BYKdb

Dataset for cluster cd of phylum firmicutes

[Download (right click)] [Edit] [Sequences] [Repertoires]

474 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E3CP62      ---------------------------------------------MPLLKLVKSKVQ--F
C2KHF1      ----------------------MSFFKKQSSVGKYGLSVETMAKGARLITAAEPKNH--V
G9WIQ9      ------------------------MPSKRKAKKASAVDLRSSRYGVPLITLDDPQDV--V
A0NKF6      ------------------------MFSKKNPQKLSAKVLRSSRYGVPLVTVQDPQNV--V
Q04DV8      ------------------------MFSKKNPQKLSANDLRSSRYGVPLVTVQDPQNV--V
D3LB10      ------------------------MFSKKNPQKLSANDLRSSRYGVPLITVQDPQDV--V
B8D0N2      -------------------------------------------------MVNYSRYTNDP
F2I4B7      ------------------------------------------------MVVDNPTSA--M
C2CI44      ------------------------------------------------MSKKNSYYSASM
C7RGH6      ------------------------------------------------MTSRNNYYSASM
C0CK73      ----------------------------MQAK----------------IVLPNEELEYGA
Q1WTC8      ---------------------------MQKFE----------------LRLDDIDFQSQ-
E8JWI5      ---------------------------MPILE----------------LAKKKKISISRV
F3AHH0      ---------------------------MINVE----------------IKVPKLGY--NS
F7K0U1      ---------------------------MREIV----------------LNGLEKDF--RS
C4Z672      ---------------------------MQEFS----------------VKKSYLDF--RT
P0C0T9      ---------------------------MTRLE----------------IVDSKLRQAKKT
Q04663      ---------------------------MTRLE----------------IVDSKLRQAKKT
Q67AY4      ---------------------------MTRLE----------------IVDSKLRQAKKT
Q3K0T0      ---------------------------MTRLE----------------IVDSKLRQAKKT
C5NWJ8      ---------------------------MAQIN----------------LLTNQKIVDPKN
F3A499      ---------------------------MAQIN----------------LLTNQKIVDPKN
Q4JZ55      ---------------------------MGKLE----------------LTRKYYQLYNET
G5JTD5      ---------------------------MGYLE----------------LSSKQEKTIDKA
G3G7C1      ---------------------------MATLE----------------IARTKKELVNKT
G3G7J9      ---------------------------MATLE----------------IARTKKELVNKT
G3G7G6      ---------------------------MATLE----------------IARTKREIVNKT
G8DUB0      ---------------------------MATLE----------------IARTKKELVNKT
G3G7I8      ---------------------------MATLE----------------IARTKREIVNKT
G3G7J4      ---------------------------MATLE----------------IARTKREIVNKT
G7SG34      ---------------------------MATLE----------------IARTKKELVNKT
G8DTZ0      ---------------------------MATLE----------------IARTKKELVNKT
G8DU07      ---------------------------MATLE----------------IARTKKELVNKT
A4VTU3      ---------------------------MAMLE----------------IARTKREGVNKT
G7SNU6      ---------------------------MAMLE----------------IARTKREIVNKT
G8DU31      ---------------------------MAMLE----------------IARTKREIVNKT
D5AGQ5      ---------------------------MAMLE----------------IARTKREGVNKT
Q9X4U7      ---------------------------MAMLE----------------IARTKREGVNKT
A3CQY2      ---------------------------MATLE----------------LVRKKRNLVKLT
E8KLY9      ---------------------------MATLE----------------LVRKKRNLVKLT
F0FHA8      ---------------------------MATLE----------------LVRKKRNLVKLT
F0I4H5      ---------------------------MATLE----------------LVRKKRNLVKLT
F0IAY3      ---------------------------MATLE----------------LVRKKRNLVKLT
F0IJI2      ---------------------------MATLE----------------LVRKKRNLVKLT
F0IS53      ---------------------------MATLE----------------LVRKKRNLVKLT
F2C9N0      ---------------------------MATLE----------------LVRKKRNLVKLT
F2CH53      ---------------------------MATLE----------------LVRKKRNLVKLT
F3SM32      ---------------------------MATLE----------------LVRKKRNLVKLT
F3UDW7      ---------------------------MATLE----------------LVRKKRNLVKLT
F3UNJ4      ---------------------------MATLE----------------LVRKKRNLVKLT
F0FQQ5      ---------------------------MATLE----------------LVRKKRNLVKLT
D6R2T8      ---------------------------MAVLE----------------LVRKRRDLVKLT
F3UUQ2      ---------------------------MAVLE----------------LVRKRRDLVKLT
E6IZC2      ---------------------------MPSLE----------------LAKNKEKTIKKT
G6A745      ---------------------------MPRLE----------------LAKNKEKALKKS
A8AZR3      ---------------------------MPILE----------------LSNNKKQSIQKT
F9HJP6      ---------------------------MPVLE----------------LSTKKKNSIQRT
Q4JYT9      ---------------------------MPTLA----------------IEQKRLDFAKKA
Q4JZY1      ---------------------------MPTLA----------------IEQKRLDFAKKA
E1LQJ7      ---------------------------MPTLE----------------IAQKHLNFAKKA
F9HC65      ---------------------------MPTLE----------------ISKKRLDFAKKA
E1LPE7      ---------------------------MAKLE----------------LSQQKLNSVKKA
F9MJW5      ---------------------------MAKLE----------------LSQQKLNSVKKA
E8KDN2      ---------------------------MAKLE----------------LSVKRQAFVKKA
E8K322      ---------------------------MAKLE----------------LSEQRLHSVKKA
F9PEU4      ---------------------------MAKLE----------------LSEQRLHSVKKA
F9PZP7      ---------------------------MAKLE----------------LSQQRLNSVKKA
C1CBD1      ---------------------------MPTLE----------------IVQKKLEFIKKT
Q7WVX0      ---------------------------MPTLE----------------IVQKKLEFIKKT
P96475      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q9AHD2      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K2Q7      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K0T5      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K0E1      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q9AH95      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K1M4      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4JZ18      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q54520      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4JYH5      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K0V2      ---------------------------MPTLE----------------IAQKKLEFVKKA
A5M4L1      ---------------------------MPTLE----------------IAQKKLEFIKKA
B2ILP5      ---------------------------MPTLE----------------IAQKKLEFIKKA
C1CCB9      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K1S7      ---------------------------MPTLE----------------IAQKKLEFIKKA
P72512      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4JZ84      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K0X5      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K0Z6      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K195      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K0A0      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K0K2      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K1F9      ---------------------------MPTLE----------------IAQKKLEFIKKA
Q4K045      ---------------------------MPTLE----------------ISQAKLDFVKKV
G6C7Z1      ---------------------------MPTLE----------------ISQAKLDLVKKA
D2ERX8      ---------------------------MPTLE----------------ISQAKLDLVKKA
F9LZC4      ---------------------------MPTLE----------------ISQAKLDLVKKA
F9P1W8      ---------------------------MPTLE----------------ISQAKLDLVKKA
I0J9C9      ---------------------------MPTLE----------------ISQAKLDFVKKA
A6YIA8      ---------------------------MPTLE----------------ISQAKLDSVKKA
Q4K005      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q4JZL7      ---------------------------MPTLE----------------ISHAKLDSVKKA
E5F5C5      ---------------------------MPTLE----------------ISQAKLDSVKKA
Q4JZG7      ---------------------------MPTLE----------------ISQAKLDSVKKA
Q4JZK1      ---------------------------MPTLE----------------ISQAKLDSVKKA
A5LJS0      ---------------------------MPTLE----------------ISQAKLDSVKKA
Q9AHB7      ---------------------------MPTLE----------------ISQAKLDSVKKA
Q4K1B7      ---------------------------MPTLE----------------ISQAKLDSVKKA
Q4JYK8      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q4K0M3      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q9AHA4      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q9X9A1      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q9ZII6      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q8KWQ0      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q4JZW7      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q4JYX9      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q4K0R7      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q4K1K6      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q4JZS3      ---------------------------MPTLE----------------ISQAKLDFVKKA
Q4K0I2      ---------------------------MPTLE----------------ISQAKLELAKKT
Q4K254      ---------------------------MPTLE----------------ISQAKLEPVKKA
Q4K237      ---------------------------MPTLE----------------ISQVKLELAKKA
B1I967      ---------------------------MPTLE----------------ISQAKLELVKKA
G6J8A4      ---------------------------MPTLE----------------ISQAKLELVKKA
G6LKG5      ---------------------------MPTLE----------------ISQAKLELVKKA
Q9ZFT8      ---------------------------MPTLE----------------ISQAKLELVKKA
D6ZQI8      ---------------------------MPTLE----------------ISQAKLELVKKA
Q4K2A8      ---------------------------MPTLE----------------ISQVKLELAKKA
Q8VU31      ---------------------------MPTLE----------------ISQVKLELAKKA
Q4K2E1      ---------------------------MPTLK----------------ITQKKLEIVKKA
Q4K2F7      ---------------------------MPTLE----------------ITQKKLEIVKKA
A5YTV7      ---------------------------MPTLE----------------ISQKKLDLARKA
F9Q345      -------------------------------------------------------MARKA
Q6L5R0      ---------------------------MPTLE----------------IAQKKLDLARKA
A5YTT9      ---------------------------MPTLE----------------IAHKKLDQARKA
E6KKS0      ---------------------------MPTLE----------------IAHKKLDQARKA
F2QF90      ---------------------------MPTLE----------------IAHKKLDQARKA
E0Q2S8      ---------------------------MPTLE----------------IVQKKLDLARKA
A1ILY1      ---------------------------MPTLE----------------IAQKKLDLARKA
Q6L5T0      ---------------------------MPTLE----------------IAQKKLDLARKA
E9FEC5      ---------------------------MPTLE----------------IVQKKLDLARKA
E0PPH9      ---------------------------MPTLE----------------IVQKKLDLARKA
F5VSG9      ---------------------------MPTLE----------------IVQKKLDLARKA
E3CBS0      ---------------------------MNTLE----------------ISKNKLQEIHKA
F9M366      ---------------------------MNTLE----------------ISKNKLQEIHKA
E8K786      ---------------------------MNTLE----------------ISKNKLQEVRKA
F8DFF4      ---------------------------MNTLE----------------ISKNKLQEIHKA
I1ZPH7      ---------------------------MNTLE----------------ISKNKLQEIHKA
E7S8W3      ---------------------------MATLE----------------IVKSKLAAMTQA
D0RXH2      ---------------------------MATLE----------------IIKNKLAEMHQA
Q83YR5      ---------------------------MATLE----------------IIKNKLAEMHQA
Q8GP54      ---------------------------MPLLK----------------LVKSKVDFAKKT
F8HDC3      ---------------------------MPLLK----------------LVKSKADFAKKT
F8LJ75      ---------------------------MPLLK----------------LVKSKADFAKKT
E9DM17      ---------------------------MPLLK----------------LVNSKVNFAKQT
I0QIK6      ---------------------------MPLLK----------------LVKSKVNFAKQT
E8KUY8      ---------------------------MPLLK----------------LVKSKVQFAKQT
Q7X553      ---------------------------MPLLK----------------LVKSKVDFAKKT
Q8GP92      ---------------------------MPLLK----------------LVKSKVDFAKKT
Q7X561      ---------------------------MPLLK----------------LVKSKVNFAKQT
Q7X549      ---------------------------MPLLK----------------LVKSKVDFAKKT
G6ERT1      ---------------------------MPLLK----------------LVKSKVDFAKKT
O87931      ---------------------------MPLLK----------------LVKSKVDFAKKT
Q8GPF6      ---------------------------MPLLK----------------LVKSKVNFAKQT
Q7X555      ---------------------------MPLLK----------------LVKSKVDFAKKT
Q7X557      ---------------------------MPLLK----------------LVKSKVDFAKKT
Q7X563      ---------------------------MPLLK----------------LVKSKVDFAKKT
Q8GMA5      ---------------------------MPLLK----------------LVKSKVNFAKQT
