2M9A3A4      GIRSSSDVERETGVSVYAKVP-------------ETAQMKKMKK---MKTFS-LVEVDSE
A0A2P6UPN2      GIRTSRELEQATGVSVYAKIP-------------ELKERK--------KSFT-LIEEGGE
A0A1M6RBQ2      GVRNALEIERKTGVSVYAKVP-------------ESSNRDLKKKSRKGTLP--LVCCCPE
A0A316BGL2      GVRNSLEIERRTGISVYAKVP-------------ESGNRDLKKKDRKGTLP--LVCSNPE
A0A1M6IQ57      GVRGSTEIERETDMSVYAKIP-------------ESHHKHTRSKHKTS-----LVEAAPN
A0A316ATY6      GVRSSTEVENTTGVSVYAKIP-------------EHHGKSSKSKKRRP-----IVITDPE
A0A1T4QDW5      GVRSSVELERETGEVVLAKIP-------------RTFSRVLTNRRRSGEGNPILVLEDPD
A0A1M6VSY0      GVRSSVELERETGEVVLAKIP-------------RTFSRVLTNRRRSGEGNPILVLEDPD
A0A2A3HHG6      GVRSSVELERETGEVVLAKIP-------------RTFSRVLTNRRRSGEGNPILVLEDPD
C9RP30          GVRSVTEIERETNTSVLAKVP-------------QNPDTGLNL-KFRKTRKT-HVQTDPD
A0A1M5V3U1      GVKSTSRIERETGLSVFAKIP-------------QSSHKFLRTNKRVHHSAP-FVLQNPE
A0A1M7NG89      GAKSASEIERETGLSVFAKIP-------------QSTHKLLRGHKHLHHGAP-FVLQNAE
A0A2C8YXS0      GVRSASEIERETGLSVFAKIP-------------QSTHKFLRANTRVHHSAP-FVLQNTE
A0A254RLK0      GIRSSQELEHATEVSVFAKIP-------------ESKNRLL---RDKRHKLT-LVEAAPN
A0A1M6RGU5      GVRSSQELEHATEVSVFAKIP-------------ESRNRLL---RDKRHKLT-LVEASPN
A0A254SQM8      GVRSSQELEHATEVSVFAKIP-------------ESRNRLL---RDKRHKLT-LVEASPN
A0A316B5S0      GVRSSLEIERATGVSVYAKIP-------------ESDNNILHHRKKGKNTLP-LVEQSPD
A0A254RXS0      GVRSSLEIERETGVSVYAKIP-------------KSENSILSLRKKGKNTLP-LVEEDPE
A0A1M6X012      GVRSSLEIERETGVSVYAKIP-------------KSENSILSLRKKGKNTLP-LVEEDPE
A0A1M5TLF1      GVRSSLEIERETGVSVYAKIP-------------KSENSILSLRKKGKNTLP-LVEEDPE
A0A2N3RVJ9      GVRSSLEIERETGVSVYAKIP-------------KSENSILSLRKKGKNTLP-LVEEDPE
A0A1M6R2N3      GVGSSSEIERETGVSVYAKVP-------------KT--HISHKLPGVNDKRFILAKADSE
A0A1N6GS15      GVGSSSEIERETGVSVYAKVP-------------KT--HISHKLPGVNDKRFILAKADSE
A0A254SB44      GVGSSSEIERETGVSVYAKIP-------------KT--QISRKLPGVNDKRFILAKADAE
A0A1M7LKR0      GVGSSSEIERETGVSVYAKIP-------------KT--QISRKLPGVSDKRFILAKADPE
A0A1X7JP42      GVGSSSEIERETGVSVYAKIP-------------KT--QISRKLPGVSDKRFILAKADPE
A0A1M6UBQ0      GVGSSSEIERETGVSVYAKIP-------------KT--QISHKLPGASDKRFILAKADSE
A0A1X7IS68      GVGSSTQIEHETGVSVYAKIP-------------KT--KINPKLPNVNDKRFILAKEDSE
                       :*.     : ..:*                                      :

A0A3C0PHK7      SVITESYRSLRTNLSFVSP-DSPIHAVLVTSAGPGEGKSLTTANLAMAYAQMGKKTLLVD
A0A0J7HV92      SVITEAYRSLRTNLSFVSP-DNPVQTVLLTSAGPGEGKSLTVSNLAMAYAQMGKKILLVD
A0A1M6RVC1      DVAVESLRALRSSLEFSMM-DDNGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLID
A0A2N3RSN9      DVAVESLRALRSSLEFSMM-DDNGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLID
A0A1M5IPF7      DVAVESLRALRSSLEFSMM-DDNGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLID
A0A254RX70      DVAVESLRALRSSLEFSMM-DDNGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLID
A0A1M7GQ27      DVAVESIRALRSSLEFSME-EGSSPTIGVSGLIPGVGKSFISVNLAALYAGLGKKVLLID
A0A1X7JCK4      DVAVESIRALRSSLEFSME-EGSSPTIGVSGLIPGVGKSFISVNLAALYAGLGKKVLLID
A0A1M7HDE6      DVAVESLRALRSSLEFSMD-EGCRPIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLID
A0A2C9A7H2      DVAVESLRALRSSLEFSMD-EGCRPIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLID
A0A254SF58      DVAVESLRTLRSSLEFSMD-ESSNSIIGVSGLIPGVGKSFVSVNLAALYAGLGKKVLLID
A0A316ANB4      DVAVESLRALRSSLEFSMD-DTMRQIIGVSGLIPGVGKSFISVNLAALYAGLGKRVLLID
A0A1J5E847      DVAVESMRTLRTSLEFVMP-ETGASVIVLSGLIPAVGKSFVSVNLAALFAGTEKRVLLID
A0A254RM08      DVAVESLRALRSSLEFSMM-DEGGSVVGVSGLIPGVGKSFISVNLAALFAGLGKRVLLID
A0A1M7CD42      DVAVESLRALRSSLEFSMM-DEGGSVVGVSGLIPGVGKSFVSVNLAALFAGLGKSVLLID