Q8GPA8      ---------------------------MPLLK----------------LVKSKVNFAKQT
Q55205      ---------------------------MPLLK----------------LVKSKVDFAKKT
C2LSE6      ---------------------------MPLLK----------------LVKSKVNFAKQT
Q7X559      ---------------------------MPLLK----------------LVKSKVNFFKQT
F8LXJ4      ---------------------------MPLLK----------------LVKSKVDFAKKT
Q1WCR1      ---------------------------MPLLK----------------LVKSKVDFAKKT
Q8GPC3      ---------------------------MPLLK----------------LVKSKVNFFKQT
E8JMT9      ---------------------------MPQLE----------------LVRAKAQMVKSM
F5X0J9      ---------------------------MPQLE----------------LVRAKAQMIKSM
H2A602      ---------------------------MPQLE----------------LVRAKAQMVKSM
E0PD83      ---------------------------MPQLE----------------LVRSKAQMVKSM
F5X652      ---------------------------MPQLE----------------LVRAKAQMVKSM
G5KD11      ---------------------------MSHLE----------------LVRSKQELYNTA
B9DUJ4      ---------------------------MAQLE----------------LVRSKQELYTRA
G5KAJ2      ---------------------------MAQLD----------------LIRSKRDLFLAA
F1Z124      ---------------------------MARLE----------------LVKSKKELYDIA
Q2KM74      ---------------------------MSQLN----------------LVRSKREHYQHA
C6LDI8      ------------------------------MQ----------------IAFEKLRTMDSV
D4J4T6      -----------------------------MNS----------------INLTRIDDGEAV
D4LTH2      ---------------------------MDE------------------LKLVFPDLPYAV
D4LG06      ---------------------------MNK------------------LKVVFPDLPYAV
A7VF42      ---------------------------MKK------------------LSIDFNEMPYAI
A8SQS8      ---------------------------MKK------------------LNVEFQELPYAV
D5HFS4      ---------------------------MKK------------------LNIEFQELPYAV
C9LAS1      ---------------------------MEQKV----------------VLTDIRKKDYFY
F3AH92      -------------------------MNTELKV----------------VMKDPKRSDYFY
I5ASF8      -------------------------MMLTNYV----------------KLIDSEEGDCFY
E7GL81      ---------------------------MGKEI----------------SLMRDQKEDYQY
G5F9E2      ---------------------------MGKEI----------------SLMRDQKEDYQY
E7GL57      ---------------------------MDNEV----------------FLKRTAIEDYQY
G5F9A9      ---------------------------MDNEV----------------FLKRTAIEDYQY
E7GL40      ---------------------------MHDEIVIEDLISPDERGMGELVLKGFEVNDYQY
G5F9H2      ---------------------------MHDEIVIEDLISPDERGMGELVLKGFEVNDYQY
A8RK85      ---------------------------MDEIL----------------HLKNTGRKDYFY
G5HTB2      ---------------------------MDQIL----------------NLKNTGEKNYHF
G5HNC5      ---------------------------MGQTL----------------SLKNTGRKDYHY
C0CZV9      ---------------------------MRQTV----------------ALNRSMKDDYHY
A8RSK9      ---------------------------MSQFV----------------TLNRIMKDDYHY
C5EN03      ---------------------------MKQII----------------TLNREMKDDYHY
G5HG45      ---------------------------MKQII----------------TLNRDMKDDYHY
D9ST44      ------------------------------------------MNNNRLITVEHPNSQ--I
G2Z8Q3      ----------------------------------------MPKERSKLLIKHQKGSK--T
C8W5K2      ------------------------------------------MFSNKLITINNPKSP--I
F5LM71      --------------------------------------MSPSNKQRPIIAHSNPMSP--I
D7VBW4      --------------------------MKLRRRVAN------MHTGIQLTTLTAPMSV--V
F9UQ54      --------------------------MKLRRRVAN------MHTGIQLTTLTAPMSV--V
H6LKR8      ------------------------------------------MNLASLITLNDPTSH--V
E0I7B5      --------------------------------------MSRQNSQANLITISNPKSP--I
D7UYE4      ---------------------------MKKKETGM-------RRGLSLIAHNKPKSI--V
Q4A120      --------------------------MAKKIDTEI-------T---TLITHKKPKAV--V
D9SVC7      -------------------------------------------MFKSLITYRDPDSI--T
D9S1J9      ----------------------------------------MEEMDAQLFVMDDPKSV--V
C0GGR5      ----------------------------MKKKKRKTNTHATDNYLDKLITSKNAKSP--V
C6CSC8      --------------------------------------MSQSENKRRLISVANPRSP--V
A3ICA3      --------------------------MLFKRKTKR------IPMARKLITVSDIMSI--P
B1HR41      --------------------------MLFKRKTKK------IPMARKLVTVSDMMSI--P
D6Y034      --------------------------MAFRNPFAKKVEDHLTEKQRSLITHFSPKSP--I
Q8EME8      --------------------------MARKKLSNV------NNKMRHLITKINPRSP--I
F3Y922      --------------------------MSEKNSLKK-----QRTKPISLITMSDPASP--I
G4L594      --------------------------MKRKNERKG-----TQTHAVSLVSLIDPSSP--V
C9B454      --------------------------MARTQKQKA-----AQTNAVSLITLTNPSSP--I
Q3XYS6      --------------------------MARTQKQKV-----IQTHAVSLITLTNPSSP--I
C9ALZ9      --------------------------MARTQKQKA-----AQTHAVSLVTLTNPSSP--I
C9BUG7      --------------------------MARTQKQKA-----AQTHAVSLVTLTNPSSP--I
D4RJF4      --------------------------MARTQKQKA-----AQTHAVSLITLTNPSSP--I
C8ZXT9      --------------------------MAKQQERKG-----TQTHAVSLITLVDPSSP--I
G5IRQ6      --------------------------MAKQQERKG-----TQTHAVSLITLVDPSSP--I
C9A6V5      -----------------------------------------------MITLIDPSSP--I
C9CHY8      --------------------------MPKKQERTG-----TETHAVSLITLVDPSSP--I
Q814Z0      --------------------------MALNLFKKK----KSHRQRRQLIAHQQPKSP--I
B9IRQ6      --------------------------MALNLFKKK----KNHRQRRQLIAHQQPKSP--I
B7HXB4      --------------------------MALNLFKKK----KNHRQRRQLIAHQQPKSP--I
Q72XH8      --------------------------MALNLFKKK----KNHRQRRQLITHQQPKSP--I
A0RL70      --------------------------MALNLFKKK----KNHRQRRQLIAHQQPKSP--I
Q6HB09      --------------------------MALNLFKKK----KNHRQRRQLIAHQQPKSP--I
F0PU64      --------------------------MALNLFKKK----KNHRQRRQLIAHQQPKSP--I
B7HFH1      --------------------------MVLNLFKKK----QNYRQRRQLIAHQQPKSP--I
B7IQS8      --------------------------MALNLFKKK----KNHRQRRQLIAHQQPKSP--I
B3ZRD6      --------------------------MALNLFKKK----KNHRQRRQLIAHQQPKSP--I
B5UQ73      --------------------------MALNLFKKK----KNHRQRRQLIAHQQPKSP--I
G9QCG3      --------------------------MALNLFKKK----KNHRQRRQLIAHQQPKSP--I
Q3EV64      --------------------------MALNLFKKK----KNHRQRRQLIAHQQPKSP--I
Q5WBB4      --------------------------MARLTRAKK----KPVQKKRQLIADVNRRSP--I
B1YMM5      ----------------------------MAKKNKM------NKDARNLITVTQPKSP--V
D7WMM8      --------------------------MFWKKKKKK----KLVKMARKLVTIANGHSF--I
A7Z921      --------------------------MGFRKKKSR--------RGLAQISVLHHKSL--V
I2CAF2      --------------------------MGFRKKKSR--------RGLAQISVLHHKSL--V
A7Z9K0      --------------------------MLTRKKDKP--------GKRSVIAMSEPKSI--N
I2CB16      --------------------------MLTRKKDKP--------GKRSVIAMTEPKSI--N
I2HW53      --------------------------MLTRKKDKP--------GKRSVIAMSEPKSI--N
G9QKR4      ----------------------------MARKTKK------IDNKRKLIAKLNPKSP--I
D5DBK3      ----------------------------MARKRKENKNDKVLTLKRRLLAHNSPKDP--V
D5DY81      ----------------------------MARKKKDQKNDKMLTLKRRLLAHNSPKDP--V
Q2BFS5      --------------------------MLFKNKPKA----SVNDSRRKLVAAYNTKSP--I
A4ITF3      ----------------------------MAAKKRK----KFQKAERNLITFDDPKSP--I
C5D961      ----------------------------MARRDRK----KIQKIERSLITMEDPKSP--I
G8MZ93      ----------------------------MARKPAT----SIRKAERRLITVDNPKSP--I
C6CW37      ------------------------------------MSMRRSTSDNRLVVLLNPSSP--V
G9RSY9      -------------------------------------------------------TPFQY
F7K9V1      ------------------------------------------MQTVTFNSIEKLDFR--T
F7K8E9      ------------------------------------------MQTITFSAIEKLDFR--T
F7KL96      ------------------------------------------MQTVTFNAIEKLDFR--T
B9Y884      ----------------------------------------MLRVGEELITILDPESS--A
A5Z5P9      ------------------------------------------MNKIKMDLTKELPYA--V
F2I6Z7      ----------------------MFNFKQRKI---DKKNKE-QRRGVSLITAADPNHV--I
D4YHG7      -----------------------MFKNKRKHF--DKMNAE-QRRGASLITVTQPNDV--I
C1J9I3      ----------------------MMQLSFSKLFHRHQEDQETQKNGVMLVAFAEPKHV--V
B1MZT1      ----------------------MAFFKKNKALG-DGLSAETMTKGARLIAAAEPKNP--V
H1WR06      ----------------------MAFFKKNKALG-DGLSAETMTKGARLIAAAEPKNP--V
H1X4N2      ----------------------MSFFKKRSSVDKDGLSVETMTTGARLITAAEPKNP--V
Q03W95      ----------------------MSFFNKGRAVGKDGLSVETMTKGARLITAAEPKNP--V
F0SX22      ------------------------MRGIKRLLNKGRNKTPDIVRDKLNILNSDSAFS--T
B6W7H4      --------------------------------------------MAKKHGYYNTTSV--F
F0GT81      --------------------------------------------MSKKGNKYYTASL--Y
B1R3X6      ----------------------------------------------MFLVDKDPKSI--A
Q8XN76      ----------------------------------------------MFLVDKDPKSI--A
B1BNK1      ----------------------------------------------MFLVDKDPKSI--A
B1V0N7      ----------------------------------------------MFLVDKEPKSI--A
Q0SVR8      ----------------------------------------------MLILEKNPKSV--A
B1BNH3      ----------------------------------------------MLILESNSQSV--A
Q8XN46      ----------------------------------------------MLILESNSQSV--A
B1V1Z4      ----------------------------------------------MLILESNSQSV--A
G5GFW0      ------------------------------------MDIRGQNGTVKLRPPNKEDYF--Y
C2EFR6      --------------------------MEIMVKVRANGERGCEWMQKFELRLDDIDFQ--S
F3ATF5      ----------------------------------------MAEQKVIMTDPRQEDYF--Y
D4M2S0      ----------------------------------------MAIQRVMLTDSRKEDVF--Y
F4BS19      --------------------------------MFKKRLKEKKYEDKNLITLIDPSSI--I
D4CG08      --------------------------------------MGKMMKVVNIHTDENRDFR--F
D4MP30      --------------------------------------MGKMMKVVNIHTDENRDFR--F
C6LCS5      ------------------------------------------MANINIDTMTKLSFR--V
B0P2G2      ------------------------------------------MKKLVMDLPEINDYR--M
D4MW29      ------------------------------------------MKKLVMDLPEINDYR--M
E5VMX8      ------------------------------------------MKKLVMDLPEINDYR--M
D4JMC2      ------------------------------------------METVVINQIKDQSYT--M
D6E0V4      ------------------------------------------METVVINQIKDQSYT--M
D6E330      ------------------------------------------MELVKFGKLKEQSYT--M
C4Z8M5      ------------------------------------------MELVKFGKLKEQSYT--M
D4JI67      ------------------------------------------MELVKFGKLKEQSYT--M
D3AC80      ------------------------------------------MQKVLLRKHEKLDFR--A
G5IFS3      ------------------------------------------MEQIRFRKREQLDFR--A
D4RX67      ------------------------------------------MQKISISKIGKLDYR--T
A6BIG7      ---------------------------------------MEDMADIVLKKVIK-DYR--S
C0C0F8      ---------------------------------------MMEMQEIYLKNMTK-DYR--S
Q97EP8      --------------------------------------MLVV--------KDKPKSP--I
Q97ER5      --------------------------------------MLVV--------KDKPKSP--I
D2RIR2      --------------------------------------MEEIKLIV----ENDPKSP--I
G0VNK6      --------------------------------------MAEIDFIT----HYDSRSP--V
I0GRR2      --------------------------------------MANIDLIV----HNDAKSP--I
A0PZ02      --------------------------------------MLIV--------EKEPKSI--A
B1B736      --------------------------------------MLIV--------EKEPKSI--A
F6BI62      --------------------------------------MIDVNNNVFKNNVVNSKTT--V
Q8RBS5      --------------------------------------MVMARNLI----LSDPKSP--F
G2MWC2      --------------------------------------MVAARNLI----VADPKSP--F
B0K4N1      --------------------------------------MVVARNPI----VADPKSP--F
B0KAR5      --------------------------------------MVVARNPI----VADPKSP--F
E8UV29      --------------------------------------MVVARNPI----VADPKSP--F
C7ISF7      --------------------------------------MVIARNPI----VADPKSP--F
C9AAE5      -----------------------------------------------MRSMKENYSI--I
H7F6C8      -----------------------------------------MSNTKRNKRRKDSYSP--T
H7F5T6      -----------------------------------MKKTDKKDLKNRLVALHEPSSP--Q
B1R3V1      -----------------------MWESK--------------GGKWMLILESNSQSV--A
D4YF13      -----------------------MFNFKSKKKQQKLENEQ--KLGSPLVTYFEPMSA--I
E6U7N4      ---------------------------------MANKHRV--LSHDVLLSSGNVPFQ--F
C8VYQ6      ------------------------------------------MAVEKLITLHSPKSP--I
D3AE78      ------------------------------------------MQKVEFKKLPRLDFR--A
A4J8V0      -----------------------------------------MMLNNRLVVLENPKSP--V
A8U9F4      -----------------------MFNKK--------KKQLDTSERPSLVTLTRPSSV--I
F4BSD9      -----------------------MFNKK--------EKKLDNNERPSLVTLTRPSSV--I
F7V792      ---------------------MEYRNQEGFERKSGSGENIIPKHSLEIEGIQELSYA--L
F6IR93      ---------------------MGLKRLK------RKTTAE--TSGVQLTTITAPMSV--V
G0M0F9      ---------------------MGLKRLK------RKTTAE--TSGVQLTTITAPMSV--V
F6ITB4      -----------------------MFKRK------EQSTTT--TAPINLTAINEPMSV--I
G0M1X9      -----------------------MFKRK------EQNTTT--TAPINLTAINEPMSV--I
G0LYN9      -----------------------MFKRK------GQNITT--TAPINLTTINEPKSV--I
D7VC13      -----------------------MFKRK------EKNIAT--TAPINLTTINEPMSV--I
F9UMZ6      -----------------------MFKRK------EQNITT--TAPINLTTINEPMSV--I
I5AV01      -------------------------------------------MDVIKIKQPDQDYF--T
B0GAL3      ----------MMQENEKQARTTYTNAQAKAAMSRRDNKAS--KLRVELTDPRKSNYF--Y
G1WUK2      MDQERRSQREMMQENEKQAKTTYTNAQAKAAMSRRDNKAS--KLRVELTDPRKSNYF--Y
E0RZL3      ---------------------------------------M--QNAKLHFSQSENNYQ--I
D8FLF8      ---------------------MAFGRKN-----YLDNETM--KNGAKLITLANPQSV--I
F0K0J7      ---------------------MAFGRKK-----HLNNDTM--KNGVKLITLANPQSV--I
Q1G8E4      ---------------------MAFGRKK-----HLNNDTM--KNGVKLITLANPQSV--I
C4VP08      ---------------------MALFRKK-----RGTDETM--HYGAKLITIAKPQSQ--I
D6S4X4      ---------------------MALFRKK-----RGTDETM--HYGAKLITVAKPQSQ--T
D0DJH0      ---------------------MALFRKK-----RGTDDTI--KNGAQLITVADPRSA--I
C7XKF3      ---------------------MALFRKK-----RGTDDTI--KHGAKLITVADPRSA--V
E3R264      ---------------------MALFRKK-----RGTDDTI--KHGAKLITVADPRSA--V
D5GZJ8      ---------------------MSLFRKK-----RGTDDTI--KHGAQLITVADPRSA--V
C2EPK5      ---------------------MSLFRRK-----RGTNETI--EKGAKLITVAKPKGP--V
A4ZGZ8      ---------------------MSLFKKK-----RGTDETI--KKGAKLITVADPKSP--V
A8YX89      ---------------------MSLFKKK-----RGTDETI--KKGAKLITVADPKSP--V
F0NWJ7      ---------------------MSLFKKK-----RGTDETI--KKGAKLITVADPKSP--V
E4SMV5      ---------------------MPLFKKK-----RGTDDTI--KNGAKLITVAKPKSP--I
F0TGY2      ---------------------MPLFKKK-----RGTDDTI--KNGAKLITVAKPKSP--I
Q5FIC7      ---------------------MPLFKKK-----RGTDETI--KHGAKLITVAKPKSP--I
F2M2M6      ---------------------MPLFKKK-----RGTDDTI--KNGAKLITVAKPKSP--I
G7M0Q3      -------------------------------MKIRNKKNK--NKKNIFSVEDKPKSV--V
G7M1R9      ---------------------------MFKARKLEKAVAS--QQYRGFVVEKKPKSI--V
A6M2L9      -------------------------MKRYK--LEKTVVDN--RIHAGFIVEDKPKSI--V
G7M566      -------------------MSVLEAIKHYKKGKDNNTIDD--RIHAGFIVEEKPKSV--V
G2KUP1      -------------------MIMSLFRKN----KKLDDNTM--KNGAPLIVEYKPISP--I
G8PE06      ---------------------MSIFNRK----RKLDDESL--KNGVGLIAYTEPASV--I
Q03GL8      -----------------------MFKKK----QKLDNESL--KNGVGLVTFTDPTST--I
E0NHP4      -----------------------MFFKK---KPKLDNESL--KNGVGLITYNDPTST--I
F4FXQ7      ---------------------MNIFRRK---QKKISTDTL--RNGVKLITDVDPKDI--V
C0WV35      ---------------------MNIFHRK---RKKLSTDTL--RNGVKLITDVDPKDI--V
H1LCW3      ---------------------MNIFHRK---RKKLSTDTL--RNGVKLITDVDPKDI--V
C2JZS1      ---------------------MTLKFKKLFSHNHVDQETQ--KNGVFLVTFAEPKHV--V
Q58Z10      ---------------------MNFSLEKILHRHKEDQETQ--KNGVMLVTFAEPKHV--V
E9SAU1      ---------------------MASIKKN----QSSNTRTR--RRTLMDKSVAFP-----V
Q38VG5      ---------------------MGLFRKE----KKLDQDSM--KEGVGLITLTSPTSV--I
F0HVF1      ---------------------MALFGRK----NHLDNETI--KNGVKLITLANPQSV--I
G6F8G9      ---------------------------------------M--KNGVKLITLANPQSV--I
C2EWM3      ---------------------MSLFKKK----TNASNETI--RYGAKLITVKDPKNV--I
F8DRU2      ---------------------MSLFHRT----QQQSTDTM--NNGAKLITVAHPKSP--I
B3XL23      ---------------------MSLFHRT----QQQSTDTM--DNGAKLITVAHPKSP--I
F8KGP1      ---------------------MSLFHRT----QQQSTDTM--DNGAKLITVAHPKSP--I
H4GK03      ---------------------MGLFSRK----KIQSVDTM--VNGANLVTLTKPQSL--V
B2GF33      ---------------------MGLFKHR----YTESTDTM--DNGAMLITLADPKSG--P
C0WW26      ---------------------MGLFKHH----YTESIDTM--DNGAMLITLADPKSG--P
D0DSJ4      ---------------------MGLFKHR----YTESTDTM--DNGAMLITLANPKSG--P
C0ZHV8      ---------------------------------MSMRRQKPDDRYQKLIAHWEPLSP--L
H1BJT1      ------------------------------------------------MSKNKNTYKFDN
F8FCE2      -------------------------------------MPQRSSKNNVIITEANPQSP--I
H6NE43      -------------------------------------MPQRSSKNNVIITEANPQSP--I
I0BSG4      -------------------------------------MPQRSSKNNVIITEANPQSP--I
Q83VF9      ----------------------------------MAKNKRSIDNNLYLITSVNPQSP--I
G8P3D7      ----------------------------------MAKNKRSIDNNRYIITSVNPQSP--I
O06030      ----------------------------------MAKNKRSIDNNHYIITSVNPQSP--I
G9M880      ----------------------------------MAKNKRSIDNNRYIITSVNPQSP--I
G6FD42      ----------------------------------MAKNKRSIDNNRYIITSVNPQSP--I
F9VC44      ----------------------------------MAKNKRSIDNNRYIITSVNPQSP--I
A9QSJ4      ----------------------------------MAKNKRSIDNNRYIITSVNPQSP--I
Q3ZK50      ----------------------------------MAKNKRSIDNNRYIITSVNPQSP--I
E3GPC6      -------------------------------------------MKDSIITYKSPKDP--I
G0V447      ---------------------------------------------MKPILLKNPKSP--I
H7F1R7      ---------------------------------------MLKLSERKLITYANPSSP--I
E6UHY4      -------------------------------MANTKKIPGGNRNRRRTLMDKNVAFP--V
D9QTC6      -----------------------------MIKMDKERRERIQSRDVELITNYSSKSP--L
D9SR41      -------------------------------------------MLKSLVTHLDPKSV--I
P95696      -------------------------------------MSKKENTTTTLFVYEKPKST--I
Q2G1K7      -------------------------------------MSKKENTTTTLFVYEKPKST--I
A8YPQ5      -------------------------------------MTNTRRSTSSLIVHEQPKSP--I
Q2FUV2      -------------------------------------MTNTRRSTSSLIVHEQPKSP--I
P39851      -------------------------------------MAKKKSTISPLYVHDKPKST--I
C5QNG4      -----------------------------------MMAEKRKKLEQPLFVNDKPKSI--I
Q4L9H7      --------------------------------MPKKNKEKRKKLSHPLYVHDKPKSV--A
E4Q5T5      -----------------------------------------MNAVKEVIALYNPRSP--I
E4SDX4      -----------------------------------------MNAVKEVIALYNPRSP--I
E4S7Y6      -----------------------------------------MSIVKEVIAYYNPRSP--I
C6CS80      -------------------------------------MSRSDLKLRPVVADANPTSP--I
E6LD64      --------------------------------MAKNNKRGTETKPVSLITLIDKSSP--I
F0EKB9      ------------------------------MMAKKQERTGTQTHAVSLITLIDPSSP--I
H7F571      -------------------------------------MGERTSGGKNLITIVNPNGP--I
F5LE48      -------------------------------------MLASTNNSKVLIADVNPKSQ--I
E7RDR3      ---------------------------------MARKKKVLQETARKLIAFTTPRSV--V
E7RG08      ---------------------------------MVKKKNKPEVKNRKLIAFTNPKSR--V
F6CNF5      ---------------------------------------MSKANGYELITHKHPRSP--V
G2FWX4      -------------------------------------------MAYSLITLEESKSP--I
G2FM59      -------------------------------------------MAYSLITLEQTKSP--I
G7WJV1      -------------------------------------------MVYSLITFEKTKSP--I
H5XZD4      -------------------------------------------MVYSLITFEQTKSP--I
H5XZG7      -------------------------------------------MSHSLITHEQTKSP--I
G7W773      ---------------------------------------------MTLITHEQTKSP--I
G2FWT8      -------------------------------------------MAYSLITLEQSKSP--I
I4DBG8      -------------------------------------------MKHSLITLEQSKSP--V
C0EBA6      -------------------------------------MSINHKKHTHLDVVLGKTSPFAI
Q9K6R0      -------------------------------MLGKGSKQKNGSKQRELITHIKKNSP--I
I2HVL2      -------------------------------MRRLGFRKKKSRRGLAQISVLHHKSL--V
D4G1R2      ------------------------------------------------------------
G4EQZ7      ----------------------------------MIFRKKKARRGLAQISVLHNKSV--V
P71051      ----------------------------------MIFRKKKARRGLAQISVLHNKSV--V
E0U2Z3      ----------------------------------MFFRKKKARRGLAQISVLHNKSI--V
G4P114      ----------------------------------MVFRKKKARRGLAQISVLHNKSI--V
A9VRC3      -----------------------------MALNSLFKKKQNHRQRRQLIAHQQPKSP--I
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      -----------------MVCTVQEKKQKERLRRLAPKKTKLLNTRRKLIAKLNPKSP--I
P96716      ------------------------------MALRKNR---GSRMQRNVIAMTEPKSL--N
G4EQF3      -------------------------------------------MQRNVIAMTEPKSL--N
D4G2E1      -------------------------------------------MRRNVIAMTEPKSL--N
I0F9R6      -------------------------------------------MRRNVIAMTEPKSL--N
E0TTZ6      ------------------------------MALRKTR---GSWMRRTVIAMTEPKSL--N
G4P1M7      ------------------------------MALRKSS---GSWIRRNVIAMTEPKSL--N
A8FHL9      ------------------------------MIFKRKK---REKRDLSCISVLNPHSV--I
Q5KUM5      -----------------------------MKPLARKPATSIRKAERRLITVDNPKSP--I
D3FZP4      ------------------------------MLKRNQSVSTRTQQQRKVVSHSNPKSP--I
I0JRK4      ------------------------------MALSKKK-KNQQTSVRSIIANDNPKSP--I
I3EBB3      ------------------------------MVLKNKK-KALLQHKRKLITKLNPKSP--I
                                                                        

E3CP62      A-KQTEEYYNAIRTNIQFSGA---QMKVISISSVEAG-EGKSTTSVNLAISFA-S-VGLR
C2KHF1      S-EQ----FRTLRTNIEFAAVSRGEIKTLLISSALPS-EGKSTVSSNLAIVYA-Q-QGKK
G9WIQ9      S-EQ----FRVLRANIDFAAATINHFQTILFTSSEMS-DGKSTVAQNLAVTWA-Q-TGKR
A0NKF6      A-EQ----FRVLRANIDFAAASLKNFKTVLFTSAEMS-DGKSTAAQNLAVTWA-Q-TGKR
Q04DV8      A-EQ----FRVLRANIDFAAASLKNFKTVLFTSAEMS-DGKSTAAQNLAITWA-Q-TGKR
D3LB10      A-GQ----FRVLRANIDFAAASLKNFKTVLFTSAEMS-DGKSTVAQNLAVAWA-Q-NGKR
B8D0N2      ALEA----YRLLRANLEFVAKK-NEARTVLITSTGPGAEGKSTISVNLAFAFA-E-IGKR
F2I4B7      A-EQ----FRTIRTNIQFSMLD-KELKTFNVTSPGPA-SGKSFLSANIAAAFA-S-DDKR
C2CI44      YDEA----IRSVRTNIQFSSLD-KKNKIIAVTSTKPS-EGKSTVIYKLAKSFA-D-NGER
C7RGH6      YDEA----IRSVRTNIQFSSLD-KKNKVISITSTKPA-EGKSTVIYKLAKSFA-D-NGDK
C0CK73      A-EA----IKTLRTNIMYS----EDVKAIMLTSTMPS-EGKSTVSLELARSFA-A-LGKN
Q1WTC8      --ES----FKTLRFNVEFSG---EKNQVFYITSTYPN-EGKSTVSLELALAFS-D-NGKK
E8JWI5      E-EY----YNALRTNIQLSG---EDIKVIAVSSTFPG-EGKTTTSTNLALTFA-K-AGHK
F3AHH0      A-ES----YKSLRANLQFCG---DDKKVLAITSCTPN-EGKSSVTLNLAVSLA-E-SGKK
F7K0U1      N-EA----YKNLRTNIEFSG---EENKVLVFTSCTPN-EGKSTVSLSVASSLA-E-SGKK
C4Z672      R-EA----YKMLRTNIEFSG---DNNKVIFITSTTPG-EGKSTVSFELAMSFA-Q-NGMK
P0C0T9      E-EY----FNAIRTNIQFSG---KENKILAITSVREG-EGKSTTSTSLALSLA-Q-AGFK
Q04663      E-EY----FNAIRTNIQFSG---KENKILAITSVREG-EGKSTTSTSLALSLA-Q-AGFK
Q67AY4      E-EY----FNAIRTNIQFSG---KENKILAITSVREG-EGKSTTSTSLALSLA-Q-AGFK
Q3K0T0      E-EY----FNAIRTNIQFSG---KENKILAITSVREG-EGKSTTSTSLALSLA-Q-AGFK
C5NWJ8      E-EY----YNALRTNIQFLG---KDKKVIAITSTSEN-EGKSTVSTNLAISLA-K-LGLK
F3A499      D-EY----YNAIRTNIQFLG---KDKKVIVITSTSEN-EGKSTVSTNLAISLA-K-LGLK
Q4JZ55      K-EY----FNALQTNIQLSG---DGLKVISVTSTVKN-EGKSTISVGLSMSLA-L-SGYK
G5JTD5      E-EY----YNSIRANIQFSG---SDIKVIALTSVQPK-EGKSTTTMSLAVSFA-R-AGYR
G3G7C1      E-EY----FNAIRTNIQLSG---EDIKVVGITSVQLN-EGKSTIAASLAIAYA-R-SGYK
G3G7J9      E-EY----FNAIRTNIQLSG---EDIKVVGITSVQLN-KGKSTIAASLAIAYA-R-SGYK
G3G7G6      E-EY----FNAIRTNIQLSG---ADIKVVGITSVQSN-EGKSRTAASLAIAYA-R-SGYK
G8DUB0      E-EY----LNAIRTNIQLSG---ADIKVVGITSVQSN-EGKSTTAASLAIAYA-R-SGYK
G3G7I8      E-EY----FNAIRTNIQLSG---ADIKVVGITSVQSN-EGKSTTAASLAIAYA-R-SGYK
G3G7J4      E-EY----FNAIRTNIQLSG---ADIKVVGITSVQSN-EGKSTTAASLAIAYA-R-SGYK
G7SG34      E-EY----FNAIRTNIQLSG---ADIKVVGITSVQSN-EGKSTTAASLALAYA-R-SGYK
G8DTZ0      E-EY----FNAIRTNIQLSG---ADIKVVGITSVQSN-EGKSTTAASLAIAYA-R-SGYK
G8DU07      E-EY----FNAIRTNIQLSG---ADIKVVGITSVQSN-EGKSTTAASLALAYA-R-SGYK
A4VTU3      E-EY----FNAIRTNIQLSG---ADIKVVGITSVKSN-EGKSTTAASLAIAYA-R-SGYK
G7SNU6      E-EY----FNAIRTNIQLSG---ADIKVVGITSVQSN-EGKSTTAASLAIAYA-R-SDYK
G8DU31      E-EY----FNAIRTNIQLSG---ADIKVVGITSVQSN-EGKSTTAASLAIAYA-R-SDYK
D5AGQ5      E-EY----FNAIRTNIQLSG---ADIKVVGITSVKSN-EGKSTTAASLAIAYA-R-SGYK
Q9X4U7      E-EY----FNAIRTNIQLSG---ADIKVVGITSVKSN-EGKSTTAASLAIAYA-R-SGYK
A3CQY2      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
E8KLY9      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
F0FHA8      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
F0I4H5      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
F0IAY3      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