A0A254SZB4      DVAVESLRALRSSLEFSMM-DEGGSVVGVSGLIPGVGKSFVSVNLAALFAGLGKSVLLID
A0A1M5LBR0      DVAVESLRALRSSLEFSMM-DEGGSIVGVSGLIPGVGKSFVSVNLAALFAGLGKKVLLID
A0A1M7DJN3      DVAVESLRALRSSLEFSMM-DEGGSIVGVSGLIPGVGKSFVSVNLAALFAGLGKKVLLID
A0A1M6UFW9      DVAVESLRALRSSLEFSMM-DEGGSIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLID
A0A1M6I669      DVAVESLRALRSSLEFSMD-EGCRPVIGISGLIPSVGKSFISVNLAALFAGLGKKVLLID
A0A1M6WDT9      DVAVESLRTLRSSLEFSME-DGARQIIGVSGLIPGVGKSFVSVNLAALCAGLGKKVILID
A0A254RG57      DVAVESLRALRSSLEFSME-DGQRRIIGVSGLIPGVGKSFISVNLAALCAGLGKKVLLID
A0A254S791      DVAIESLRTLRSSLEFSMD-EGSSPIIGISGLIPGVGKSFISVNLAALYAGLGKKVLLID
A0A285ZTW6      DVAVESLRTLRSSLEFSMD-DGSSPIIGISGLIPGVGKSFISVNLAALYAGLGKKVLLID
A0A380S6W7      DVAVESLRALRSSLEFSMD-EGVHTIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLID
A0A1M6V3G7      DVAIESLRALRSSLEFSME-DESKSIIGVSGLIPGVGKSFISVNLAALFAGLGKRVLLID
A0A1N6J281      DVAIESLRALRSSLEFSME-DESKSIIGVSGLIPGVGKSFISVNLAALFAGLGKRVLLID
A0A285ZYD6      DPLSESIRSILTAIDFSFNMNKEHQVIMVSGITPGVGKSFISTNLAATFAMVGKKTLFID
A0A1M6S079      DRVSESFRSLLTSVDFSMT-SLSHPVLMISGLIPGGGKSFVSLNLAALYAESGKRTLLID
A0A1M6WR43      DPASEAFRSLLTSVDFTVP-SQTHPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLID
A0A2N3RVS2      DPASEAFRSLLTSVDFTVP-SQTHPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLID
A0A1M5VRV4      DPASEAFRSLLTSVDFTVP-SQTHPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLID
A0A254RLG7      DPASEAFRSLLTSVDFTVP-SQTHPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLID
A0A1M6SHG3      DPASEAFRSLYTAIDFSIA-DQK--VIMVTGMVPGVGKSFVSKNLTALYASNGKKVLLID
A0A1M6WJF1      SPSSEALRSLYTAIEFATT-DLR--VMMVTGMIPGVGKSFVSKNIAALFAGSGKKTLLID
A0A254RQS8      SPSSEALRSLYTAIEFATS-DMR--VMMVTGMVPGVGKSFVSKNVSALFAGSGKKTLLID
A0A1M6Z6I9      SPSSEALRSLYTAIEFATN-DLR--VMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLID
A0A254STU0      SPSSEALRSLYTAIEFATN-DLR--VMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLID
A0A1M5G181      SPSSEALRSLYTAIEFATN-DLR--VMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLID
A0A1M6VYU0      SPSSEALRSLYTAIEFATN-DLR--VMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLID
A0A1M7DAK0      NGVCEAFRALQTALTFLMP-NPEHCVLLVMGLNPGAGKSFVSLNLAATMATSGKKVLLID
A0A254SNB3      EPASEAFRTLQTAIDFSLS-EGQK-VIMICGLVPGVGKSFVSKNLAAVYAMNGKRVLLID
A0A380RVE7      EPASEAFRTLQTAIDFSLS-EGQK-VIMICGLVPGVGKSFVSKNLAAVYAMNGKRVLLID
A0A1M5F234      DQASEAFHTLQTALDFSLE-AGQK-VVMTCGLVPGVGKSFVAKNLAAVYAMNGKRVLLID
A0A1M6VST0      DQASEAFRTLQTALDFSLE-AGQK-VVMTCGLMPGVGKSFVAKNLAAVYAMNGKRVLLID
A0A2C8Y654      EPFAEAVRALRTALEFSLF-ADGKKVLMVSGLIEGVGKSFVSTNLACSFAMSGKKVLLVD
A0A1M5J685      EPFAEAVRALRTALEFSLF-ADGKKVLMVSGLIEGVGKSFVSTNLACSFAMSGKKVLLVD
A0A1M7JMJ6      EPFAEAVRALRTALEFSLF-ADGKKVLMVSGLIEGVGKSFVSTNLACSFAMSGKKVLLVD
A0A254S3F1      DPFAEGIRALRTALEFSVF-SDGKKVLMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVD
A0A254SFQ7      DPFAEGIRALRTALEFSVF-SDGKKVLMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVD
A0A380S7L2      DPFAEGIRALRTALEFSVF-SDGKKVLMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVD
A0A1M7MCZ6      DPFAEGVRALRTALEFSVF-SDGKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVD
A0A1X7KIP6      DPFAEGVRALRTALEFSVF-SDGKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVD
A0A286A129      DPFAEGIRALRTALEFSVF-SDGKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVD
C9RRK0          DPFAEGVRALRTALEFSVF-CDGKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVD
A0A2M9A3A4      DVACEALRTLRTSLEFSMM-DS--KVLLVTGLSPGSGKSFISKNLAALIAMNGKKVLLID
A0A2P6UPN2      DIASEALRILRTSLEFSMG-VG--KVLLITGCVPNCGKTFISKNLAALYAASGKKVLLLD
A0A1M6RBQ2      DPASEALRSVFTSVEFSA--AAERPVIMVAGLVAGVGKSFVSRNLAALYANFGKKVLLVD
A0A316BGL2      DPASEALRSVFTSVEFSA--TADHPVIMVAGLVAGVGKSFVSRNLAALYANFGKKVLLID
A0A1M6IQ57      DLASEAFRGLQTALDFSLG-EGQN-VVMVCGLVPGVGKSFVSKNLSAVYAMNGKRVLLID
A0A316ATY6      DRVSESFRSLLTSVDFTLP-TQGHPVMMISGLIPGVGKSFVSLNLAALYAEAGKKTLLID
A0A1T4QDW5      DPASENIRSLLTAVEFGML-SKTNNVIMVTGIDKGIGKSFISLNFAAAMANAGKKVLLID
A0A1M6VSY0      DPASENIRSLLTAVEFGML-SKTNNVIMVTGIDKGIGKSFISLNFAAAMANAGKKVLLID
A0A2A3HHG6      DPASENIRSLLTAVEFGML-SKTNNVIMVTGIDKGIGKSFISLNFAAAMANAGKKVLLID
C9RP30          DPLSESIRSILTAIDFSFNMNKEHQVIMVSGIMPGVGKSFISTNLAATFAMVGKKTLFID
A0A1M5V3U1      DKVSESFRSLQTALAFLMP-NPEHCVILVMGLMPGVGKSFVSLNLAAVLAASGKKVLLID
A0A1M7NG89      DKVSESFRSLQTALMFLMP-NPEHSVVLVMGLIPGVGKSFVSLNLAATIAASGKKVLLID
A0A2C8YXS0      DKVSESFRSLQTALMFLMP-NPEHSVVLVMGLIPGVGKSFVSLNLAATIAVSGKKVLLID
A0A254RLK0      DQASEAFRTLQTAVDFSLS-EGQK-VVMVCGLVPGVGKSFVSKNLAAVYAMNGRRVLLVD
A0A1M6RGU5      DQASEAFRTLQTAVDFSLT-EGQK-VLMICGLMPGVGKSFVSKNLAAVYAMNGKRVLLID
A0A254SQM8      DQASEAFRTLQTAVDFSLT-EGQK-VLMICGLMPGVGKSFVSKNLAAVYAMNGKRVLLID
A0A316B5S0      DPASEAFRSLYTAIDFSIA-N-QK-VVMVTGMVPGVGKSFVSKNLAALYATNGKRVLLID
A0A254RXS0      DPASEAFRSLYTAIDFSVG-E-QK-VIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLID
A0A1M6X012      DPASEAFRSLYTAIDFSVG-E-QK-VIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLID
A0A1M5TLF1      DPASEAFRSLYTAIDFSVG-E-QK-VIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLID
A0A2N3RVJ9      DPASEAFRSLYTAIDFSVG-E-QK-VIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLID
A0A1M6R2N3      DFAIEKLRALRTALEFSCI-DEGGRVLMVTGISPEAGKSFVSLNLTYLFAKQNKRVIFID
A0A1N6GS15      DFAIEKIRALRTALEFSCL-DEGGRVLMVTGISPEAGKSFVSLNLTYLFAKQNKRVIFID
A0A254SB44      DIAIEKVRTLRTALEFSFL-EEGGRVLMVTGIVPGAGKSFVSLNLAYLFAKQNKRVLFVD
A0A1M7LKR0      DIAVEKVRTLRTALEFSFL-DEGGRVLMVTGVAPGAGKSFVSLNLSYLFAKQNKRVVFVD
A0A1X7JP42      DIAVEKVRTLRTALEFSFL-DEGGRVLMVTGVAPGAGKSFVSLNLSYLFAKQNKRVVFVD
A0A1M6UBQ0      DLAVEKIRALRTALEFSFL-DEGGKVLMVTGIAPGAGKSFVSLNLAYLFAQQGKRSIFID
A0A1X7IS68      DIAIERIRTLRTTLEFSCL-DEGGKVVIVTGITPGAGKSFISLNLAYLFAKQEKRVLFID
                .   *  . : : : *          :   .     **::   *.:   *   .  :::*

A0A3C0PHK7      TDLRRPVIHHFFNMKREPGFSDLFIENPDYEHV-IRSSKKENLDVVTAGVFTPNPAELIG
A0A0J7HV92      ADLRRPVQHHIFGMKREPGFSELFIDNPDYEKI-IRPTGRENLYLISAGIFTPNPAELVG
A0A1M6RVC1      ADLRKGRLHKEFGIKRGNGLSQVLLREVQVEEV-IHPTEVENMFVIPCGNVPANPAELLG
A0A2N3RSN9      ADLRKGRLHKEFGIKRGNGLSQVLLREVQVEEV-IHPTEVENMFVIPCGNVPANPAELLG
A0A1M5IPF7      ADLRKGRLHKEFGIKRGNGLSQVLLREVQVEEV-IHPTEVENMFVIPCGNVPANPAELLG
A0A254RX70      ADLRKGRLHKEFGIKRGNGLSQVLLREVQVEEV-IHPTEVENMFVIPCGNVPANPAELLG
A0A1M7GQ27      ADLRKGRLHKEFGIKRGKGLSQILLGEATVDEV-IHNTEVDNLFIMQCGTVPPNPSELLG
A0A1X7JCK4      ADLRKGRLHKEFGIKRGKGLSQILLGEATVDEV-IHNTEVDNLFIMQCGTVPPNPSELLG
A0A1M7HDE6      ADLRKGRLHKEFGIKRGNGLSQLLMRNAELADV-IHSTEVENLFVMPCGNVPSNPSELLG
A0A2C9A7H2      ADLRKGRLHKEFGIKRGDGLSQLLMRNAELKDV-IHTTEVENLFVMPCGNVPSNPSELLG
A0A254SF58      ADLRKGRLHKEFGIKRGKGLSQILLHTATAEEV-ISSTEVENLDIIPCGMVPSNPSELLG
A0A316ANB4      ADLRKGRLHKEFGLSRDKGLSQILLGEINAQDV-TYETEVENLYVMPCGKSPTNPSEILG
A0A1J5E847      ADLRKGRLHKEFGIRRDQGLSEVLVGKCKLEEC-LHVTNVPNLSLLVAGKIPASPAELLG
A0A254RM08      ADLRKGRLHKEFGIKRGNGLSQVLLREVKVEDV-IHKTEVENLFVVPCGNVPANPAELLG
A0A1M7CD42      ADLRKGRLHKEFGIKRGNGLSQVLLREVKAEDV-IHKTEVENLYVMPCGNVPNNPAELLG
A0A254SZB4      ADLRKGRLHKEFGIKRGNGLSQVLLREVKAEDV-IHKTEVENLYVMPCGNVPNNPAELLG
A0A1M5LBR0      ADLRKGRLHKEFGIKRGNGLSQVLLREVEAESV-VFPTEVENLFVIPCGNVPNNPAELLG