F0IJI2      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
F0IS53      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
F2C9N0      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
F2CH53      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
F3SM32      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
F3UDW7      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
F3UNJ4      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
F0FQQ5      E-EY----YNALSTNVQLSG---ANIKMVEISSVTAN-EGKSTTSVNLAAAFA-R-AGHK
D6R2T8      E-EY----YNALSTNVQLSG---ANIKVVEVTSVMPN-EGKSTTSTNLAIAFA-R-SGYK
F3UUQ2      E-EY----YNALSTNVQLSG---ANIKVVEVTSVMPN-EGKSTTSTNLAIAFA-R-SGYK
E6IZC2      E-EY----YNALRTNIQLSG---DNIKVIAVTSVQSG-EGKSTTSTNLAIAFA-R-SGYN
G6A745      E-EY----YNALRTNIQLSG---ENIKVIAVTSVQSG-EGKSTTSTNLAIAFA-R-SGYN
A8AZR3      E-EY----YNALRTNIQLSG---EDIKIVAVTSVQPN-EGKSTTSTNLAIAFA-R-AGYT
F9HJP6      E-EY----YNALRTNIQLSG---ENIKIVSLTSVHPN-EGKSTTSTNLAIAFA-R-AGYK
Q4JYT9      E-EN----YNALRTNIQLSG---DNLRVLSISSVKPG-EGKSTTSINIAWAFA-R-AGYK
Q4JZY1      E-EN----YNALRTNIQLSG---DNLKVLSISSVKPG-EGKSVTSMNIAWAFA-R-AGYK
E1LQJ7      E-EH----YNALRTNIQLSG---DNLKVLSISSVKSG-EGKSTTSINIAWAFA-R-AGYK
F9HC65      E-EH----YNALRTNIQLSG---DNLKVLAISSVKPG-EGKSTTATNIAWAFA-R-AGYK
E1LPE7      E-EY----YNALRTNVQLSG---NDLKVIVVTSVDSS-EGKSTTSTNIAWAFA-R-AGYK
F9MJW5      E-EY----YNALRTNVQLSG---NDLKVIVVTSVDSS-EGKSTTSTNIAWAFA-R-AGYK
E8KDN2      E-EY----YNALRTNIQLSG---DKLKVIAISSVRPG-EGKSTTSINIAWAFA-R-AGYK
E8K322      E-EY----YNALRTNIQLSG---DGLKVIALSSVRPG-EGKSTTSTNIAWAFA-R-AGYK
F9PEU4      E-EY----YNALRTNIQLSG---DGLKVIALSSVRPG-EGKSTTSTNIAWAFA-R-AGYK
F9PZP7      E-EY----YNALRTNIQLSG---DGLKVIALSSVRPG-EGKSTTSTNIAWAFA-R-AGYK
C1CBD1      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSINIAWSFA-R-AGYK
Q7WVX0      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSINIAWSFA-R-AGYK
P96475      E-EY----YNTLCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIAMSFA-R-AGYK
Q9AHD2      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSINIAWSFA-R-AGYK
Q4K2Q7      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
Q4K0T5      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
Q4K0E1      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIAWSFA-R-AGYK
Q9AH95      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSINIAWSFA-R-AGYK
Q4K1M4      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
Q4JZ18      E-EH----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
Q54520      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
Q4JYH5      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVSIARSFA-R-AGYK
Q4K0V2      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPE-EGKTTTSVNIARSFA-R-AGYK
A5M4L1      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
B2ILP5      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
C1CCB9      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
Q4K1S7      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
P72512      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
Q4JZ84      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
Q4K0X5      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
Q4K0Z6      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
Q4K195      E-EH----YNALCTNIQLSG---DKLKVISVTSVSPG-EGKTTTSVNIAWSFA-R-AGYK
Q4K0A0      E-EY----YNALCTNIQLSG---DKLKVISVTSVNPG-EGKTTTSVNIARSFA-R-AGYK
Q4K0K2      E-EY----YNALCTNIQLSG---DKLKVISVTSVSPG-EGKTTTSVNIAWSFA-R-AGYK
Q4K1F9      E-EY----YNALCTNIQLSG---DKLKVISVTSVSPG-EGKTTTSVNIAWSFA-R-AGYK
Q4K045      E-EN----YNALCTNLQLSG---DDLKVFSITSVKLG-EGKSMTSTSIAWTFA-R-AGYK
G6C7Z1      E-EY----YNALCTNLQLSG---DDLKVFSITSVKAG-EGKSTTSTNIAWAFA-R-AGYK
D2ERX8      E-EY----YNALCTNLQLSG---DDLKVFSITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
F9LZC4      E-EY----YNALCTNLQLSG---DDLKVFSITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
F9P1W8      E-EY----YNALCTNLQLSG---DDLKVFSITSVNPG-EGKSTTSTNIAWAFA-R-AGYK
I0J9C9      E-EY----YNALCTNLQLSG---DDLKVFSITSVKLG-EGKSTTSTNIAWAFA-H-AGYK
A6YIA8      E-EY----YNALCTNLQLSG---DGLKVFSITSVKLG-EGKSTTSTNIAWAFA-R-AGYK
Q4K005      E-EN----YNALCTNLQLSG---DDLKVFSITSVKAG-EGKSMTSTNIAWAFA-H-AGYK
Q4JZL7      E-EY----YNALCTNLQLSG---DGLKVFSITSVKIG-EGKSTTSANIAWAFA-R-AGYK
E5F5C5      E-EY----YNALCTNLQLSG---DGLKVFSITSVKLG-EGKSTTSTNIAWAFA-R-AGYK
Q4JZG7      E-EY----YNALCTNLQLSG---DGLKVFSITSVKIG-EGKSTTSANIAWAFA-R-AGYK
Q4JZK1      E-EY----YNALCTNLQLSG---DGLKVFSITSVKIG-EGKSTTSANIAWAFA-R-AGYK
A5LJS0      E-EY----YNALCTNLQLSG---DGLKVFSITSVKIG-EGKSTNSTNIAWAFA-R-AGYK
Q9AHB7      E-EY----YNALCTNLQLSG---DGLKVFSITSVKIG-EGKSTTSTNIAWAFA-R-AGYK
Q4K1B7      E-EY----YNALCTNLQLSG---DGLKVFSITSVKIG-EGKSTTSANIAWAFA-R-AGYK
Q4JYK8      E-EY----YNALCTNLQLSG---DDLKVFSITSVKLG-EGKSTTSTNIAWAFA-R-AGYK
Q4K0M3      E-EY----YNALCTNLQLSG---DDLKVFSITSVKLG-EGKSTTSTNIAWAFA-H-AGYK
Q9AHA4      E-EY----YNSLCMNLQLSG---DGLKVFSITSVKLG-EGKSTTSTNIAWAFA-R-AGYK
Q9X9A1      E-EY----YNSLCMNLQLSG---GGLKVFSITSVKLG-EGKSTTSTNIAWAFA-R-AGYK
Q9ZII6      E-EY----YNSLCTNLQLSG---DGLKVFSITSVKLG-EGKSTTSTNIAWAFA-R-AGYK
Q8KWQ0      E-EY----YNALCTNLQLSG---DGLKVFSITSVKLG-EGKSTTSINIAWAFA-R-AGYK
Q4JZW7      E-EN----YNALCTNLQLSG---DDLKVFSITSVKLG-EGKSTTSTNIAWAFA-H-AGYK
Q4JYX9      E-EY----YNALCTNLQLSG---DNLRVFSITSVKLG-EGKSTTSTNIAWAFA-R-AGYK
Q4K0R7      E-EY----YNALCTNLQLSG---DNLKVFSITSVKLG-EGKSTTSTNIAWAFA-R-AGYK
Q4K1K6      E-EY----YNALCTNLQLSG---DGLKVFSITSVKLG-EGKSTTSTNIAWAFA-R-AGYK
Q4JZS3      E-EN----YNALCTNLQLSG---DDLKVFSITSVKQG-EGKSTTSTNIAWAFA-R-AGYK
Q4K0I2      E-EY----YNALCTNPQLSG---DDLKVFSISSVKAG-EGKTTTSTNIAWAFA-H-AGYK
Q4K254      E-EY----YNALCTNLQLSG---DDLKVFSITSVKAG-EGKTTTSINIAWAFA-R-AGYK
Q4K237      E-EY----YNALCTNLQLSG---DDLKVFSITSVKAG-EGKTTTSTNIAWAFA-R-AGYK
B1I967      E-EY----YNALCTNLQLSG---DDLKVFSITSVKAG-EGKTTTSTNIAWAFA-R-AGYK
G6J8A4      E-EY----YNALCTNLQLSG---DDLKVFSITSVKAG-EGKTTTSTNIAWAFA-R-AGYK
G6LKG5      E-EY----YNALCTNLQLSG---DDLKVFSITSVKAG-EGKTTTSTNIAWAFA-R-AGYK
Q9ZFT8      E-EY----YNALCTNLQLSG---DDLKVFSITSVKAG-EGKTTTSTNIAWAFA-R-AGYK
D6ZQI8      E-EY----YNALCTNLQLSG---DDLKVFSITSVKVG-EGKTTTSTNIAWAFA-R-AGYK
Q4K2A8      E-EY----YNALCTNLQLSG---DDLKVFSITSVKPG-EGKTTTSTNIAWAFA-R-AGYK
Q8VU31      E-EY----YNALCTNLQLSG---DDLKVFSITSVKPG-EGKTTTSTNIARAFA-R-AGYK
Q4K2E1      E-EY----YNALRTNIQLSG---DNLKVISITSVKPG-EGKSTTSTNIAWAFA-H-AGYK
Q4K2F7      E-EY----YNALRTNIQLSG---DNLKVISITSVKPG-EGKSTTSTNIAWAFA-H-AGYK
A5YTV7      E-EY----YNALRTNIQLSG---NNLKVIAITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
F9Q345      E-EY----YNALRTNIQLSG---NNLKVISITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
Q6L5R0      E-EY----YNALRTNIQLSG---NNLKVISITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
A5YTT9      E-EY----YNALRTNIQLSG---NNLQVISITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
E6KKS0      E-EY----YNALRTNIQLSG---NNLQVISITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
F2QF90      E-EY----YNALRTNIQLSG---NNLQVISITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
E0Q2S8      E-EY----YNALRTNIQLSG---NNLKVISITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
A1ILY1      E-EY----YNALRTNIQLSG---NNLKVIAITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
Q6L5T0      E-EY----YNALRTNIQLSG---NNLKVISITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
E9FEC5      E-EY----YNALRTNIQLSG---NNLKVISITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
E0PPH9      E-EY----YNALRTNIQLSG---NNLKVISITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
F5VSG9      E-EY----YNALRTNIQLSG---NNLKVISITSVKPG-EGKSTTSTNIAWAFA-R-AGYK
E3CBS0      E-EY----FNALATNIQLSG---VNLKVIAVSSVQEN-EGKSTTSTNLAVAFA-R-AGYK
F9M366      E-EY----FNALATNIQLSG---VNLKVIAVSSVKEN-EGKSTTSTNLAVAFA-R-AGYK
E8K786      E-EY----FNALATNIQLSG---VDLKVIAISSVQEN-EGKSTTSTNLAVAFA-R-AGYK
F8DFF4      E-EY----FNALATNIQLSG---VDLKVIAVSSVQEN-EGKSTTSTNLAVAFA-R-AGYK
I1ZPH7      E-EY----FNALATNIQLSG---VDLKVIAVSSVQEN-EGKSTTSTNLAVAFA-R-AGYK
E7S8W3      E-EY----FNALSTNIQLSG---TNIKVVAISSVQPN-EGKSTISTNLATAFA-R-AGYR
D0RXH2      E-EY----FNALSTNIQLSG---SDIKVVAVSSVQPN-EGKSTISINLSLAFA-R-AGYR
Q83YR5      E-EY----FNALSTNIQLSG---SDIKVVAVSSVQPN-EGKSTISINLSLAFA-R-AGYR
Q8GP54      E-EY----YNAIRTNIQFSG---AQIKVIAISSVEAG-EGKSTTSVNLAISFA-S-VGLR
F8HDC3      E-EY----YNAIRTNIQFSG---ANFKVIAVSSVQPG-EGKSTTSVNLAISFA-S-VGLR
F8LJ75      E-EY----YNAIRTNIQFSG---ANFKVIAVSSVQPG-EGKSTTSVNLAISFA-S-VGLR
E9DM17      E-EY----YNAIRTNIQFSG---AQMKVIAVSSVEAG-EGKSTTSVNIAISFA-S-VGLR
I0QIK6      E-EY----YNAIRTNIQFSG---AQMKVIAVSSVEAG-EGKSTTSVNIAISFA-S-VGLR
E8KUY8      E-EY----YNAIRTNIQFSG---AQMKVISISSVEAG-EGKSTTSVNLAISFA-S-VGLR
Q7X553      E-EY----YNTIRTNIQFSG---AQMKVIAISSVEAR-EGKSTTSVNLAISFA-S-VGLP
Q8GP92      E-EY----YNAIRTNIQFSG---AQMKVIAISSVEVG-EGKSTTSVNLAISFA-S-VGLR
Q7X561      E-EY----YNAIRTNIQFSG---AQIKVIAISSVEAG-EGKSPTSLNLAISFA-S-VGLR
Q7X549      E-EY----YNAIRTNIQFSG---AQMKVIAISSVEAG-EGKSTTSVNLAISFA-S-VGLR
G6ERT1      E-EY----YNTIRTNIQFSG---AQMKVIAISSVEAR-EGKSTTSVNLAISFA-S-VGLR
O87931      E-EY----YNTIRTNIQFSG---AQMKVIAISSVEAR-EGKSTTSVNLAISFA-S-VGLR
Q8GPF6      E-EN----YNAIRTNIQFSG---AQIKVIAISSVEVG-EGKTTTSVNLAISFA-S-IGIR
Q7X555      E-EY----YNAIRTNIQFSG---AQIKVIAISSVEAG-EGKSTTSVNLAISFA-S-VGLR
Q7X557      E-EY----YNAIRTNIQFSG---AQIKVIAISSVEVG-EGKSTTSVNLAISFA-S-VGLR
Q7X563      E-EY----YNAIRTNIQFSG---AQIKVIAVSSVEAG-EGKSAISVNLAISFA-S-VGLR
Q8GMA5      E-EY----YNAIRTNIQFSG---AQIKVIAISSVEAG-EGKSTTSLNLAISFA-S-VGLR
Q8GPA8      E-EY----YNAIRTNIQFSG---AQIKVIAISSVEAG-EGKSTTSLNLAISFA-S-VGLR
Q55205      E-EY----YNAIRTNIQFSG---AQIKVIAISSVEAG-EGKSTTSVNLAISFA-S-VGLR
C2LSE6      E-EY----YNAIRTNIQFSG---TQMKVIAISSVEAG-EGKSTTSVNLAISFA-S-VGLR
Q7X559      E-EY----YNAIRTNIQFSG---AQMKVIAISSVEAG-EGKSTTSVNLAISFA-S-VGLR
F8LXJ4      E-EY----YNAIRTNIQFSG---AQMKVIAISSVEAG-EGKSTTSVNLAISFA-S-VGLR
Q1WCR1      E-EY----YNAIRTNIQFSG---AQMKVIAISSVEAG-EGKSTTSVNLAISFA-S-VGLR
Q8GPC3      E-EY----YNAIRTNIQFSG---AQMKVIAISSVEAG-EGKSTTSVNLAISFA-S-VGLR
E8JMT9      E-EY----YNSIRTNIQFSG---RDLKVITLTSAQPG-EGKSTTSVNLAISFA-H-AGFR
F5X0J9      E-EY----YNSIRTNIQFSG---RDLKVITLTSAQPG-EGKSTTSVNLAISFA-R-AGFR
H2A602      E-EY----YNSIRTNIQFSG---RDLKVITLTSAQSG-EGKSTTSVNLAISFA-R-AGFR
E0PD83      E-EY----YNSIRTNVQFSG---RDLKVITLTSAQAG-EGKSTTSVNLAISFA-R-AGFR
F5X652      E-EY----YNSIRTNVQFSG---RDLKVITLTSAQAG-EGKSTTSVNLAISFA-R-AGFR
G5KD11      E-EY----YNTIRTNIQFSG---RDLKVIVLTSVQPN-EGKSTTSVNLAISLA-K-AGLK
B9DUJ4      E-EY----YNSIRTNIQFSG---RDLRVIVLTSVQPN-EGKSTTSVNLAVSFA-K-AGLK
G5KAJ2      E-EY----YNSIRTNIQFSG---RDLRVIVLTSVQPG-EGKSTSSINLAVSFA-N-AGFK
F1Z124      E-EY----YNSIRTNIQFSG---RDLKVITLTSVQPG-EGKSTTSANIAISFA-K-AGLK
Q2KM74      E-EY----YNSIRTNIQFSG---RDYKAIVLTSVQPG-EGKSTTSINLAISFA-K-AGFK
C6LDI8      SREA----YKALRTNITFCG---EDIKAIAITSSMPN-EGKSTVAFSLAQAFA-E-DNKQ
D4J4T6      S-EY----YKQLRTNIYFCG---QDKQCIAFTSSFPN-EGKSTVVFNLCKALA-E-DGKR
D4LTH2      E-EA----MNRLRINVKFCG---KNTKKIMLTSCLPN-EGKSTVAVYLWKMLA-E-AGFP
D4LG06      E-EA----MNRLRINVKFCG---KNTKKILLTSCMPN-EGKSTVSSYLWKMLA-E-AGFS
A7VF42      E-EA----MNRLRINIKFCG---KNTKKLLITSSLPN-EGKSTISINLWKMMA-E-AGFP
A8SQS8      E-EA----MNRLRINIKFCG---KNTKKILITSSMPN-EGKSSIAINLWKMLA-E-AGFP
D5HFS4      E-EA----MNRLRINIKFCG---KNTRKILITSSMPN-EGKSSVAINLWKMLA-E-AGFP
C9LAS1      E-EA----IKTLRTNIQFTG---KNVKTIMFTSCFPN-EGKSDVTFQLCQEIG-N-MGKR
F3AH92      E-EA----LKTLRTNIQFSN---KEVKVILLTSCYPN-EGKSDIAFNLSKEMG-S-IGKK
I5ASF8      R-EE----IKKLRANIVFTG---RKYKKIMFTSCFQG-EGKSDTVFHLAVDMT-K-LGKR
E7GL81      E-EA----IKTLRTNIQFSG---TNLQVIMLTSAVPN-EGKSEISFSLASSLA-Q-IDNR
G5F9E2      E-EA----IKTLRTNIQFSG---TNLQVIMLTSAVPN-EGKSEISFSLASSLA-Q-IDNR
E7GL57      N-EA----MKTLRTNIQFSG---TGIQVVMLTSSVPG-EGKSETTFHLAASLA-Q-LDKK
G5F9A9      N-EA----MKTLRTNIQFSG---TGIQVVMLTSSVPG-EGKSETTFHLAASLA-Q-LDKK
E7GL40      E-EA----MKTLRTNIQFSG---SNIHAVMFTSSAPN-EGKSETTFQLAASMV-Q-LGKK
G5F9H2      E-EA----MKTLRTNIQFSG---SNIHAVMFTSSAPN-EGKSETTFQLAASMA-Q-LGKK
A8RK85      E-EA----IKTLRTNIQFCG---SGLKTIMFTSSMPD-EGKSETAFALASSFG-N-IGKK
G5HTB2      E-ES----IKTLRTNMQFCG---SSLKTIMFTSSLPN-EGKSEITFSVAASLG-S-IGKK
G5HNC5      E-EA----VKTLRTNIQFCG---NNLKTIMFTSSLPS-EGKSDTTFAVAASFG-S-IGKK
C0CZV9      N-EA----VKTLRTNIQFCG---SGIRVIMMTSALPD-EGKSDMAFALASSLA-Q-IGKR
A8RSK9      N-EA----IKTLRTNIQFCG---NGIKTIMLTSSLPD-EGKSDITFAMASSLA-Q-IGKR
C5EN03      N-EA----IKTLRTNIQFCG---SGIRTIMLTSSLPD-EGKSDITFAMASSLA-Q-IGKK
G5HG45      N-EA----IKTLRTNIQFCG---NGIRTIMLTSSLPD-EGKSDITFAMAASLA-Q-IGKK
D9ST44      S-EA----YRTLRTNIQFSSLD-KNVKTIVVTSSVAG-EGKSTTCANLGVVMA-E-NGYN
G2Z8Q3      A-EQ----FRMIRTNIEFISKQ-RMLKIMMITSTKPQ-EGKSTIIANLADVMG-R-QELK
C8W5K2      A-EA----YRILRTNIHFSVLN-KPLKTLLITSAGCG-EGKTLTVANLGVAFA-Q-AGEK
F5LM71      S-ET----YRTLRTNIQYS-GVDGEIRTLMVTSASPW-EGKSTTIDNLAVVYA-Q-TDKK
D7VBW4      T-EQ----VKTIRTNLNYA-MVGKPLKTLMITSAIQG-EGKSTVGSNLAVEYA-K-KGLQ
F9UQ54      T-EQ----VKTIRTNLNYA-MVGKPLKTLMITSAIQG-EGKSTVSSNLAVEYA-K-KGLQ
H6LKR8      T-ES----YKLLRTNLNFI-NLENKYQVLLFTSAAKE-EGKTTTIANLAITLA-Q-SGKR
E0I7B5      S-EA----YRTLRTNIQFS-SVDEPIKVIMIASAQAG-EGKTTTVTNLAITYA-M-EGKR
D7UYE4      S-EK----FRGIRTNIMFS-TADSEVKTVVVTSEKPS-SGKSTISANLAITYA-Q-AGFK
Q4A120      S-EK----FRGIRSNILFS-TADAEIQTLLIASDKPS-SGKSTVSANIAVTYA-Q-AGFK
D9SVC7      S-EI----YRTLKTKLQFV-NIDNDIRTLLVTSASKA-EGKSTTTANLAITVA-Q-SGRK
D9S1J9      S-EA----FRVLRTNLQFS-SIDRPLKKVVVTSSIPQ-EGKSTVIANLAVSIA-S-AGSR
C0GGR5      S-EA----FRTIRTNIEFS-DIDKDKKTLLTTSATQG-EGKSVVTANLGVTMA-M-AGKR
C6CSC8      S-ET----YRTLRTNIEFA-AIDSALQVIMVSSAGPG-EGKSTTIANLAVTFS-Q-SDRK
A3ICA3      S-EQ----YRTIRANIKFS-QPNQDVKTILVTSSIAG-EGKSTNAANIGVVFS-Q-EGKR
B1HR41      S-EQ----YRTIRANIKFS-QPNQDVKTILVTSSIAG-EGKSTNAANIGVVFS-Q-EGKR
D6Y034      S-EQ----FRAIRTNIQFA-SPDISLKRLLVTSTSPG-EGKSTTAANLAIVLA-Q-QENR
Q8EME8      S-EQ----YRTIRTNLQFA-SVDSDLRSILLTSAGPS-EGKSMTTANLAIVYA-Q-QGKR
F3Y922      S-EQ----YKTIRTNIQYA-MVDKTLQTLAITSSNAS-EGKSTSTINLAIVFA-N-SNKK
G4L594      A-EQ----YRTIRTNIQFASSADQQVKTIVVTSSGPS-EGKSLSSANLAAVFA-Q-TGQK
C9B454      A-EQ----YRTIRTNIQFASAAGQQIKTIVVTSSGPG-EGKSTIAANIAVVFA-K-SGQR
Q3XYS6      S-EQ----YRTIRTNIQFASAAGQQIKTIVVTSSGPG-EGKSTTAANIAVVFA-K-SGQR
C9ALZ9      A-EQ----YRTIRTNIQFASAAGQQIKTIVVTSSGPG-EGKSTTAANIAVVFA-K-SGQR
C9BUG7      A-EQ----YRTIRTNIQFASAAGQQIKTIVVTSSGPG-EGKSTTAANIAVVFA-K-SGQR
D4RJF4      A-EQ----YRTIRTNIQFASAAGQQIKTIVVTSSGPG-EGKSTTSANIAVVFA-K-SGQR
C8ZXT9      S-EQ----YRTIRTNIQFASSADQQIKTLVVTSSGPG-EGKSTTSANLAVVFA-K-SGQR
G5IRQ6      S-EQ----YRTIRTNIQFASSADQQIKTLVVTSSGPG-EGKSTTSANLAVVFA-K-SGQR
C9A6V5      S-EQ----YRTIRTNIQFASSADKQIKTIVVTSSGPG-EGKSTTSANLAVVFA-K-SGQR
C9CHY8      A-EQ----YRTIRTNIQFASSADKQIKTIVVTSSGPA-EGKSTTSANLAVVFA-K-SGQR
Q814Z0      S-EQ----YRNIRTNIEFA-AIDMNLHSLLVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
B9IRQ6      S-EQ----YRNIRTNIEFA-AVDTNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
B7HXB4      S-EQ----YRNIRTNVEFA-SVDTNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
Q72XH8      S-EQ----YRNIRTNIEFA-AVDKNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
A0RL70      S-EQ----YRNIRTNVEFA-AVDTNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
Q6HB09      S-EQ----YRNIRTNVEFA-AVDTNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
F0PU64      S-EQ----YRNIRTNVEFA-AVDTNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
B7HFH1      S-EQ----YRNIRTNIEFA-AVDTNLHSLMITSANPS-EGKTTTTANMAVVFA-Q-QGKK
B7IQS8      S-EQ----YRNIRTNIEFA-AIDTNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
B3ZRD6      S-EQ----YRNIRTNIEFA-AVDTNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
B5UQ73      S-EQ----YRNIRTNIEFA-AIDTNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
G9QCG3      S-EQ----YRNIRTNIEFA-AIDTNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
Q3EV64      S-EQ----YRNIRTNIEFA-AVDTNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
Q5WBB4      T-EQ----YRTIRTNIEYS-AVDTEIKSLLVTSAGPG-EGKSTTASNLAVVIA-Q-NGQT
B1YMM5      A-EQ----YRTIRTNIEFM-AVDREIQVILVTSATQG-EGKSTTSSNLAVAYA-Q-QGKK
D7WMM8      S-EQ----FRTIRTNITFS-MPDREIKTILVTSATPG-EGKSTNAANIGVVFA-Q-EGKR
A7Z921      A-EQ----YRTIRTNIEFS-SVQTHLRSILVTSSVPG-EGKSFSAANLAAVFA-Q-QEKK
I2CAF2      A-EQ----YRTIRTNIEFS-SVQTHLRSILVTSSVPG-EGKSFSAANLAAVFA-Q-QEKK
A7Z9K0      S-EQ----YRTIRTNIEFS-SVDTEVKSLLITSAGPE-EGKSTTAANLAVVFA-Q-QGKK
I2CB16      S-EQ----YRTIRTNIEFS-SVDTEVKSLLITSAGPE-EGKSTTAANLAVVFA-Q-QGKK
I2HW53      S-EQ----YRTIRTNIEFS-SVDTEVKSLLITSAGPE-EGKSTTAANLAVVFA-Q-QGKK
G9QKR4      S-EQ----YRTIRTNIQFA-SADGELRSFMVTSASQG-EGKSTTAANLAIVFA-Q-QGKR
D5DBK3      A-EQ----YRTIRTNIQFS-DADEEIKALLVTSSGSA-EGKSTTASNLATVYA-Q-QGLK
D5DY81      A-EQ----YRTIRTNIQFS-GADEDIKSLVLTSSGPS-EGKSTTAANLATVYA-Q-QGLN
Q2BFS5      A-EQ----YRTVRTNIQFS-SVDQDVRSILVTSSGPG-EGKSTTVANLAVVFA-Q-QNKR
A4ITF3      S-EQ----YRTIRTNIQFS-FIDEPLRSLMVTSSAPS-EGKSTTAANLAVVFA-Q-QGKK
C5D961      S-EQ----YRTIRTNVQFS-FVDKTMRSIMITSAGPG-EGKSTTTVNLAIVFA-Q-QGKK
G8MZ93      A-EQ----YRTIRTNIQFS-FIDAPLRSLIVTSTGPG-EGKSTTAANLAVVFA-Q-QGKK
C6CW37      A-EA----YRTLRTNIQYSSVD-APIQLLMAASAQSG-EGKSTVISNLAVAYA-L-EGKR
G9RSY9      Q-EA----YKSLRTNLNFMAMG-KACKKLIFTSAIPG-EGKSSVALNLAVSLA-E-TGSR
F7K9V1      K-ES----YKTLRTNLEFSG---KDRKVISITSSTPN-EGKTSVSFQLALSIA-E-GGKK
F7K8E9      K-ES----YKTLRTNLEFSG---KDRRVISITSSTPN-EGKTSVSFQLAMSIA-E-GGKK
F7KL96      K-ES----YKTLRTNLEFSG---KDRRVISVTSSTPN-EGKTSVSFQLAISIA-E-GGKK
B9Y884      S-EA----YRTLRTNILMRNFDR-DMKVINIISTTAQ-EGKTTCVLNLAMVYA-Q-LQKK
A5Z5P9      E-ES----INRLRINVSFLG--N-EIKKIMVVSTMPN-EGKSFVTLQMWKQMA-S-AGIK
F2I6Z7      S-EQ----FRTIRTNIQFAIDAY-HLKTLMFTSSGPW-EGKSTIAANVATTMA-HLDGVR
D4YHG7      S-ES----FRQIRTNIQFSMVDH-DFKSIMFTSSGVW-EGKSTVTANTAAVMA-Q-QGLR
C1J9I3      S-EQ----FRTVRTNIEFAGAALDRCQVVMFTSSAMS-EGKSTVSANVAVTWA-Q-AGKK
B1MZT1      S-EQ----FRTLRTNIDFASVAKGNVKTLLVSSALPS-EGKSTITANLAVVYA-Q-QGKR
H1WR06      S-EQ----FRTLRTNIDFASVAKGNVKTLLVSSALPS-EGKSTITANLAVVYA-Q-QGKR
H1X4N2      S-EQ----FRTLRTNIEFAAVSRGEIKTLLISSALPS-EGKSTVSSNLAIVYA-Q-QGKK
Q03W95      S-EQ----FRTLRTNIEFASVAKGEIKTLLISSALPS-EGKSTVTANLAVAYA-Q-QGKK
F0SX22      I-EE----YKALRTNITFCLPSG-QCKIIGITSAEAE-EGKSITCINLALAFA-E-TKAR
B6W7H4      D-EA----IRSVRTNIQFSDIDN-KKRVIAMTSSKPS-EGKTTVLYSIAKSFA-E-NGNS
F0GT81      D-EA----IRSLRTNIQFSSLDN-KNKVIAITSTKPS-EGKSTVIYNLAKSFA-Q-NGER
B1R3X6      A-ES----YRVLRTSLEYSSIDK-ELKSIVITSSEPG-EGKSTVAGNLASIIA-Q-NDKK
Q8XN76      A-ES----YRVLRTSLEYSSIDK-ELKSIVVTSSEPG-EGKSTVAGNLASIIA-Q-NNKK
B1BNK1      A-ES----YRVLRTSLEYSSIDK-ELKSIVVTSSEPG-EGKSTVARNLASIIA-Q-NNKK
B1V0N7      A-ES----YRVLRTSLEYSSIDK-DLKSIVVTSSEPG-EGKSTVAGNLASIIA-Q-NNKK
Q0SVR8      A-ES----YRTLRTNIQYSSFDN-PVKSIVITSSEPG-EGKSTTSANLALSFA-Q-DGKK
B1BNH3      A-ES----YRTLRTNIQYSSFDN-PVKSIVITSSEPG-EGKSTTSANLALSFA-Q-DGKR
Q8XN46      A-ES----YRTLRTNIQYSSFDN-PVKSIVITSSEPG-EGKSTTSANLALSFA-Q-DGKR
B1V1Z4      A-ES----YRTLRTNIQYSSFDN-PVKSIVITSSEPG-EGKSTTSANLALSFA-Q-DGKR
G5GFW0      N-EA----IKALRTNIQFCG--N-NIHVIMITSSIPG-EGKTMTSFALARSFS-Q-IGRK
C2EFR6      Q-ES----FKTLRFNVEFSG--E-KNQVFYITSTYPN-EGKSTVSLELALAFS-D-NGKK
F3ATF5      Q-EA----IKTLRTNIQFAG--M-DVKTILFTSCYPN-EGKSDITFQLSQEIG-K-LGKK
D4M2S0      E-EA----IKTLRTNMQFSG--V-ETKSIVLTSCYPN-EGKSDVAFQLAVEIG-K-MGKR
F4BS19      S-EE----FRTLRTNIQFSMIDK-ELKTLMVTSSKQG-EGKSTIAANLAVVFA-S-QGKK
D4CG08      E-EA----IKTLRTNIQFSG--P-DIKTVMFTSAVPG-EGKSQITISEAMSLA-G-LGKK
D4MP30      E-EA----IKTLRTNIQFSG--P-DIKTVMFTSAVPG-EGKSQITVSEAMSLA-G-LGKK
C6LCS5      S-EA----YKSLRTNITFCG--K-DCRVIAITSCTPN-EGKSNVSLNLAASLA-E-TGKK
B0P2G2      V-EG----LNQLKTNLAFCG--K-DIKVITMTSSVPN-EGKSSVSLSLSRTLA-E-SGKK
D4MW29      V-EG----LNQLKTNLAFCG--K-DIKVITMTSSVPN-EGKSSVSLSLSRTLA-E-SGKK
E5VMX8      V-EG----LNQLKTNLAFCG--K-DIKVITMTSSVLN-EGKSSVSLSLSRTLA-E-SGKK
D4JMC2      K-ES----LRALKTSISFSG--K-GVKSILFTSSVPN-EGKTTVVMDLARSMA-D-SKKS
D6E0V4      K-ES----LRALKTSISFSG--K-GVKSILFTSSVPN-EGKTTVVMDLARSMA-D-SKKS
D6E330      K-ES----LRALKTNIQFCG--D-DIRTLLVTSSVPN-EGKSTVALDLARSLT-E-SGNR
C4Z8M5      K-ES----LRALKTNIQFCG--D-DIRTLLVTSSVPN-EGKSTVALDLARSLT-E-SGNR
D4JI67      K-ES----LRALKTNIQFCG--D-DIRTLLVTSSVPN-EGKSTVALDLARSLT-E-SGNR
D3AC80      N-EA----FKTLRTNILFSG--H-DTRVITLTSSTPN-EGKSSLSFQLAISFA-E-ADNR
G5IFS3      T-EA----FKALRTNILFCG--D-NIKVIGLTSSTPD-EGKTSVSVQLATSFA-E-AGKR
D4RX67      N-EA----FKRLRTNILFSG--S-DVKCIAITSCLPG-DGKSTVSMNLAKSFA-E-MGKK
A6BIG7      S-EA----YKTLRTNIEFSG--A-DKKVIVFTSCIPN-EGKSTVTMGLAEALA-E-GEKR
C0C0F8      N-EA----YKTLRTNVEFSG--A-DNKVIVFTSCTPN-EGKSTVSLSLAQSLA-E-GGKR
Q97EP8      S-EA----YRTLRSNIQFSSFDK-DMQLILITSSGPG-EGKSTTSCNLALAMA-E-AGNS
Q97ER5      A-EA----YRTLRSNIQFSSFDK-DMQLILVTSSGPG-EGKSTTSCNLALAMA-E-AGNS
D2RIR2      A-ET----YRAIRTNLQFAGAGQ-DLKYICFTSSVPG-EGKSTTISNMALTLA-Q-DGKK
G0VNK6      S-EA----YRAIRTNLQFAGAGK-QLKTLVFTSAIPG-EGKSTTVANLAIAMG-Q-DDKK
I0GRR2      S-EA----YRAIRTNLQFAGAGK-MIKFISFTSATPG-EGKSTTISNVAIAMA-Q-DGKR
A0PZ02      A-EA----YRTLRTNIQYSSFDK-ELKTIIVTSSGPS-EGKSTTSGNLALSMA-Q-SDRK
B1B736      A-EA----YRTLRTNIQYSSFDK-ELKTIIVTSSGPS-EGKSTTSGNLALSMA-Q-SDKK
F6BI62      S-EA----FRSLRTNLQFTSVDK-KVKSILITSSLPN-EGKSTIIKNLAYALA-M-TGVK
Q8RBS5      A-EA----FRALRTNLQFTGIDK-KVKSILITSSLPN-EGKSTVVKNLAYSVA-L-TGNK
G2MWC2      A-EA----FRALRTNLQFTSVDK-KVKSILITSSLPN-EGKSTVVKNLAYSVA-L-TGSK
B0K4N1      A-EA----FRALRTNLQFTSVDR-KVKSILITSSLPN-EGKSTIVKNLSYSVA-L-TGSK
B0KAR5      A-EA----FRALRTNLQFTSVDR-KVKSILITSSLPN-EGKSTIVKNLSYSVA-L-TGSK
E8UV29      A-EA----FRALRTNLQFTSVDR-KVKSILITSSLPN-EGKSTIVKNLSYSVA-L-TGSK
C7ISF7      A-EA----FRALRTNLQFTSVDR-KVKSILITSSLPN-EGKSTIVKNLSYSVA-L-TGSK
C9AAE5      S-EQ----VKLIRENVEYLCQQ-QEAQTILITSGESG-TGKSTVSANLAVAYA-Q-KGNR
H7F6C8      S-EQ----FKLIRTGIDFSGID-EKKQVILITSPESG-TGKSTVSSHLAVAYA-E-KGAR
H7F5T6      A-EY----FRTIKTNIEMMNID-SKVKSLLITSPTQD-SGKTMISVNLASTYA-N-DGVK
B1R3V1      A-ES----YRTLRTNIQYSSFD-NPVKSIVITSSEPG-EGKSTTSANLALSFA-Q-DGKR
D4YF13      A-EQ----YKTIRTNIEFAQIG-SSVKSIAVTSSISM-EGKSTTTVNLAYTYA-Q-TGKK
E6U7N4      V-ES----YKTLRTNLDFIPID-EPCKKFLITSSIPE-EGKSTVSINLAITLA-E-SQKR
C8VYQ6      A-EA----YRILRTNIQFSSLD-KPIKSLLVTSAGPN-EGKSLTVANLAVAFA-Q-AGLK
D3AE78      N-EA----FKTLRTNITFCG---DAQRVILFTSTIPN-EGKTSVVFQLARSFA-E-DGKR
A4J8V0      A-EA----YRIARTNIQFAAVD-KELKTLLITSSGPA-EGKSTTAANLGIAFA-Q-SGKS
A8U9F4      A-EQ----FRTIRTNIQFSMVD-KNLKTLVITSAGPG-AGKSTISANLAVTFA-M-QGKK
F4BSD9      A-EQ----FRTIRTNIQFSMVD-KNLKTLVITSAGPG-AGKSTISANLAVTFA-M-QGKK
F7V792      E-EA----INRLRINVSFMG---KKVRKIMVTSTFPN-EGKSFIAQQLWRRMA-E-AGID
F6IR93      T-EQ----IKTIRTNLNYAMVG-KPLKTLMVTSAIQG-EGKSTVAGNLAIEYA-K-KGLQ
G0M0F9      T-EQ----IKTIRTNLNYAMVG-KPLKTLMVTSAIQG-EGKSTVAGNLAIEYA-K-KGLQ
F6ITB4      T-EQ----IKTIRTNINFAASD-RKLRTLMVTSAMLG-EGKSTVSGNLAVEYA-K-EGMQ
G0M1X9      T-EQ----IKTIRTNINFAASD-RKLRTLMVTSAMLG-EGKSTVSGNLAVEYA-K-EGMQ
G0LYN9      T-EQ----IKTIRTNINFAATD-KNLRTLMVTSAMLG-EGKSTVSCNLAVEYA-K-EGMQ
D7VC13      T-EQ----IKTIRTNINFTATD-HKLRTLMVTSAMLG-EGKSKVSGNLAVEYA-K-EGMQ
F9UMZ6      T-EQ----IKTIRTNINFAATD-HKLRTLMVTSAMLG-EGKSTVSGNLAVEYA-K-EGMQ
I5AV01      R-EA----YKTLRANFLFSG---PEKKVIDVTSCSEN-EGKSTVSMQLAISLA-Q-SGKR
B0GAL3      E-EA----LKTLRTNIQFAGAD---IKTILVTSCFPN-EGKSDVVFQLAKEMG-M-AGKK
G1WUK2      E-EA----LKTLRTNIQFAGAD---IKTILVTSCFPN-EGKSDVAFQLAREMG-M-AGKK
E0RZL3      K-EA----YKTLRSNIEFSG---QNVKVVSVTSCTPG-EGKTTVAMALARAFA-E-AGKK
D8FLF8      S-EQ----FRNIRTNINFMNVD-KEVKTIAFTSAMAS-AGKSTVSANVSITMA-Q-AGKK
F0K0J7      S-EQ----FRNIRTNINFMNVD-REVKTIVFTSAMAS-AGKSTVSANVAITMA-Q-AGKK
Q1G8E4      S-EQ----FRNIRTNINFMNVD-REVKTIVFTSAMAS-AGKSTVSANVAITMA-Q-AGKK
C4VP08      T-EQ----FRTVRTNINFKAID-HDINTLAFTSAAIS-EGKSTVAANVAITYA-Q-SGKK
D6S4X4      T-EQ----FRTVRTNINFKAID-HDINTLAFTSAAIS-EGKSTVAANVAITYA-Q-SGKK
D0DJH0      S-EQ----FRTIRTNSNFMSVD-KEIHTLAFTSANIS-EGKSTVTANVAITYA-Q-AGRK
C7XKF3      S-EQ----FRTIRTNINFMAVD-EEISTLAFTSANIS-EGKSTVTANVAITYA-Q-AGRK
E3R264      S-EQ----FRTIRTNINFMAVD-EEISTLAFTSANIS-EGKSTVTANVAITYA-Q-AGRK
D5GZJ8      A-EQ----FRTIRTNINFMAVD-EEINTLAFTSANIS-EGKSTVTANVAITYA-Q-AGRK
C2EPK5      S-EQ----FRTIRTNINFMAVD-HDIKSVAFTSANIS-EGKSTIAANVAITYA-Q-AGRK
A4ZGZ8      T-EQ----FRTIRTNINFMAVD-HDIKSVAFTSASIS-EGKSTVAANVAVTYA-Q-AGHK
A8YX89      T-EQ----FRTIRTNINFMAVD-HDIKSVAFTSASIS-EGKSTVAANVAVTYA-Q-AGHK
F0NWJ7      T-EQ----FRTIRTNINFMAVD-HNIKSVAFTSANIS-EGKSTVAANVAVTYA-Q-AGRK
E4SMV5      A-EQ----FRTVRTNINFMAVD-HDIKSLAFTSANIS-EGKSTVAANVAVTYA-Q-AGRK
F0TGY2      A-EQ----FRTVRTNINFMAVD-HDIKSLAFTSANIS-EGKSTVAANVAVTYA-Q-AGRK
Q5FIC7      A-EQ----FRTVRTNINFMAVD-HDIKSLAFTSANIS-EGKSTVAANVAVTYA-Q-AGRK
F2M2M6      A-EQ----FRTVRTNINFMAVD-HDIKSLAFTSANIS-EGKSTVAANVAVTYA-Q-AGRK
G7M0Q3      S-EA----YKTLRTNIQYSSFD-NEIKSLVITSAEMA-EGKSTVAENIALTFA-Q-GEKR
G7M1R9      S-EA----YRTLRTNIQYSSFD-KQIRTIVVTSAEAA-EGKSTVSGNLALSFA-Q-NEKK
A6M2L9      A-EA----YRTLRTNIQYSSFD-KEIRTIAVTSAEMA-EGKSTVAGNIAASFA-Q-NEKK
G7M566      S-EA----YRTLRTNIQYSSFD-KEIRTIAVTSAEMA-EGKSTVAGNIALTFA-Q-SDKK