A0A1M7DJN3      ADLRKGRLHKEFGIKRGNGLSQVLLREVEAESV-VFPTEVENLFVIPCGNVPNNPAELLG
A0A1M6UFW9      ADLRKGRLHKEFGIKRGDGLSQILLRKVEPEDV-IFPTEVENLFVIPCGNVPANPAELLG
A0A1M6I669      ADLRKGRLHKEFGLKRGNGLSQYLLHETTLEDV-IHSTEVENLFVIPCGHVPSNPSEILG
A0A1M6WDT9      ADLRKGRLHKEFGIKRGNGISQVLLHEAEINDV-IHATEVENLFVMPCGNSPSNPSELLG
A0A254RG57      ADLRKGRLHKEFGIKRGKGLSQVLLHNATLDEV-ICSTEVENLDIIPCGNVPSNPSELLG
A0A254S791      ADLRKGRLHKEFGIKRGKGLSQVLLHTATAEEV-ISKTEVENLEIIPCGNVPSNPSELLG
A0A285ZTW6      ADLRKGRLHKEFGIKRGKGLSQILLHSATFEEV-VSKTEVENLEIIPCGMVPSNPSELLG
A0A380S6W7      ADLRKGRLHKEFGIKRGKGLSQILLHTATLEDV-ISSTEVNNLDVIQCGNVPSNPSELLG
A0A1M6V3G7      ADLRKGRLHKEFGIKRDKGLSQILLHTATPAEV-ISKTEVPNLEVMQCGNVPSNPSELLG
A0A1N6J281      ADLRKGRLHKEFGIKRDKGLSQILLHTATPAEV-IRKTEVPNLEVMQCGNVPSNPSELLG
A0A285ZYD6      ADMRKATCR-F---TKV-GLADVLMGKVAFENAKISSPNLPNLDILESGKFTLSAFELLR
A0A1M6S079      ADMRRGVHHSG---CKM-GLAELLSGTCELGAV-AVQSNVENMYVVSAGHSRLSPSELLR
A0A1M6WR43      ADMRRGVHRSS---SKM-GLAEVLGGLCEFGVA-VATSDIENLFVISAGHTKLSPSELLR
A0A2N3RVS2      ADMRRGVHRSS---SKM-GLAEVLGGLCEFGVA-VATSDIENLFVISAGHTKLSPSELLR
A0A1M5VRV4      ADMRRGVHRSS---CKM-GLAEVLGGLCEFGVA-VATSDIENLFVISAGHTKLSPSELLR
A0A254RLG7      ADMRRGVHRSS---SKM-GLAEVLGGLCEFGVA-VATSDIENLFVISAGHTKLSPSELLR
A0A1M6SHG3      ADMRRGVVYSK---HRE-GLGDVLSGKASLDAV-VSESLVKNMYTLGAGNSEVAPSELLR
A0A1M6WJF1      ADMRRGVIYSH---RKQ-GLGDVLSGHCSLDSA-IADSITKNLFVLGAGKTDVSPSELLR
A0A254RQS8      ADMRRGVVYSH---HKQ-GLGDVLSGHCSLDSA-VADSITKNLYVLGAGKTDVSPSELLR
A0A1M6Z6I9      ADMRRGVVYSH---RKQ-GLGDVLEGKCSLDNA-VADSITKNLYVLGAGKTDVSPSELLR
A0A254STU0      ADMRRGVVYSH---RKQ-GLGDVLEGKCSLDNA-VADSITKNLYVLGAGKTDVSPSELLR
A0A1M5G181      ADMRRGVVYSH---RKQ-GLGDVLEGKCSLDNA-VADSITKNLYVLGAGKTDVSPSELLR
A0A1M6VYU0      ADMRRGVVYSH---RKQ-GLGDVLEGKCSLDNA-VADSITKNLYVLGAGKTDVSPSELLR
A0A1M7DAK0      ADMRRGVIHSG---SKF-GLADVLLGLATLDTA-VVSKHDDNLFVMNAGKTKLAACELLR
A0A254SNB3      ADMRKGVIHSS---KHV-GLTEVLSGKVDWHEA-VSDNRCQNLFVMGGGKRLMSPSELLR
A0A380RVE7      ADMRKGVIHSS---KHV-GLTEVLSGKVDWHEA-VSDNRCQNLFVMGGGKRLMSPSELLR
A0A1M5F234      ADMRKGVIRSS---KYI-GLTEVLSGKVEWREA-VADARCQNLFVMGCGKRLMSPSELLR
A0A1M6VST0      ADMRKGVIRSS---KYI-GLTEVLSGKVEWHEA-VADARCENLFVMGCGKRLMSPSELLR
A0A2C8Y654      MDLRRGRMFKK---GHK-GLCEMLRAEKFDDEY-IEMVSE-NYHIIGSGKRVVNPGDLLN
A0A1M5J685      MDLRRGRMFKK---GHK-GLCEMLRAEKFDDEY-IEVVSE-NYHIIGSGKRVVNPGDLLN
A0A1M7JMJ6      MDLRRGRMFKK---GHK-GLCEMLRAEKFDDEY-IEMVSE-NYHIIGSGKRVVNPGDLLN
A0A254S3F1      MDLRRGHLFKH---SQK-GLCEMLEEENYGDDY-VVKVMD-NFHVLGAGARVVNPGGLLT
A0A254SFQ7      MDLRRGHLFKH---SQK-GLCEMLEKEDYSDEY-VVKVTD-NFYVLGSGARVVNPGGLLN
A0A380S7L2      MDLRRGHLFKH---SQK-GLCEMLEKEDYSDEY-VVKVTD-NFYVLGSGARVVNPGGLLN
A0A1M7MCZ6      MDLRRGHFFKH---TQK-GLCEMLEKENYTDEY-VVKVTD-NFHVLGSGARVVNPGGLLN
A0A1X7KIP6      MDLRRGHFFKH---TQK-GLCEMLEKENYTDEY-VVKVTD-NFHVLGSGARVVNPGGLLN
A0A286A129      MDLRRGHLFKH---SQK-GLCEMLEKEDYSDEY-VVHVMD-NFYVLGSGARVVNPGGLLN
C9RRK0          MDLRRGHLFKH---SQK-GLCEMLEKEDYSDEY-VVKISD-NFYVLGSGARVVNPGGLLN
A0A2M9A3A4      TDFRASYMSSR---GRKRGLSDYLLGQIALDEA-VEHLDGAQVDLLGAGSYSSSPSEMIS
A0A2P6UPN2      TDFRASELSPR---GRKHGLSDYLLNKISLDEA-IDHLEKLGFDLIGAGSYTSSPTEMLA
A0A1M6RBQ2      VDMRRGVVYSK---HSQ-GLADILSGKMSFDEC-LSKTDVDNMWVIGAGKPEQAPTDLLH
A0A316BGL2      VDMRRGVVYSK---NAQ-GLADILSGKRSFDEC-LSKTDVEGMWVIGSGKPLQAPTDLLH
A0A1M6IQ57      ADMRKGVIRST---KYA-GLTDVLAGKVDWHDV-VADCPCKGLFILGRGSVVMAPSELLR
A0A316ATY6      ADMRRGVHHSG---SKM-GLAELLGGTCELAAVAKPSPEAENLFIVSSGHSRLSPSELLR
A0A1T4QDW5      ADMRRGKLIRK---RRK-GLVEVLLGKESLDSMVTLYDNVENLYVLSTGILNVTASELLR
A0A1M6VSY0      ADMRRGKLIRK---RRK-GLVEVLLGKESLDSMVTLYDNVENLYVLSTGILNVTASELLR
A0A2A3HHG6      ADMRRGKLIRK---RRK-GLVEVLLGKESLDSMVTLYDNVENLYVLSTGILNVTASELLR
C9RP30          ADMRKATCR-F---TKV-GLVDVLMGKVAFDNAKITSPNLPNLDILESGKFTLSAFELLR
A0A1M5V3U1      ADMRRGVINGR---SKF-GLADVLAGIATLDTA-VSQKHTDNLFVMNAGKTKLAACELLR
A0A1M7NG89      ADMRRGVIHGR---SKF-GLADVLAGIATLDTA-VSQKHVDNLCVMNAGKTKLAACELLR
A0A2C8YXS0      ADMRRGVIHGR---SKF-GLADVLAGIATLDTA-VSQKHDDNLYVMNAGKTKLAACELLR
A0A254RLK0      ADMRKGVIRSS---KYL-GLTEVLSGKIPWRET-VAESRCQNLFVMGCGKRLMSPSELLR
A0A1M6RGU5      ADMRKGVIRSS---KYL-GLAEVLSGKIPWRET-VAESRCQNLFVMGCGKRLMSPSELLR
A0A254SQM8      ADMRKGVIRSS---KYL-GLAEVLSGKIPWRET-VAESRCQNLFVMGCGKRLMSPSELLR
A0A316B5S0      ADMRRGVVYSK---HRQ-GLGDVLSGKVPLDNV-ISETLVKNMFALGAGNSEVAPSELLR
A0A254RXS0      ADMRRGVVYSH---HKQ-GLGDVLSGRCTLESA-VADSITKNLFVIGAGITDVSPSELLR
A0A1M6X012      ADMRRGVVYSH---HKQ-GLGDVLSGRCTLESA-VADSITKNLFVIGAGITDVSPSELLR
A0A1M5TLF1      ADMRRGVVYSH---HKQ-GLGDVLSGRCTLESA-VADSITKNLFVIGAGITDVSPSELLR
A0A2N3RVJ9      ADMRRGVVYSH---HKQ-GLGDVLSGRCTLESA-VADSITKNLFVIGAGITDVSPSELLR
A0A1M6R2N3      ADLRKSRLSHK---HEK-GVSDVIAKSATLDS--VVVDMGEGAYFLPKGSRVANPGEMLA
A0A1N6GS15      ADLRKSRLSHK---HEK-GVSDVIAKTATLDS--VVVDMGEGAYFLPKGSRVANPGEMLA
A0A254SB44      ADLRKSRLSHM---REK-GVSDILINNGKLED--LVVDMGEGFFFLPKGSRAPNPGEMVS
A0A1M7LKR0      ADLRKSRLSHS---REK-GISDILINNSKLED--CVIDMGEGMYFLPKGSRAPNPGEMVS
A0A1X7JP42      ADLRKSRLSHS---REK-GISDILINNSKLED--CVIDMGEGMYFLPKGSRAPNPGEMVS
A0A1M6UBQ0      ADLRKSRLSHK---HEK-GITDVIAKGCDLEK--ALIDIGDGAYFLPMGSRVANPGEMLG
A0A1X7IS68      ADLRKSRLSHI---REK-GVSDIISKVCHLED--VIINLGEGADFLPNGTHTQNPAEMLS
                 *:*              *. : :                     :  *     .  :: 

A0A3C0PHK7      SNKMGQHIEYFKKNYDMVFFDTPPIVAVTDATLLGKKVDGVLLVVKSHHSDREFVSRALA
A0A0J7HV92      SQKMVQIIDDLKARFDMIFFDTPPIIAVTDAALLGTKVDGLLMVIKSHHTDRDIAYRAMN
A0A1M6RVC1      SRHYADLIERFKSEYDLVIVDTPPIMLVTDAALACRLAAQIVMVIEYNRHSIEAIQEGMS
A0A2N3RSN9      SKHYADLIERFKSEYDLVIVDTPPIMLVTDAALACRLAAQIVMVIEYNRHSIEAIQEGMS
A0A1M5IPF7      SRHYSDLIERFKSEYDLVIVDTPPIMLVTDAALACRLAAQIVMVIEYNRHSIEAIQEGMG
A0A254RX70      SRHYSDLIERFKSEYDLVIVDTPPIMLVTDAALACRLAAQIVMVIEYNRHSIEAIQEGMS
A0A1M7GQ27      SKHYASMISELEKSYDLIIVDTPPIMLVTDAALACRVVSQIVMVIEYNKHSIDAIKDGMT
A0A1X7JCK4      SKHYASMISELEKSYDLIIVDTPPIMLVTDAALACRVVSQIVMVIEYNKHSIDAIKDGMT
A0A1M7HDE6      SKHYTELISNLEKEYDMIIIDTPPIMLVTDATLACRYASQLVMVIEYNKHSIDAIKDGMA
A0A2C9A7H2      SKHYAELINGLEKEYDLIIIDTPPIMLVTDAALACRIASQIVMVIEYNKHSIDAIKDGMA
A0A254SF58      SKRYSELIEELKSKYDLIIVDTPPIMLVTDAALACRVAAQIVMVIEYNKHSIEAIQDGMK
A0A316ANB4      SKHYAELIESLEKQFDLIIVDTPPIMLVTDAALACRFASQVVMVIEYNKHSINAIKDGMA
A0A1J5E847      SHRYVQLLEKLKTMFDVIIVDTPPVMLVTDAMLVCRHSDQAILVVEYNRHSIDAIREGLA
A0A254RM08      SKHYAELIEEFKNSYDLVIVDTPPIMLVTDAALACRVAAQIVMVIEYNKHSIEAIKDGMA
A0A1M7CD42      SKHYAELIEQFKKDYDLVIVDTPPIMLVTDAALACRVAAQIVMVIEYNKHSIEAIKDGMA
A0A254SZB4      SKHYAELIEQFKKDYDLVIVDTPPIMLVTDAALACRVAAQIVMVIEYNKHSIEAIKDGMA
A0A1M5LBR0      SKHYAEVINKFKKEYDLVVIDTPPIMLVTDAALACHVASQIVMVIEYNKHSIDAIKDGMA
A0A1M7DJN3      SKHYAEVINKFKKEYDLVVIDTPPIMLVTDAALACHVASQIVMVIEYNKHSIDAIKDGMA
A0A1M6UFW9      SKHYSEIINKFKQEYDLVIVDTPPIMLVTDAALACHVADQIVMVIEFNKHSIEAIKDGMS
A0A1M6I669      SKHYSDMIDELEKHYDLIIVDTPPIMLVTDAALACRQASQIVMVIEYNKHSIEAIQDGMA
A0A1M6WDT9      SKHYTNLIEELEKQFDLIIVDTPPIMLVTDASLACKVASQIVMVIEYNKHSIDAIQDGMK
A0A254RG57      SKHYTSTIDELEKKYDLIIVDTPPIMLVTDAALACRVASQIVMVIEYNKHSIDAIKDGMK
A0A254S791      SKRYNDLIQELKSRYDLIIIDTPPIMLVTDAALACRVAAQIVMVIEYNKHSIDAIQDGMK
A0A285ZTW6      SKRYLDLIDELKSKYDLIIIDTPPIMLVTDAALACRVAAQIVMVIEYNKHSIDAIQDGMK
A0A380S6W7      SKHYSTLIENLKNQYDLIIVDTPPIMLVTDAAQACRVASQIVMVIEYNRHSIEAIKDGMK