G2KUP1      A-EQ----FRTVRTNIKFSIVA-NQNKVVSITSANPS-EGKSVFISNLACTFA-E-QGEK
G8PE06      A-EQ----FRTIRTNIKFSAID-QKLKTIVFTSSAPS-EGKSTVSNNVAVTWA-V-QGRK
Q03GL8      A-EQ----FRTVRTNIQFSSVD-KALKSIVFTSSAPS-EGKSTVSNNVAVTWA-D-QGKR
E0NHP4      A-EQ----FRTVRTNIQFSSVD-KQLKSIVFTSSAPS-EGKSTVSNNVAVTWA-D-QGKS
F4FXQ7      S-EQ----FRTVRTNINFSAVN-QKLKTIIFTSSAVS-EGKSTVSANLAVIWA-Q-QGQK
C0WV35      S-EQ----FRTVRTNINFSAVN-QKLKTIIFTSSAVS-EGKSTVSANLAVIWA-Q-QGQK
H1LCW3      S-EQ----FRTVRTNINFSAVN-QKLKTIIFTSSAVS-EGKSTVSANLAVIWA-Q-QGQK
C2JZS1      S-EQ----FRTVRTNIEFAGAALDKCQVIMFTSSAMS-EGKSTVSANVAVTWA-Q-AGKK
Q58Z10      S-EQ----FRTVRTNIEFAGAALDQCQVVMFTSSAMS-EGKSKVSANVAVTWA-Q-AGKK
E9SAU1      T-EA----YKNLRTNLSFALST-KKNHIIAISSALAA-EGKSTVAANIAITLA-Q-NNNS
Q38VG5      A-EQ----FRTIRTNIQFSSID-QKLRSIVFTSSGPS-QGKSTISANVAVTWA-D-QGVN
F0HVF1      S-EQ----FRNIRTNINFMNVD-KEVKTIAFTSAMAS-AGKSTVSANVSITMA-Q-AGKK
G6F8G9      S-EQ----FRNIRTNINFMNVD-KEVKTIVFTSAMAS-AGKSTVSANVAITMA-Q-AGKK
C2EWM3      S-EQ----FRTIRTNISFMGID-HPIKTLAFTSANIS-EGKSTVTDNIAVVWA-N-AGKR
F8DRU2      S-EQ----FRTIRTNINFMAID-KPIKTLAMTSANVS-EGKSTVTDNVAVVWA-Q-TGQR
B3XL23      S-EQ----FRTIRTNINFMAID-KPIKTLAMTSANVS-EGKSTVTDNVAVVWA-Q-TGQK
F8KGP1      S-EQ----FRTIRTNINFMAID-KPIKSLALTSANVS-EGKSTVTDNVAVVWA-Q-TGQK
H4GK03      A-EQ----FRTIKTNITFMGVD-HPIKALAFTSSNIS-EGKSTVTANVGVTWA-Q-DNKR
B2GF33      A-EQ----FRTIRTNIHFMSVD-RPLKTVAFTSSGIS-EGKSTVTANVAIAWA-Q-EGKR
C0WW26      A-EQ----FRTIRTNIHFMSVD-RPLKTVAFTSSGIS-EGKSTVMANVAIAWA-Q-EGKQ
D0DSJ4      A-EQ----FRTIRTNIHFMSVD-RPLKTVAFTSSGIS-EGKSTVTDNVAIAWA-Q-EGKR
C0ZHV8      V-EG----YRTLRLNIQFSMGD-KLMQTILVTSPGAS-EGKTITAANLSLMMA-K-DHKK
H1BJT1      M-EA----FRKLKTNIEFSAVE-KPIKVVNITSSCAN-EGKSTVAFHLAQVYA-A-KYKK
F8FCE2      S-ES----YRTLRTNIDFSLVD-NDNKVIMVTSTQQA-EGKTTTAVNMAVAYA-Q-TEKK
H6NE43      S-ES----YRTLRTNIDFSLVD-NDNKVIMVTSTQQA-EGKTTTAVNMAVAYA-Q-TEKK
I0BSG4      S-ES----YRTLRTNIDFSLVD-NDNKVIMVTSTQQA-EGKTTTAVNMAVAYA-Q-TEKK
Q83VF9      S-EQ----YRTIRTTIDFKMAD-QGIKSFLVTSSEAA-AGKSTVSANIAVAFA-Q-QGKK
G8P3D7      S-EQ----YRTIRTTIDFKMAD-QGIKSFLVTSSEAA-AGKSTESANLAVAFA-Q-QGKK
O06030      S-EQ----YRTIRTTIDFKMAD-QGIKSFLVTSSETD-EGKTTVSANIAVAFA-Q-QGKK
G9M880      S-EQ----YRTIRTTIDFKMAD-QGIKSFLVTSSEAA-AGKSTSSANIAVAFA-Q-QGKK
G6FD42      S-EQ----YRTIRTTIDFKMAD-QGIKSFLVTSSEAA-AGKSTASANIAVAFA-Q-QGKK
F9VC44      S-EQ----YRTIRTTIDFKMAD-QGIKSFLVTSSEAA-AGKSTASANLAVAFA-Q-QGKK
A9QSJ4      S-EQ----YRTIRTTIDFKMAD-QGIKSFLVTSSEAA-TGKSTESANLAVAFA-Q-QGKK
Q3ZK50      S-EQ----YRTIRTTIDFKMAD-QGIKSFLVTSSEAA-AGKSNGSANLAVAFA-Q-QGKK
E3GPC6      S-EA----FRNMRTNITFADID-EELRVLTITSTGKG-EGKSTIIANYAVALA-Q-SKKK
G0V447      S-EA----YRTLRTNVQFSSVD-KNLKVILVTSSGPS-EGKTTTAVNLALSFA-E-LNKK
H7F1R7      A-EQ----FKTLRAGIHFSSAD-HKYKTILITSTEPE-SGKSTVSANLAVVYA-Q-HGQK
E6UHY4      T-EA----YKNLRTNISFALST-KKNKIFAISSALAS-EGKSTVAANIAITLA-Q-NNNH
D9QTC6      A-EA----YRTLRTNIEFLSPD-DPLETMVITSSVPQ-EGKSITIANLAVSMA-E-NGQQ
D9SR41      S-ET----YRTLRTNIQYANID-GDLRSIIITSSSPS-EGKSTTVANLAIATA-Q-TGKK
P95696      S-EK----FRGIRSNIMFSKAN-GEVKRLLVTSEKPG-AGKSTVVSNVAITYA-Q-AGYK
Q2G1K7      S-EK----FRGIRSNIMFSKAN-GEVKRLLVTSEKPG-AGKSTVVSNVAITYA-Q-AGYK
A8YPQ5      S-EK----FRGIRSNIMFANPD-SAVQSIVITSEAPG-AGKSTIAANLAVAYA-Q-AGYK
Q2FUV2      S-EK----FRGIRSNIMFANPD-SAVQSIVITSEAPG-AGKSTIAANLAVAYA-Q-AGYK
P39851      S-EK----FRGIRSNIMFSNAE-NEIKSLLITSEKSA-SGKSILSANIAVTYA-Q-AGYK
C5QNG4      S-EK----FRGIRSNIMFSRAK-DEIVSIIVTSEKPA-AGKSIVSANIATTYA-Q-AGYR
Q4L9H7      S-ER----FRGIRSNIMFSGV--EEANSIIVTSEKPA-AGKSIVSANIAITYA-Q-AGYK
E4Q5T5      T-ES----YRMLRTNIQYSSLD-KPIKTIVITSTGPS-EGKTITCANLAVVMA-Q-AGSK
E4SDX4      T-ES----YRMLRTNIQYSSLD-KPIKTIVVTSTGPS-EGKTVTCANLAVVMA-Q-AGSK
E4S7Y6      T-ES----YRMLRTNIQYSSLD-KPIKSLVITSSGPS-EGKTITTANLAVVMA-Q-AGSK
C6CS80      S-EA----YRTLRTNLQYAETD-RPLQLLMVTSAGPE-EGKSTTILNLAVTYA-Q-MERR
E6LD64      S-EQ----YRTIRTNIQFASTVDHEIKTIVVTSSGAG-EGKSTTAANLAVVFA-N-AGQR
F0EKB9      S-EQ----YRTIRTNIQFASSADKQIKTIVVTSSGPG-EGKSTTSANLAVVFA-K-SGQR
H7F571      S-EQ----FKTLRTGIHFSSVD-TNYKTIMVTSPEPG-SGKSTISANLAVCYA-K-QGIR
F5LE48      S-EA----YRVLRTNIQYSSID-KEITTILVTSAQPA-EGKSTTVSNLAITYA-Q-EEKN
E7RDR3      T-EQ----FRTLRTNINFSSPD-SEIRTMVVTSAAPS-EGKSTTAANLAVVFA-Q-EGKK
E7RG08      S-EQ----FRTLRTNIHFTVPG-GKVRSLVVTSASHL-EGKSTTSSNLAIVFA-Q-EGKR
F6CNF5      A-EA----YRVLRTNLGFSGLD-RPCRSILVTSAGPE-DGKSTTAANLAVVLA-Q-AGNK
G2FWX4      S-EA----YRTLRTNIQFRSVN-SENNKIMITSAGRR-EGKSFTVANLAVSMA-Q-DGKS
G2FM59      S-EA----YRMLRTNVQFTSVD-LDTQKIMITSSGPR-EGKSHTVANLAVSMA-Q-SGKS
G7WJV1      S-EA----YRTLRTNVQFTNVD-SNTQKIVVTSSGPG-EGKSHTVANLAVSMA-Q-SGKS
H5XZD4      S-EA----YRSLRTNVQFTSVD-SDTQKIVVTSSGPR-EGKSHTVANLAVSIA-Q-SGKS
H5XZG7      S-EA----YRTLRTNVQFTSVD-SKTKKIMITSSGPR-EGKSTTAANLAVSIA-Q-SGKS
G7W773      S-EA----YRTLRTNVQFTSID-TKTKRIMVTSSGPR-EGKSTTVANLAVSMA-Q-SGKS
G2FWT8      S-EA----YRTLRTNVQFTSVD-SETKKIMITSSGPR-EGKSSTVANLAVSIA-Q-AGKS
I4DBG8      S-EA----FRTLRTNVQFTSVD-SQTKKIMVTSAGPQ-EGKSSTVANLAVSIA-Q-TGKT
C0EBA6      T-EA----YKTMRTNLSFALAD-AKNKRVVITSSLPN-EGKSTTATNIAITLA-Q-TGKK
Q9K6R0      S-EQ----YRTIRTNIEFAAVD-RELKTIVVTSSGPG-EGKSTTSANLAVVMA-Q-NGHN
I2HVL2      A-EQ----YRTIRTNIEFSSVQ-THLRSILVTSSVPG-EGKSFSAANLAAVFA-Q-QEKK
D4G1R2      ----------------------------------MPG-EGKSFSAANLAAVFAQQ-QEKK
G4EQZ7      A-EQ----YRTIRTNIEFSSVQ-TNLRSILVTSSVPG-EGKSFSAANLAAVFAQQ-QEKK
P71051      A-EQ----YRTIRTNIEFSSVQ-TNLRSILVTSSVPG-EGKSFSAANLAAVFAQQ-QEKK
E0U2Z3      A-EQ----YRTIRTNIEFSSVQ-TNLRSILVTSSVPG-EGKSFSAANLAAVFAQQ-QEKK
G4P114      A-EQ----YRTIRTNIEFSSVQ-TNLRSILVTSSVPG-EGKSFSAANLAAVFAQQ-QEKK
A9VRC3      S-EQ----YRNIRTNVEFASVD-TNLHSLMVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2QJY5      -----------------------------MITSAKPS-EGKTTTTANMAVVFA-Q-QGKK
C2RG49      -----------------------MNLHSLLVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2T8T6      -----------------------MNLHSLLVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2MTG3      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2SSX8      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2YZB2      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C3GBJ8      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2SBU4      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2NQN6      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C3GRR0      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2PN22      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2Y452      -----------------------------MVTSANPS-EGKTTTTANIAVVFA-Q-QGKK
C2WVG6      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C3EBC0      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2XJH9      -----------------------------MFTSANPS-EGKTTTTANIAVVFA-Q-QGKK
C2P8H3      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2ULR6      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C2V4M2      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
C3H979      -----------------------------MVTSANPS-EGKTTTTANMAVVFA-Q-QGKK
G2TR25      S-EQ----FRTIRTNISFSSVD-NDLQLLMVTSSGPG-EGKSTIVGNLAVVFA-Q-QGKR
P96716      S-EQ----YRTIRTNIEFASVD-RQMKSVMITSACPG-EGKSTTAANLAVVFA-Q-QGKK
G4EQF3      S-EQ----YRTIRTNIEFASVD-RQMKSVMITSACPG-EGKSTTAANLAVVFA-Q-QGKK
D4G2E1      S-EQ----YRTIRTNIEFASVD-RQMKSVMITSACPG-EGKSTTAANLAVVFA-Q-QGKK
I0F9R6      S-EQ----YRTIRTNIEFASVD-RQMKSVMITSACPG-EGKSTTAANLAVVFA-Q-QGKK
E0TTZ6      S-EQ----YRTIRTNIEFASVD-RQMKTVMITSACPG-EGKSTTAANLAVVFA-Q-QGKK
G4P1M7      S-EQ----YRTIRTNIEFASVD-RQMKSVMITSACPG-EGKSTTAANLAVVFA-Q-QGKK
A8FHL9      A-EQ----FRTIRTNIEFTSIQ-TRLKSILVTSSLPK-EGKSFTAANLAAVFA-Q-QKKR
Q5KUM5      A-EQ----YRTIRTNIQFSFID-APLRSLIVTSTGPG-EGKSTTAANLAVVFA-Q-QGKK
D3FZP4      A-EQ----YRTLRTNIQFANMDGEEMRSILVTSAGPG-EGKSTTIANLAIVLA-Q-QGKR
I0JRK4      A-EQ----YRTIRTNLQFASVD-KELETMIVTSAGPS-EGKSLTTANVAVVFA-Q-QGKK
I3EBB3      S-EQ----YRTIRTNIQFSSID-KEIRSLIVTSPGPG-EGKTTTIANLAVVFA-Q-QGKT
                                                   **:                  

E3CP62      TLFIDADTRNS-VL--SGTFKSN--------APYKGLSNFLS-------GNAD-LNETIC
C2KHF1      VLLVDADLRRP-TV--AVSFGLN--------RNSAGLTNCLG------DSHKE-ISDVVH
G9WIQ9      VLLVDADFRRP-TI--HKTFGLT---------NDRGLTTVLA-------MNDQ-PAEIIN
A0NKF6      VLLLDADFRRP-TL--HKTFAVP---------NEHGLTTVLA-------MHEQ-PASAIH
Q04DV8      VLLLDADFRRP-TL--HKTFAVP---------NEHGLTTVLA-------MHEQ-PASVIH
D3LB10      VLLLDADFRRP-TV--HKTFAIS--------NE-RGLTTVLA--------MHDQPASLIH
B8D0N2      VMLVDADLRKP-RL--HKILSIN--------PD-PGLSDILK------GQT---TPTEVT
F2I4B7      VLLLDADMRKP-TV--HKTFGVP--------ND-RGLTNLLT------DSRLE-IHQVIK
C2CI44      VILIDCDLRSP-SL--YEIAGIN-----D---N-VGVTNYLT------GK-VSIQRAINK
C7RGH6      VILLDCDLRSP-SI--SEIAGIN-----D---N-VGITNYLT------GK-VNIQRAINK
C0CK73      TVLMDCDMRKS-YL--VRRLGIQ-----E--KI-QGVSEYLS------KQ----SMKIVY
Q1WTC8      ALLIDADLRKS-VS--RQLIRTG-----S--IE-MGLSDYLV------GR-AQ-FDDVIA
E8JWI5      TLLIDADIRNSKML--GGVFKSG-----E--KV-SGLTEYLA------RN-TD-LSQGLC
F3AHH0      VLLLDADLRKS-ML--LGRTKIK-----G--TA-KGMTHFLS------GQ-VE-IKDVLC
F7K0U1      VLFIDADLRKS-VL--AGRHRVQ-----G--EL-KGLSHFLS------GR-AK-VEDVVC
C4Z672      TLLIDADTRKS-VM--KNRWRKG-----K--IK-YGLTHYLS------GK-NE-LTDVIS
P0C0T9      TLLIDADTRNS-VM--SGTFKAT-----G--TI-KGLTNYLS------GN-AD-LGDIIC
Q04663      TLLIDADTRNS-VM--SGTFKAT-----G--TI-KGLTNYLS------GN-AD-LGDIIC
Q67AY4      TLLIDADTRNS-VM--SGTFKAT-----G--TI-KGLTNYLS------GN-AD-LGDIIC
Q3K0T0      TLLIDADTRNS-VM--SGTFKAT-----G--TI-KGLTNYLS------GN-AD-LGDIIC
C5NWJ8      TILVDADTRKS-VM--AGRFKFK-----H--KI-SGLTNYLS------GV-SP-IEDVIY
F3A499      TILVDADTRKS-VM--AGRFKFK-----H--KI-SGLTNYLS------GV-SP-IEDVIY
Q4JZ55      VLLLDVDLRNS-VM--SGMFHSR-----E--RI-TGLTEYLS------GK-AG-MADSMQ
G5JTD5      TLLIDADTRNS-VM--MGSFKPD-----G--PV-KGLTDFLS------GN-AD-LQTTIS
G3G7C1      TVLVDADIRNS-VM--SGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSRGLC
G3G7J9      TVLVDADIRNS-VM--SGFFEPI-----T--KI-TGLTDYLA------GT-TD-LSRGLC
G3G7G6      TVLVDADIRNS-VM--SGFFKPV-----T--KI-TGLTDYLA------GT-TD-LSQGLC
G8DUB0      TVLVDADIRNS-VM--SGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSQGLC
G3G7I8      TVLVDADIRNS-VM--SGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSQGLC
G3G7J4      TVLVDADIRNS-VM--PGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSQGLC
G7SG34      TVLVDADIRNS-VM--SGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSQGLC
G8DTZ0      TVLVDADIRNS-VM--SGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSQGLC
G8DU07      TVLVDADIRNS-VM--SGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSQGLC
A4VTU3      TVLVDADIRNS-VM--PGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSQGLC
G7SNU6      TVLVDADIRNS-VM--PGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSQGLC
G8DU31      TVLVDADIRNS-VM--PGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSQGLC
D5AGQ5      TVLVDADIRNS-VM--PGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSQGLC
Q9X4U7      TVLVDADIRNS-VM--PGFFKPI-----T--KI-TGLTDYLA------GT-TD-LSQGLC
A3CQY2      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
E8KLY9      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
F0FHA8      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
F0I4H5      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
F0IAY3      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
F0IJI2      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
F0IS53      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
F2C9N0      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
F2CH53      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
F3SM32      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
F3UDW7      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
F3UNJ4      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
F0FQQ5      TLMIDADIRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS------GQ-AA-LHEVIN
D6R2T8      TLLIDSDIRNS-VM--SGVFKSH-----G--KV-LGLTDFLS------GQ-SD-VKAILN
F3UUQ2      TLLIDSDIRNS-VM--SGVFKSH-----G--KV-LGLTDFLS------GQ-SD-VKAILN
E6IZC2      TLLIDADIRNS-VM--SGIFKTR-----D--KI-TGLTDYLA------GA-TD-LSNGLC
G6A745      TLLIDADIRNS-VM--SGVFKTR-----D--KI-TGLTDYLA------GA-AD-LSNGLC
A8AZR3      TLLIDADIRNS-IM--SGVFKSK-----E--KI-TGLTDYLV------GK-ND-LSQGLC
F9HJP6      TLLIDADIRNS-VM--SGVFKSS-----A--KI-TGLTDYLS------GK-TD-LSQGLC
Q4JYT9      ALLVDADIRNS-IM--SGVFKSR-----E--KI-TGLTDFLA------GT-TD-LSHGLC