A0A1M6V3G7      SKHYAAMIEELKKQYDLIIIDTPPIMLVTDAALACRVVSEIVMVIEYNRHSIDAIKDGMK
A0A1N6J281      SRHYAAMIEELKQQYDLIIIDTPPIMLVTDAALACRVVSEIVMVIEYNRHSIDAIKDGMK
A0A285ZYD6      GDMLKKLIDEIRPQYDAIIIDTPPTNLVTDAYMICPLIDFALVVLHYGRHSMDSIKESLH
A0A1M6S079      GENFTKLMDVARKQFDIIIVDTPPMSMVTDAELIYPVVDFSLFVLHYGKHNMNEIKESVA
A0A1M6WR43      GENFRSMLDEARKQFDVIIVDTPPMSMVTDAELIYPAADFSLFVLHYGKHSMDEISEAMT
A0A2N3RVS2      GENFRSMLDEARKQFDVIIVDTPPMSMVTDAELIYPAADFSLFVLHYGKHSMDEISEAMT
A0A1M5VRV4      GENFRSMLDEARKQFDVIIVDTPPMSMVTDAELIYPAADFSLFVLHYGKHSMDEISEAMT
A0A254RLG7      GENFRSMLDEARKQFDVIIVDTPPMSMVTDAELIYPAADFSLFVLHYGKHSMDEISEAMT
A0A1M6SHG3      GDNFKKLLEDAKTKFDMIVVDTPPLNLVTDSELIYPVVDFALFVLHYGRHSMDQIKESMI
A0A1M6WJF1      GDTFKNLLEEAKSKYDIVIVDTPPLELVTDSELIYPIVDFALFVLHYGKHSMDQIKESMM
A0A254RQS8      GDNFKNLLDEAKAKFDIVIVDTPPLELVTDSELIYPIVDFALFVLHYGKHTMDQIKESMM
A0A1M6Z6I9      GETFKNLLEEAKSKFDIIIVDTPPLELVTDSELIYPIVDFALFVLHYGKHSMDQIKESMM
A0A254STU0      GDNFKNLLDEAKSKFDIVIVDTPPLELVTDSELIYPIVDFALFVLHYGKHSMDQIKESMM
A0A1M5G181      GETFKNLLEEAKSKFDIIIVDTPPLELVTDSELIYPIVDFALFVLHYGKHSMDQIKESMM
A0A1M6VYU0      GETFKNLLEEAKSKFDIIIVDTPPLELVTDSELIYPIVDFALSVLHYGKHTMDQIKESMM
A0A1M7DAK0      GDAMDKLFKEARQKFDMVIVDTPPLNLVTDAELICPLVDYSLFVLHYGRHSIEEIKETID
A0A254SNB3      RDTFKNLLEEMKSEFDMILVDTPPVSMVTDAELIFPLVDFTLMVVHYGTDSLAQVKESLA
A0A380RVE7      RDTFKNLLEEMKSEFDMILVDTPPVSMVTDAELIFPLVDFTLMVVHYGTDSLAQVKESLA
A0A1M5F234      HDKFKALLEDLKQEYDMIIVDTPPVSMVTDAELIYPLVDFTLMVVHYGVDSLEQIKENLA
A0A1M6VST0      HDKFKTLLEDLKQEYDMIIVDTPPVSMVTDAELIYPLVDFTLMVVHYGADSLEQIKENLA
A0A2C8Y654      KNRFGTFLDTFRKKYDLIILDTPPIFQCSDALLVEKYADYLLCVLKQSAQSMDNIQEALS
A0A1M5J685      KNRFGTFLDTFRKKYDLIILDTPPVFQCSDALLVEKYADYLLCVLKQSAHSMDNIQEALS
A0A1M7JMJ6      KNRFGTFLDTFRKKYDLIILDTPPVFQCSDALLVEKYADYLLCVLKQSAHSMDNIQEALS
A0A254S3F1      SSRFSAFLDAFRDKYDLIVLDTPPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALN
A0A254SFQ7      SSRFSAFLDAFKDKYDLIVLDTPPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALN
A0A380S7L2      SSRFSAFLDAFKDKYDLIVLDTPPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALN
A0A1M7MCZ6      SSRFSAFLDSFRDKYDLIVLDTPPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALN
A0A1X7KIP6      SSRFSAFLDSFRDKYDLIVLDTPPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALN
A0A286A129      SSRFSAFLDAFRDKYDLIVLDTPPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALN
C9RRK0          SSRFSAFLDAFRDKYDLIVLDTPPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALN
A0A2M9A3A4      SKAFENLLNEMKSKYDLIIVDSAPVLAVADALVASRYADFVLLVIHYGHDSMEALREGLG
A0A2P6UPN2      SSAFGDLISQMRNRYDLIILDSAPILSVADALTTSRYADFVLVAVRYAKDSLEGVEEALS
A0A1M6RBQ2      GETFADMLRYAKQNFDVIVLDTPPINLVADTELVLPLVDFSLFVLHYGRHTMDEIDEAVT
A0A316BGL2      GETFAELLKFAKQNFDVIVLDTPPINLVADTELVLPLVDFSLYVLHYGRHTMDEIDEAVN
A0A1M6IQ57      HDDFKKLLDEAKKEYDMVIVDTPPLSLVTDSELIYPHVDFLLMVLHYGIHSMEQIKESIN
A0A316ATY6      GDNFKNLMDEARKQFEVVIVDTPPMSMVTDAELIYPVVDMSLFVLHYGKHSMNEIKESVN
A0A1T4QDW5      GQAFANLVAEAREKYDVVLIDTPPVALATDAELMANLATLVLFVIKYNTHSMEEIQEVLK
A0A1M6VSY0      GQAFANLVAEAREKYDVVLIDTPPVALATDAELMANLASLVLFVIKYNTHSMEEIQEMLK
A0A2A3HHG6      GQAFANLVAEAREKYDVVLIDTPPVALATDAELMANLASLVLFVIKYNTHSMEEIQEMLK
C9RP30          GDMLKKLIDEIRPQYDAIIIDTPPTNLVTDAYMICPLIDFALVVLHYGRHSMDSIKESLH
A0A1M5V3U1      GDAMDNLLKEARRKYDLVIVDTPPLNLVTDAELICPLVDYSLFVLHYGRHSIEEIKETIE
A0A1M7NG89      GDAMDKLLKEAREKFDMVIVDTPPLNLVTDAELICPLVDYSLFVLHYGRHSMEEIKETVE
A0A2C8YXS0      GEAMDKLLKEARERFDMIIVDTPPLNLVTDAELICPLVDYSLFVLHYGRHSMEEIKETVE
A0A254RLK0      HDLFKNLLEEMKSEYDMILVDTPPVSMVTDAELIFPLVDFALMVVHYGTDSLAQIKENLA
A0A1M6RGU5      HDLFKTLLEEMKSEYDMILVDTPPVSMVTDAELIFPLVDFALMVVHYGTDSVAQIKENLA
A0A254SQM8      HDLFKTLLEEMKSEYDMILVDTPPVSMVTDAELIFPLVDFALMVVHYGTDSVAQIKENLA
A0A316B5S0      GENFKRLLEDAKSQFDMIVVDTPPLNLVTDSELIYPVVDFALFVLHYGRHSMEQIKESMI
A0A254RXS0      GTKFKELLDSASETYDTIIVDTPPLNLVTDSELIFPVVDFALFVLHYGRHSMEQIKEAMI
A0A1M6X012      GTKFKELLDSASETYDTIIVDTPPLNLVTDSELIFPVVDFALFVLHYGRHSMEQIKEAMI
A0A1M5TLF1      GTKFKELLDSASETYDTIIVDTPPLNLVTDSELIFPVVDFALFVLHYGRHSMEQIKEAMI
A0A2N3RVJ9      GTKFKELLDSASETYDTIIVDTPPLNLVTDSELIFPVVDFALFVLHYGRHSMEQIKEAMI
A0A1M6R2N3      SKAFAELVQECREKYDIVVIDTPPCSLVSDAQAIAKLADFGLIVVEYKKHSMENIQEIID
A0A1N6GS15      SKSFAELVQECREKYDIVVIDTPPCSLVSDAQAIAKLADFGLIVVEYKKHSMENIQEIID
A0A254SB44      SRAFAELIDECKSKYDVVVIDTPPNSLVSDAQSIAKLADFGLIVIEYKKHSMDEIQDVID
A0A1M7LKR0      SKAFADLIDECKAKYDVVVIDTPPNSLVSDAQAIAKLVDFGLVVIEYKKHSLEVIQETID
A0A1X7JP42      SKAFADLIDECKAKYDVVVIDTPPNSLVSDAQAVAKLVDFGLVVIEYKKHSLEVIQETID
A0A1M6UBQ0      SKAFAELVQECKSKFDVVIIDTPPIALVSDALAIAKLADFGLIVIEYKKHSMENIQETIE
A0A1X7IS68      SKAFAELIHECREKYDVVIIDTPPTSLVSDAQAIAKLADFGLLVIEYKKHTMESIQEAID
                       .      :: :..*:.*    :*:          : .:             : 

A0A3C0PHK7      TFTNVGIK--VWGVILNDIDLT------HRYSSYGYYKYYYHYYKSKKD----
A0A0J7HV92      SLKNIGVK--IYGTVLNDINLSD------RYTSYGYYKYYYHYYKTKKD----
A0A1M6RVC1      QILKGNSTA-HASIVINKYEHSRTEGYGYKYGKY-------------------
A0A2N3RSN9      QILKGNSTA-HASIVINKYEHSRTEGYGYKYGKY-------------------
A0A1M5IPF7      QILKGNSTA-HASIVINKYEHSRTEGYGYKYGKY-------------------
A0A254RX70      QILKGNSTA-HASIVINKYEHSRTEGYGYKYGKY-------------------
A0A1M7GQ27      QLLKGNSNA-HASFVINKYEHGHSDGYGYKYGKY-------------------
A0A1X7JCK4      QLLKGNSNA-HASFVINKYEHGHSDGYGYKYGKY-------------------
A0A1M7HDE6      QLLKGNGDA-HASIVINKYEHSHSDGYGYKYGKY-------------------
A0A2C9A7H2      QLLKGNTDA-HASIVVNKYEHSHSDGYGYKYGKY-------------------
A0A254SF58      QLLKGNTSA-HASFVINKYEHGHNDGYGYKYGKY-------------------
A0A316ANB4      HLLKGNNSA-HASFVINKYEHSHADGYGYKYGKY-------------------
A0A1J5E847      LFTKGASESVHKSIVINKYVHSKVDGYGYKYGKY-------------------
A0A254RM08      QILKG-NSSAHASIVINKYEHSRTEGYGYKYGKY-------------------
A0A1M7CD42      QILKG-NSSAHASIVINKYEHSRTEGYGYKYGKY-------------------
A0A254SZB4      QILKG-NSSAHASIVINKYEHSRTEGYGYKYGKY-------------------
A0A1M5LBR0      QILKG-NSSAHASIVINKYEHSRTEGYGYKYGKY-------------------
A0A1M7DJN3      QILKG-NSSAHASIVINKYEHSRTEGYGYKYGKY-------------------
A0A1M6UFW9      QILKG-NPQAHASIVINKYEHSRTEGYGYKYGKY-------------------
A0A1M6I669      QLLKG-NTNAHASFVINKYQHSHSDGFGYKYGKY-------------------
A0A1M6WDT9      QLLKG-SPDAHASFVINKYEHSHSDGYGYKYGKY-------------------
A0A254RG57      QLLKG-NNDVHASFVINKYEHSHSDGYGYKYGKY-------------------
A0A254S791      QLLKG-NNTAHASFVINKYEHGHNDGYGYKYGKY-------------------
A0A285ZTW6      QLLKG-NNTAHASFVINKYEHGHSDGYGYKYGKY-------------------
A0A380S6W7      QLLKG-NEEAHASFVINKYEHGHNDGYGYKYGKY-------------------
A0A1M6V3G7      QLLKG-NNDVHASLVINKYEHGHSDGYGYKYGKY-------------------
A0A1N6J281      QLLKG-NNDVHASLVINKYEHGHSDGYGYKYGKY-------------------
A0A285ZYD6      TLERYCD-K-PKAFVLNHCEHR--HGYGYGYGYGYGYG--YGYYGSKSKKHKN
A0A1M6S079      KMNRFGD-K-PKAFVMNHCEREA-GRYGYGYG----YGY-YGYYSKNK-----
A0A1M6WR43      KMKRFGE-K-PKAFVMNHCERET-GRYGYGYG----YGY-YGYYSKKK-----
A0A2N3RVS2      KMKRFGE-K-PKAFVMNHCERET-GRYGYGYG----YGY-YGYYSKKK-----
A0A1M5VRV4      KMNRFGE-K-PKAFVMNHCERET-GRYGYGYG----YGY-YGYYSKKK-----
A0A254RLG7      KMNRFGE-K-PKAFVMNHCERET-GRYGYGYG----YGY-YGYYSKKK-----
A0A1M6SHG3      KVDRCGD-K-PHAFVMNHVEHDG-RGYGYGYGGHG-YGK-YGYYSNKKKKK--