Q4JZY1      ALLVDADIRNS-IM--SGVFKSR-----E--KI-TGLTDFLA------GT-TD-LSHGLC
E1LQJ7      TLLVDADIRNS-VM--SGVFKSR-----E--KI-TGLTDFLA------GT-TD-LSHGLC
F9HC65      TLLVDADIRNS-VM--SGVFKSR-----E--KI-TGLTDFLA------GT-TD-LSNGLC
E1LPE7      TLLIDADIRNS-VM--SGVFKSR-----E--RI-TGLTDYLA------GT-QD-LSNGLC
F9MJW5      TLLIDADIRNS-VM--SGVFKSR-----E--RI-TGLTDYLA------GT-QD-LSNGLC
E8KDN2      TLLVDADIRNS-VM--SGDFMSR-----E--KI-TGLTDYLS------GT-KD-LSQGLC
E8K322      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTDYLS------GT-KD-LSHGLC
F9PEU4      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTDYLS------GT-KD-LSHGLC
F9PZP7      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTDYLS------GT-KD-LSHGLC
C1CBD1      TLLIDGDIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSHGLC
Q7WVX0      TLLIDGDIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSHGLC
P96475      TLLFDGDIRNS-VM--SGFFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q9AHD2      TLLIDGDTRNS-VM--LGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4K2Q7      TLLLDGDTRNS-VI--SGFFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4K0T5      TLLIDGDTRNS-VI--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4K0E1      TLLIDGDTRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q9AH95      TLLIDGDTRQS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4K1M4      TLLIDGDTRNS-VM--SGFFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4JZ18      TLLIDGDTRNS-VM--SGFFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q54520      TLLIDGDTRNS-VM--SGFFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4JYH5      TLLIDGDIRNS-VM--SGFFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4K0V2      TLLIDGDTRNS-VM--SGFFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
A5M4L1      TLLIDGDTRNS-VI--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSYGLC
B2ILP5      TLLIDGDTRNS-VI--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSYGLC
C1CCB9      TLLIDGDTRNS-VI--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSYGLC
Q4K1S7      TLLIDGDTRNS-VI--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSYGLC
P72512      TLLIDGDTRNS-VI--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSYGLC
Q4JZ84      TLLIDGDTRNS-VI--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4K0X5      TLLIDGDTRNS-VI--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSRGLC
Q4K0Z6      TLLIDGDTRNS-VI--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4K195      TLLIDGDTRNS-VI--SGFFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4K0A0      TLLIDGDTRNS-VI--SGVFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4K0K2      TLLIDGDTRNS-VI--SGFFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4K1F9      TLLIDGDIRNS-VI--SGFFKSR-----E--KI-TGLTEFLS------GT-AD-LSHGLC
Q4K045      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
G6C7Z1      TLLIDGDIRNS-VM--SGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
D2ERX8      TLLIDGDIRNS-VM--SGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
F9LZC4      TLLIDGDIRNS-VM--SGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
F9P1W8      TLLIDGDIRNS-VM--SGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
I0J9C9      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
A6YIA8      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q4K005      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q4JZL7      TLLIDGDIRNS-VM--LGVFKAR-----N--KI-TGLTEFLS------GT-TD-LSQGLC
E5F5C5      TLLIDGDIRNS-VM--LGVFKAR-----N--KI-TGLTEFLS------GT-TD-LSQGLC
Q4JZG7      TLLIDGDIRNS-VM--LGVFKAR-----N--KI-TGLTEFLS------GT-TD-LSQGLC
Q4JZK1      TLLIDGDIRNS-VM--LGVFKAR-----N--KI-TGLTEFLS------GT-TD-LSQGLC
A5LJS0      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q9AHB7      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q4K1B7      TLLIDGDIRNS-VM--LGVFKAR-----N--KI-TGLTEFLS------GT-TD-LSQGLC
Q4JYK8      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q4K0M3      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q9AHA4      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q9X9A1      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q9ZII6      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q8KWQ0      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q4JZW7      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q4JYX9      TLLIDGDIRNS-VM--SGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q4K0R7      TLLIDGDIRNS-VM--SGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q4K1K6      TLLIDGDIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q4JZS3      TLLIDADIRNS-VM--LGVFKAR-----D--KI-TGLTEFLS------GT-TD-LSQGLC
Q4K0I2      TLLIDADMRNS-VM--SGVFKSR-----E--RI-TGLTEFLS------GT-TD-LSQGLC
Q4K254      TLLIDADMRNS-VM--SGVFKPR-----E--RI-TGLTEFLS------GT-TD-LSQGLC
Q4K237      TLLIDADMRNS-VM--SGVFKSR-----E--RI-TGLTEFLS------GT-TD-LSQGLC
B1I967      TLLIDADMRNS-VM--SGVFKSR-----E--RI-TGLTEFLS------GT-TD-LSQGLC
G6J8A4      TLLIDADMRNS-VM--SGVFKSR-----E--RI-TGLTEFLS------GT-TD-LSQGLC
G6LKG5      TLLIDADMRNS-VM--SGVFKSR-----E--RI-TGLTEFLS------GT-TD-LSQGLC
Q9ZFT8      TLLIDADMRNS-VM--SGVFKSR-----E--RI-TGLTEFLS------GT-TD-LSQGLC
D6ZQI8      TLLIDADMRNS-VM--SGVFKSR-----E--RI-TGLTEFLS------GT-TD-LSQGLC
Q4K2A8      TLLIDADMRNS-VM--SGVFKPR-----E--RI-TGLTEFLS------GT-TD-LSQGLC
Q8VU31      TLLIDADMRNS-VM--SGVFKSR-----E--RI-TGLTEFLS------GT-TD-LSQGLC
Q4K2E1      TLLIDADIRNS-VM--SGVFRSS-----E--KI-TGLTEFLS------GT-TD-LSQGLC
Q4K2F7      TLLIDADIRNS-VM--SGVFRSS-----E--KI-TGLTEFLS------GT-TD-LSQGLC
A5YTV7      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
F9Q345      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
Q6L5R0      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
A5YTT9      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
E6KKS0      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
F2QF90      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
E0Q2S8      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
A1ILY1      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
Q6L5T0      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
E9FEC5      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
E0PPH9      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
F5VSG9      TLLIDADIRNS-VM--SGVFKSR-----E--KI-TGLTEFLS------GT-TD-LSQGLC
E3CBS0      TLLVDCDIRNS-VM--TGVFRSR-----D--KI-QGLTDFLS------GR-SQ-LNQILY
F9M366      TLLVDCDIRNS-VM--TGVFRSR-----D--KI-QGLTDFLS------GR-SQ-LNQILY
E8K786      TLLVDCDIRNS-VM--TGVFRSR-----D--KI-QGLTDFLS------GR-SQ-LDQILY
F8DFF4      TLLVDCDIRNS-VM--TGVFRSR-----E--KI-QGLTDFLS------GQ-SQ-LDQVLY
I1ZPH7      TLLVDCDIRNS-VM--TGVFRSR-----E--KI-QGLTDFLS------GQ-SQ-LDQVLY
E7S8W3      TLLIDADIRNS-VM--TGVFKSQ-----G--RV-AGLTEVLS------GK-SE-ISQAIA
D0RXH2      TLLIDADIRNS-VM--TGVFKSQ-----R--KV-EGLTEVLS------GN-AD-ISRALA
Q83YR5      TLLIDADIRNS-VM--TGVFKSQ-----R--KV-EGLTEVLS------GN-AD-ISRALA
Q8GP54      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-ADLLNETIC
F8HDC3      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AS-LGEVIC
F8LJ75      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AS-LGEVIC
E9DM17      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AT-LEETVC
I0QIK6      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AT-LEETVC
E8KUY8      TLFIDADTRNS-VL--SGTFKSN-----A--PY-KGLSNFLS------GN-AD-LNETIC
Q7X553      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AV-LNETIC
Q8GP92      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
Q7X561      TLLIDADTRNS-VF--SGTFKTN-----E--PY-KGLSNFLS------GN-AD-LNDRIC
Q7X549      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-GD-LNETIC
G6ERT1      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
O87931      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
Q8GPF6      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
Q7X555      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLY------RN-AD-LNETIC
Q7X557      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
Q7X563      TLLIDADLRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
Q8GMA5      TLLIDADTRNS-VF--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
Q8GPA8      TLLIDADTRNS-VF--SGTFKTN-----E--PY-KGLSNFLS------GN-AD-LNETIC
Q55205      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
C2LSE6      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
Q7X559      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
F8LXJ4      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
Q1WCR1      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
Q8GPC3      TLLIDADTRNS-VL--SGTFKSN-----E--PY-KGLSNFLS------GN-AD-LNETIC
E8JMT9      TLLIDADTRNS-VM--SGTFKSN-----E--RY-QGLTSFLS------GN-AE-LSDVIC
F5X0J9      TLLIDADTRNS-VM--SGTFKSN-----E--RY-QGLTSFLS------GN-AE-LSDAIC
H2A602      TLLIDADTRNS-VM--SGTFKSK-----E--RY-QGLTSFLS------GN-AE-LSDVIC
E0PD83      TLLIDADTRNS-VM--SGTFKSN-----E--RY-QGLTSFLS------GN-AE-LSDVIC
F5X652      TLLIDADTRNS-VM--SGTFKSN-----E--RY-QGLTSFLS------GN-AE-LSDVIC
G5KD11      TLLIDADIRNS-VM--SGTFKSD-----S--KY-EGLSSYLS------GN-TE-LSKVIV
B9DUJ4      TLLIDADIRNS-VI--SGTFKAD-----E--KY-EGLSSYLS------GN-AD-LSSVIS
G5KAJ2      TLLIDADIRNS-VM--SGTFKSD-----E--KY-EGLSSYLS------GN-AD-LSHVIS
F1Z124      TLLIDADIRNS-VM--SGTFKAD-----E--KY-EGLSSYLS------GN-AE-LSAVIS
Q2KM74      TLLIDADVRNS-VM--SGAFKSD-----D--RY-EGLSSYLS------GN-AE-LSSVIS
C6LDI8      VLLIDADNRKS-TL--EYRYGVD-----R--TV-KGLSHFLA------GT-AE-LRDVLC
D4J4T6      VILLDADLRKS-VL--YNRCMPD-----Q--EV-KGLSHYLA------GF-VP-LNDVIC
D4LTH2      SVLVDVDLRNS-VL--MKSVQVD-----V-SDK-KGLNHYLS------GL-AE-YDEVVY
D4LG06      TVMVDVDLRKS-VQ--MQRMQVE-----NASET-KGLNHYLS------GM-AE-YEDVVY
A7VF42      TVFLDVDLRKS-VI--KGRHNMK-----SESEI-KDLGYYLS------GQ-AE-YEDVVY
A8SQS8      TVLVDVDLRKS-VI--KERHHIN-----NTEKL-QDLGYYLS------GQ-AE-IEDVVY
D5HFS4      AVLVDVDLRKS-VI--KDRHHIK-----DADKL-PDLGYFLS------GQ-SE-MEDVIY
C9LAS1      VLLIDADIRKS-AY--VSRYRIK-----Q--KV-NGLSQYLS------GQ-LA-KEFLIY
F3AH92      VLLLDADIRKS-VY--VKRYSVK-----Q--EV-KGLSQCLS------GQ-VD-KEQITY
I5ASF8      VLLIDADIRNS-QY--VSRFGVK-----Q--HV-LGLSEYLS------GQVDE-VNQIFY
E7GL81      VLLIDADVRKS-VL--VTRYKLD-----R--KI-EGLSQYLS------GQ-KK-LEEVIY
G5F9E2      VLLIDADVRKS-VL--VTRYKLD-----R--KI-EGLSQYLS------GQ-KK-LEEVIY
E7GL57      VLLIDADIRKS-IL--VTRYQLD-----R--RV-DGLSQYLS------GQ-KK-LEEVVY
G5F9A9      VLLIDADIRKS-IL--VTRYQLD-----R--RV-DGLSQYLS------GQ-KK-LEEVVY
E7GL40      VLLIDADIRKS-VL--VSRYHLE-----H--QV-DGLSQYLS------GQ-CK-KEEVVY
G5F9H2      VLLIDADIRKS-VL--VSRYHLE-----H--QV-DGLSQYLS------GQ-CK-KEEVVY
A8RK85      VLLVDADIRKS-VM--VKRYEIK-----G--NP-NGLSQYLS------GQ-KS-LEEICY
G5HTB2      VLMIDADIRKS-VL--IKRYEIK-----G--NP-NGLSQYLS------GQ-KS-LDEICY
G5HNC5      VLLIDGDIRKS-VI--VKRHEIQ-----G--NP-CGLSQYLS------GQ-KT-AEEICY
C0CZV9      VLLIDADIRKS-VL--VSRYQLE-----D--EV-CGLSQYLS------GQ-KP-LEEIRY
A8RSK9      VVMIDADIRKS-VL--VSRYQLE-----H--EV-PGLSQYLS------GQ-RP-LEHVLY
C5EN03      VVMIDADIRKS-VL--VSRYQLD-----T--EV-YGLSQYLS------GQ-KT-LEEVLY
G5HG45      VVMIDADIRKS-VL--VSRYQLE-----T--EV-YGLSQYLS------GQ-KT-LADVLY
D9ST44      TILIDCDFRNP-SL--HRQFNIP---------NRKGLLGFLE------GNA-L-FSESVQ
G2Z8Q3      VLIIDADLRLP-SQ--HYILGVD---------NSIGLTDILE------ETI-Q-SQNAIQ
C8W5K2      AVLLDCDFRKP-GL--HTVFGQS---------NNKGLVDIIL------GRL-P-LDLGLK
F5LM71      VLLIDADLRKP-TA--HRTFGLS--------NR-TGLTDVLT------RQA-E-VEEALK
D7VBW4      VLLVDADLRRP-TI--HQTFAIS--------NQ-RGVSSWLS------GQLTD-VNEAIY
F9UQ54      VLLVDADLRRP-TI--HQTFAIS--------NQ-RGVSSWLS------GQLTD-VNEAIY
H6LKR8      VLLIDADLRLP-RI--GKIFDIS-----L--NQ-PGLSNMLV------DGL-I-FDSVLN
E0I7B5      VLLIDADLRKP-SL--HRMFDLS--------NR-IGLTNLLA------GQF-H-LSEVEQ
D7UYE4      TLLIDGDMRKP-TQ--HYQFNKS--------NI-EGLSKLII------KKS-D-FEKSIL
Q4A120      TLLIDGDMRKP-TQ--HYIFNKN--------NI-KGLSNVII------NKS-T-FEDAVY
D9SVC7      VLIIDSDIRKP-YI--HKLFSLP--------NK-TGLTTVLT------NQC-D-LMDAIQ
D9S1J9      VLLVDADLRRP-KL--YKLFLLE--------NY-KGLSNLLA------EDL-P-LDTVVN
C0GGR5      VLILDADLRNP-TM--HKIFNVR--------NN-VGITNLLL------NGSIS-LEETL-
C6CSC8      VVLIDADMRKP-TA--HKTFQIS--------NR-FGLSSVIS------QQS-T-LQEVIQ
A3ICA3      VLIIDADMRKP-TL--HHTFYLD--------NI-FGLSSVLS------RQA-T-LQEVIQ