A0A1M6WJF1      KLDRCCEGK-SRAFVMNHCEHE---GHGYGYGGYGYYGK-YGYYNKDKKKKS-
A0A254RQS8      KLDRCCEGK-PRAFVMNHCESD---GHGYGYGGYGYYGK-YSYYGKDKKKK--
A0A1M6Z6I9      KLDRCCEGK-PRAFVMNHCESD---GHGYGYGSYG-YGK-YSYYGKDKKKK--
A0A254STU0      KLDRCCEGK-PRAFVMNHCESD---GHGYGYGSYG-YGK-YSYYGKDKKKK--
A0A1M5G181      KLDRCCEGK-PRAFVMNHCESD---GHGYGYGSYG-YGK-YSYYGKDKKRK--
A0A1M6VYU0      KLDRCCEGK-ARAFVMNHCESD---GHGYGYGSYG-YGK-YGYYGKDKKKK--
A0A1M7DAK0      RVKRYSD-K-PAAIVMNHCEQE--PGR-YGYGYYG-----KGYKSK-------
A0A254SNB3      NLRRYAD-K-PCAFVMNHCEYE--PGHYYGYGYYG-----GGYYGKGYYSK--
A0A380RVE7      NLRRYAD-K-PCAFVMNHCEYE--PGHYYGYGYYG-----GGYYGKGYYSK--
A0A1M5F234      NLRRYAD-K-PCAFVLNHCEYE--PGHYYGYGYYG-----KGYYGKGYFSKS-
A0A1M6VST0      NLRRYAD-K-PCAFVLNHCEYE--PGHYYGYGYYG-----KGYYGKGYFSKS-
A0A2C8Y654      TFDRSTETPLPKAFVFNKCE----RHSGYGYGGY--YGY-YGY-KKY------
A0A1M5J685      TFDRSTETPLPKAFVFNKCE----RHSGYGYGGY--YGY-YGY-KKY------
A0A1M7JMJ6      TFDRSTETPLPKAFVFNKCE----RHSGYGYGGY--YGY-YGY-KKY------
A0A254S3F1      TFDRSTETPLQKAFVFNKCE----RHAGSGYGS---YGY-YGYHKKY------
A0A254SFQ7      TFDRSTETPLQKAFVFNKCE----RHAGYGYGS---YGY-YGYHKKY------
A0A380S7L2      TFDRSTETPLQKAFVFNKCE----RHAGYGYGS---YGY-YGYHKKY------
A0A1M7MCZ6      TFDRSTETPLPKAFVFNKCE----RHAGYGYGS---YGY-YGYHKKY------
A0A1X7KIP6      TFDRSTETPLPKAFVFNKCE----RHAGYGYGS---YGY-YGYHKKY------
A0A286A129      TFDRSTETPLQKAFVFNKCE----RHAGYGYGS---YGY-YGYHKKY------
C9RRK0          TFDRSTETPLQKAFVFNKCE----RHAGYGYGS---YGY-YGYHKKY------
A0A2M9A3A4      QFEKANVE--HKAMVFNRCVYEG-GHSSYGYG----YGYGYGYGKNKKKKKS-
A0A2P6UPN2      LLDKAEVK--NRALVINRILSDEISHYGYGYG----YGYGYGYKKKYGHKKS-
A0A1M6RBQ2      KVNRLSES--PKAFVMNHCDRFM-SSHYYYNGYSS-YGFKKK-----------
A0A316BGL2      KIERLSEA--PRAFVMNHCDRDL-GSRYYYNGY-G-YGFKKK-----------
A0A1M6IQ57      GLKRFADK--PGAFVMNHCEHEP-GHYGYGYGYYG-KKYYGSK----------
A0A316ATY6      KINRFGDK--PKAFVMNHCEREA-GK--YGYGYGY--GYYGYYSKNK------
A0A1T4QDW5      RLKRYTSG--QLALVMNSCMRER-G---YGYGYYG--GYGGGYSRYEKY----
A0A1M6VSY0      RLKRYLNG--QIALVMNSCMRER-G---YGYGYYG--GYGGGYSRYEKY----
A0A2A3HHG6      RLKRYLNG--QIALVMNSCMRER-G---YGYGYYG--GYGGGYSRYEKY----
C9RP30          TLERYCDK--PKAFVLNHCEHRH-GY-GYGYGY----GYYGSKSKKHKN----
A0A1M5V3U1      RVRRYSDK--PSAIVMNHCEHEP-GRYGYGYGYYG-KGYYGK-----------
A0A1M7NG89      RVKRYSDK--PAAIVMNHCEREP-GH--YGYGYYD-KGYYGKKS---------
A0A2C8YXS0      RVKRYSDK--PAAIVMNHCEREP-GR--YGYGYYD-KGYYGKKS---------
A0A254RLK0      NLRRYADK--PCAFVMNHCEYEP-GH-YNGYGYYG-KGYYGK-GYFSKS----
A0A1M6RGU5      NLRRYADK--PCAFVMNHCEYEP-GH-YYGYGYYG-KGYYGK-GYFSKS----
A0A254SQM8      NLRRYADK--PCAFVMNHCEYEP-GH-YYGYGYYG-KGYYGK-GYFSKS----
A0A316B5S0      KVERCGDK--PHAFVMNHVEHD--GR-GYGYGYGG-YG-YGKYGYYSNRKKKK
A0A254RXS0      KIERCGNK--PHALVMNHCESD--GH-GYGH-YGS-YGSYGSYGSYKKKKKR-
A0A1M6X012      KIERCGNK--PHALVMNHCESD--GH-GYGH-YGS-YGSYGSYGSYKKKKKR-
A0A1M5TLF1      KIERCGNK--PHALVMNHCESD--GH-GYGH-YGS-YGSYGSYGSYKKKKKR-
A0A2N3RVJ9      KIERCGNK--PHALVMNHCESD--GH-GYGH-YGS-YGSYGSYGSYKKKKKR-
A0A1M6R2N3      QLSMAKLE--KKAIVLNKCVHDG-SSYGYGYGY-G-YGYGYGYRYRYGEKKK-
A0A1N6GS15      QLSMAKLE--KKAIVLNKCVHDG-SSYGYGYGY-G-YGYGYGYRYRYGEKKK-
A0A254SB44      QLSIAKLD--KKAIVLNQCLQD------------G-LGYGYDYRYRYDEIKKS
A0A1M7LKR0      QLNIAKLK--KVAIALNQCVNDG-SS--YGYGY-G-YGYGYGYRYRYGDKKKS
A0A1X7JP42      QLNIAKLK--KVAIALNQCVNDG-SS--YGYGY-G-YGYGYGYRYRYGDKKKS
A0A1M6UBQ0      QLNIAKLD--KKAIVLNHCIHDS-GA--YGYGY-G-YGYGYRYRYRDK-----
A0A1X7IS68      LISSSKLE--KKAIVLNQCVQDD-SS--YGYGY-G-YGYGYGYKNRYRSDEKK
                 .          .  .*                                    

© 1998-2019