B1HR41      VLIIDADMRKP-TL--HHTFYLD--------NV-FGLSSVLS------RQA-T-LQEVIQ
D6Y034      VLLIDGDMRKP-TG--HFTFQLP--------NK-QGLSNVLA------KQA-S-LSSCVQ
Q8EME8      VLLVDADLRKP-TI--HYTFRLD--------NL-RGLSNILV------GET-S-LRDAVE
F3Y922      VLLVDADMRNP-TI--AKTFELI--------NN-RGLSTLLS------NKTMT-TEEVLQ
G4L594      VLLVDADLRKP-TI--HKTFQLN--------NE-AGLSTVLS------TGV-K-AGETAQ
C9B454      VLLVDADLRKP-VV--YETFQLN--------NA-SGLSTALS------SSG-S-VADEIQ
Q3XYS6      VLLVDADLRKP-VV--YKTFQLN--------NA-SGLSTALS------SLG-S-VVDVIQ
C9ALZ9      VLLVDADLRKP-VI--YKTFKLN--------NA-SGLSTVLS------SSG-S-VADEIQ
C9BUG7      VLLVDADLRKP-VV--YKTFQLN--------NA-SGLSTALS------SSG-S-VADVIQ
D4RJF4      VLLVDADLRKP-VV--YKAFQLN--------NT-SGLSTALS------SSG-S-VADVIQ
C8ZXT9      VLLVDADMRKP-TV--HKTFNLL--------NN-VGVSTVLS------TST-N-LAEAAQ
G5IRQ6      VLLVDADMRKP-TV--HKTFNLL--------NN-VGVSTVLS------TST-N-LAEAAQ
C9A6V5      VLLVDADMRKP-TV--YKTFSLN--------NA-SGLSTVLS------TST-S-VLEAAQ
C9CHY8      VLLVDADMRKP-TV--YKTFNLN--------NA-SGLSTVLS------TST-S-VLEVAQ
Q814Z0      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-R-LEKCVQ
B9IRQ6      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-R-LEKCVQ
B7HXB4      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------YSE-R-LEKCVQ
Q72XH8      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-R-LEKCVQ
A0RL70      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-R-LEKCVQ
Q6HB09      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-R-LEKCVQ
F0PU64      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-R-LEKCVQ
B7HFH1      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-R-LEKCVQ
B7IQS8      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-H-LEKCVQ
B3ZRD6      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-R-LEKCVQ
B5UQ73      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-R-LEKCVQ
G9QCG3      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-R-LEKCVQ
Q3EV64      VLLIDADMRKP-AM--HQMFQVD--------NI-FGLTNVLT------HSE-R-LEKCVQ
Q5WBB4      VLLIDADMRKP-TA--HYTFGLM--------NN-RGLTNVLT------RQQ-K-QDDVIQ
B1YMM5      VLIIDTDMRRP-TV--HYTFRVA--------NG-LGLSSLLT------RQA-D-LGKAIL
D7WMM8      VVIVDADLRKP-TM--HYTFLLQ--------NA-RGLSNLLT------RHF-T-ISEVVN
A7Z921      VLLVDADLRKP-TI--HETYQLE--------NV-QGLTNVLV------GNA-S-LGETVQ
I2CAF2      VLLVDADLRKP-TI--HETYQLE--------NV-QGLTNVLV------GNA-S-LGETVQ
A7Z9K0      VLLIDADLRKP-TV--HFTFKLD--------NG-TGLTSLLL------KQM-P-FQKAVL
I2CB16      VLLIDADLRKP-TV--HFTFKLD--------NG-TGLTSLLL------KQM-P-FQKAVL
I2HW53      VLLIDADLRKP-TV--HFTFKLD--------NG-TGLTSLLL------KQM-P-FQKAVL
G9QKR4      VLLVDSDLRKP-TM--HYTFRVT--------NT-VGLTNVLT------RQA-S-LVEAVQ
D5DBK3      VLLIDADLRKP-TA--HYTFRLE--------NH-AGLTNVLT------RQS-T-LGQGVQ
D5DY81      VLLIDGDLRKP-TA--HYTFRLE--------NH-TGLTNVLT------RQS-S-LGQAVQ
Q2BFS5      VLLVDADLRKP-TA--HYTFNLT--------NN-NGLTNVLT------KSS-S-LLKAVK
A4ITF3      TLLVDADLRKP-TV--HYTFRLN--------NY-AGLTSVLT------NAS-P-LSSALQ
C5D961      VLLIDADLRKP-TV--HYTFRLN--------NY-MGLTNVLT------NSA-P-LLPSCQ
G8MZ93      TLLIDADLRKP-TV--HYTFRLN--------NY-KGLTNVLT------GSA-P-LLPTCQ
C6CW37      VLLIDTDLRKP-TI--HRIFSQT-----N---R-QGLTNLLT------SQS-T-LQEVIK
G9RSY9      VLVIDCDLRKP-VI--HRYLKID-----N--SAYKGITSALA------DGS-L-AESIIN
F7K9V1      VVLVDADLRKS-VL--KGRYKTN-----A--AR-YGLSHYLS------GQA-S-ISDISC
F7K8E9      VILVDADLRKS-VL--KGRYKSN-----A--AR-YGLSHYLS------GQA-S-ISDIFC
F7KL96      VILVDADLRKS-VL--KGRYKSN-----A--SR-YGLSHYLS------GQA-S-ISDISC
B9Y884      VLVIDLDLRMP-TI--HKKLKLK-----N---K-KGISDIIG------HQA-E-FEEVVL
A5Z5P9      SVFVDGDMRNS-VI--VNKYGIEKEDGSE---M-EGLAHYLA------EEF-P-LENVVY
F2I6Z7      VLMIDCDLRKP-TV--HKTFDIH----SR---K--GLTTYLT------DRD-V-DYMDVA
D4YHG7      VLLVDADLRKP-TV--AKTFNIN----TT---V--GLTSLLT------DRD-A-SIMDTV
C1J9I3      VLLIDADLRRP-TI--HATFRTL----NI---D--GVTTILI------G-K-D-EAGAVV
B1MZT1      VLLVDADLRRP-TV--AITFDVT----DN---H--GLTNYLA------DAH-S-ELGSII
H1WR06      VLLVDADLRRP-TV--AITFDVT----DN---H--GLTNYLA------DVH-S-ELGSII
H1X4N2      VLLVDADLRRP-TV--SVSFGLN----RN---S-VGLTNYLG------DSH-K-EISYVV
Q03W95      VLLVDSDLRRP-TV--AVTFGLN----KN---A-SGLTNYLG------DSE-K-EVGSII
F0SX22      VLIIDCDLRRP-RI--SSLLSMP-----A---S-PGLSNVLV------SLS-S-PDEVIH
B6W7H4      VVLLDFDLRMP-KV--GKVAGIE-----T---N-MGLTNVIT------GKV-E-LDRALI
F0GT81      VILLDCDLRSP-SI--SEVSGIK-----D---N-VGLTNYLT------GKV-S-LERAIN
B1R3X6      VIIIDCDLRRP-TI--HKKFGIS-----N---S-IGLTEYII------GKN-D-LNNVIQ
Q8XN76      VIIIDCDLRRP-TI--HKKFGIS-----N---S-IGLTEYII------GKN-D-LNNVIQ
B1BNK1      VIIIDCDLRRP-TI--HKKFGIS-----N---S-IGLTEYII------GKK-D-LNNVIQ
B1V0N7      VIIIDCDLRRP-TI--HKKFGIS-----N---S-IGLTEYII------GKN-D-LNNVIQ
Q0SVR8      VILIDCDLRKP-VV--HKEFQIS-----N---S-RGLSEFLI------GNV-E-FSKVVY
B1BNH3      VIIIDCDLRKP-VV--HKNFGIS-----N---S-VGLSEFLI------GKV-E-FSKVVY
Q8XN46      VIIIDCDLRKP-VV--HKNLGIS-----N---S-IGLSEFLI------GKA-E-FSKVVY
B1V1Z4      VIIIDCDLRKP-VV--HKNFGIS-----N---S-VGLSEFLI------GKV-E-FSKVVY
G5GFW0      TLFIDADIRKS-VM--LTRYQVD----ID---V-YGLSQYLS------GQI-K-LEEVIY
C2EFR6      ALLIDADLRKS-VS--RQLIRTG----SI---E-MGLSDYLV------GRA-Q-FDDVIA
F3ATF5      VLLLDADIRKS-IL--ASRYGVG----KQ---V-QGLSNYLS------GQA-S-IAEIIY
D4M2S0      VLIIDADIRKS-SY--IKRYQVK----QK---T-NGLSQYLS------GQI-S-LEEIIY
F4BS19      VLLVDADMRNP-SL--HKLFKVR-----N---Q-QGLTSILT------TKN-R-QIANLL
D4CG08      VLVVDADIRKS-VL--LTRYQVE----QE---V-HGLTEYLS------GQR-Q-MEEVIC
D4MP30      VLVVDADIRKS-VL--LTRYQVE----QE---V-HGLTEYLS------GQR-Q-MEEVIC
C6LCS5      VLFIDADLRKS-VL--IGRLGVT----EK---I-VGLTNYIT------GQC-E-FKEIVC
B0P2G2      ILMVDADLRKS-VM--AARYHIQ----GI---D-KGLSHYLT------GQA-E-VEDIIY
D4MW29      ILMVDADLRKS-VM--AARYHIQ----GI---D-KGLSHYLT------GQA-E-VEDIIY
E5VMX8      ILMVDADLRKS-VM--AARYHIQ----GI---D-KGLSHYLT------GQA-E-VEDIIY
D4JMC2      VLIVDTDMRKS-VL--VGRLRAKVESGGK---I-YGLSHYLS------GQV-S-LDKVVY
D6E0V4      VLIVDTDMRKS-VL--VGRLRAKVESGGK---I-YGLSHYLS------GQV-S-LDKVVY
D6E330      VLFIDTDMRKS-VL--AGRLRATAASGGE---I-CGLSHYLS------GQR-R-LEEVMY
C4Z8M5      VLFIDTDMRKS-VL--AGRLRATAASGGE---I-CGLSHYLS------GQR-R-LEEVMY
D4JI67      VLFIDTDMRKS-VL--AGRLRATAASGGE---I-CGLSHYLS------GQR-R-LEEVMY
D3AC80      VLFIDADIRKS-VL--VGRYKAE----GN---K-FGLTHYLS------GQK-T-IDDVIC
G5IFS3      VLLIDADIRKS-VI--LGRYRIN----KE---V-FGLTHYLT------RQR-G-KREVIY
D4RX67      TIFIDSDLRKS-VL--MGRYKIS----KS---I-GGLSHYLS------GMY-P-LEEVVC
A6BIG7      VLFIDADLRKS-VL--VGRYKVT----GK---I-KGLTHFLS------GQS-D-AKDVIQ
C0C0F8      VLFVDADLRKS-VL--MGRHKVN----GD---L-KGLSHFLS------GQS-E-VDDIIY
Q97EP8      VLLLDCDLRKP-SV--HKKFKIS-----N---N-IGLSNVLA------GQT-K-FESASH
Q97ER5      VLLMDCDLRKP-SV--HKKFKIS-----N---N-DGLSNVLA------GHT-K-FENASN
D2RIR2      VLLVDCDLRKP-VQ--HKIFGVI-----N-----QGVTNCLA------QGV-P-FAQVVH
G0VNK6      ILLIDCDMRKP-VV--HRRFGLL-----N-----RGLSNCFA------EDL-P-LKEVIQ
I0GRR2      VLLIDADMRKP-VQ--HKKFRLQ-----N-----KGLSNIIA------TGE-S-LESMIQ
A0PZ02      VLLIDCDLRKP-TV--HKKFHIS-----N---E-KGLSNYLV------GEV-P-FEEVVV
B1B736      VLLIDCDLRKP-TV--HKKFNIS-----N---I-KGLSNYLV------GEV-S-FEEVAV
F6BI62      VIVVDCDLRNP-TV--HQMFKIP-----N---M-SGLTNIIV------EDD-R-YEKYVI
Q8RBS5      VVVIDGDLRNP-TV--HKSFNLP-----N---N-RGLTNLLI------DEG-D-YEAYLN
G2MWC2      VIVIDADLRNP-TV--HKTFNLP-----N---S-RGLTNLLI------DEG-D-YEAYLN
B0K4N1      VIVIDADLRNP-TV--HKTFNLS-----N---S-RGLTNLLI------DEG-D-YEAYLN
B0KAR5      VIVIDADLRNP-TV--HKTFNLS-----N---S-RGLTNLLI------DEG-D-YEAYLN
E8UV29      VIVIDADLRNP-TV--HKTFNLS-----N---S-RGLTNLLI------DEG-D-YEAYLN
C7ISF7      AIVIDADLRNP-TV--HKTFNLS-----N---S-RGLTNLLI------DEG-D-YEAYLN
C9AAE5      TLLIDADLRKP-TQ--HYLFSQE-----M---H-VGLSNYIR-------RDIS-IESCVQ
H7F6C8      TLLIDADMRKP-TL--HKRFSKN-----L---H-LGLSNVMT-------GDIS-LEDSIQ
H7F5T6      TLLIDLDLRRP-SL--GFAIPIV-----K--AS-PGLTGILD-----SSQNLT-PEDVIV
B1R3V1      VIIIDCDLRKP-VV--HKNFGIS-----N---S-VGLSEFLI----GKV---E-FSKVVY
D4YF13      VLIVDTDLRKP-TL--HKTFKLN-----N---N-VGLTTALV----NEEY--S-LESVIQ
E6U7N4      VLLIDLDLRKP-TI--KKNLKLK-----D--VR-SGISSVLA----DQK---S-EDDCIV
C8VYQ6      VLIIDCDMRKP-TQ--HKIFELS-----N---I-KGLSNVLI----GEL---S-LMKGLL
D3AE78      VLLLDADMRKS-VL--MGHYRVD-----Q--ET-RGLSHYLV----GQE---S-AENVAY
A4J8V0      VIIVDADLRKP-TQ--HKVWEID-----N---I-IGLTNILL----GDT---E-IATALQ
A8U9F4      VLIVDADMRKP-TV--HKTFRLP-----N---R-DGLTTLLT----ERD--VE-IKDIAH
F4BSD9      VLIVDADMRKP-TV--HKTFRLP-----N---R-DGLTTLLT----ERD--VE-IKDIAH
F7V792      SVLVDADLRNS-TLADRCRMETD-----S--GQPMGLSHYLA----NDC---E-LEDVLY
F6IR93      VLLVDADLRRP-TV--HQTFGVP-----N---Q-RGLSSWLS----GQLE--D-VNDAIH
G0M0F9      VLLVDADLRRP-TV--HQTFGVP-----N---Q-RGLSSWLS----GQLE--D-VNDAIH
F6ITB4      VLLVDADLRRP-TI--HKTFGLK-----N---Q-KGLSSWLG----NQLD--D-VNDAIH
G0M1X9      VLLVDADLRRP-TI--HKTFGLK-----N---Q-KGLSSWLG----NQLD--D-VNDAIH
G0LYN9      VLLVDADLRRP-TI--HTTFGLE-----N---H-KGLSSWLA----NQMD--N-VNDAIH
D7VC13      VLLVDADLRRP-TI--HKTFGLK-----N---H-KGLSSWLA----NQLD--D-VNDAIH
F9UMZ6      VLLVDADLRRP-TI--HKTFGLK-----N---H-KGLSSWLA----NQMD--D-VNDAIH
I5AV01      TLLIDADMRKS-VL--VGRTGVS-----G--KQIKGLAHALS----GQC---D-GVDVVY
B0GAL3      TVLLDADIRKS-VL--VQRYLVD-----S--DV-KGLSQYLS----GQA---P-VRDILY
G1WUK2      TVFLDADIRKS-VL--VQRYFVD-----S--DV-KGLSQYLS----GQA---P-VRDILY
E0RZL3      TVLVDADMRKS-VL--VGRYKTG-----S--VR-LGLTHCLV----GRER----LSSVIC
D8FLF8      TILIDADLRRP-TL--HSTFNVS-----N---S-NGLTTLLT----SRAKEMG-ANSVIR
F0K0J7      TILVDADLRRP-TM--HSTFNVS-----N---S-NGLTTLLT----SRSMEMD-ANSVIR
Q1G8E4      TILVDADLRRP-TM--HSTFNVS-----N---S-NGLTTLLT----SRSMEMD-ANSVIR
C4VP08      TLLIDGDLRRP-TV--HSTFSLS-----N---R-RGLTTILT----SNNNKFN-LDDFAQ
D6S4X4      TLLIDGDLRRP-TV--HSTFSLT-----N---R-RGLTSILT----SDSNELN-LDEFTQ
D0DJH0      TLLIDGDLRRP-TL--HSTFNVK-----N---N-TGLTTVLT----SEADEIN-LNDVVE
C7XKF3      TLLIDADLRRP-TL--HSTFNVK-----N---N-TGLTTVLT----SEADAIN-LNDVVE
E3R264      TLLIDADLRRP-TL--HSTFNVK-----N---N-TGLTTVLT----SEADAIN-LNDVVE
D5GZJ8      TLLIDADLRRP-TL--HSTFNVK-----N---N-TGLTTVLT----SEADEIN-LNDVVE
C2EPK5      TLLIDGDLRRP-TV--HTTFNLS-----N---H-VGLSTVIS----SSAKEVD-LDKVIQ
A4ZGZ8      VLLIDADLRRP-TV--HRTFNLS-----N---H-VGLSTVIS----STAKEVD-LDEVVQ
A8YX89      VLLIDADLRRP-TV--HRTFNLS-----N---H-VGLSTVIS----STAKEVD-LDEVVQ
F0NWJ7      VLLIDADLRRP-TV--HRTFNLS-----N---H-AGLSTVIS----STAKEVD-LDEVVQ
E4SMV5      VLLVDADLRRP-TV--HSTFNLS-----N---H-VGLSTVIS----STAKEVD-LDSVVQ
F0TGY2      VLLVDADLRRP-TV--HSTFNLS-----N---H-VGLSTVIS----STAKEVD-LDSVVQ
Q5FIC7      VLLVDADLRRP-TV--HSTFNLS-----N---H-VGLSTVIS----STAKEVD-LDSVVQ
F2M2M6      VLLVDADLRRP-TV--HSTFNLS-----N---H-VGLSTVIS----STAKEVD-LDSVVQ
G7M0Q3      VLLIDCDLRKP-SV--HVNFNVS-----N---L-VGISEVLL----GKV---P-IEEAVQ
G7M1R9      VIIVDCDLRKP-SV--HKNFKVS-----N---L-KGLSEVLI----GKE---E-LDNVVL
A6M2L9      VILVDCDLRKP-SV--HKNFKVS-----N---L-IGLSEVLL----GKA---A-IEEAVQ
G7M566      VILVDCDLRKP-SV--HKNFKAS-----N---L-VGISEILI----GKV---S-IEEAVQ
G2KUP1      TILIDADMRRP-TV--YKTFMVS-----N---Q-NGLSTYLS----GNS---N-LDESIL
G8PE06      ILLVDADLRRP-TV--HRTFSQN-----N---A-KGLSTLLS----GNV---D-MDTAIH
Q03GL8      VLIVDADMRRP-TV--HRTFSVS-----N---A-VGLSNLLA----ETG---S-LENAIH
E0NHP4      VLIVDADMRRP-TV--HRTFRTS-----N---A-IGLSNLLA----GTG---S-LDDAIH
F4FXQ7      VLFIDSDLRRP-TL--HTTFGLL-----N---T-NGLSTALS----TDI---D-FNSVVQ
C0WV35      TLFIDSDLRRP-TL--HTTFGLL-----N---T-NGLSTALS----TDI---D-FNSVVQ
H1LCW3      TLFIDSDLRRP-TL--HTTFGLL-----N---T-NGLSTALS----TDI---D-FNSVVQ
C2JZS1      VLLVDADLRRP-TV--HATFRKL-----N---L-DGVTTVLT----GKT---K-PDEVVE
Q58Z10      VLLIDADLRRP-TV--HATFRTL-----N---L-DGVTTVLT----GKE---K-PDDVVE
E9SAU1      VLLIDGDLRKP-VQ--HKVFNIK-----N---E-VGISSLIG----GLN---S-FKEVVH
Q38VG5      VLLVDADMRRP-TI--HQTFQVP-----N---K-KGLTSLLT----ED--EFD-FNTTIQ
F0HVF1      TILIDADLRWP-TL--HSTFNVS-----N---S-NGLTTLLT----SRSKEMD-ANSVIR
G6F8G9      TILVDADLRRP-TM--HSTFNVS-----N---S-NGLTTLLT----SRSMEMD-ANSVIR
C2EWM3      VLLIDADLRRP-TL--HQTFNIS-----N---R-EGLTTILT----SDALEMD-ITNMIK
F8DRU2      VLLIDSDLRRP-TL--HATFSKN-----N---Q-HGLTTILT----SGTNSVD-LHEIIQ
B3XL23      VLLIDSDLRRP-TL--HATFNKS-----N---Q-HGLTTILT----SGTNSVD-LREIIQ
F8KGP1      VLLIDSDLRRP-TL--HATFNKS-----N---Q-HGLTTILT----SGTNSVD-LREIIQ
H4GK03      VLMVDADLRRP-TM--HSTFDLD-----N---R-QGLTTLLM----DQEHVIN-SQDVIQ
B2GF33      VLLIDADLRRS-TL--HATFGLS-----N---Q-KGLTTVLT----GDSNEVD-LSNVVQ
C0WW26      VLLIDADLRRS-TL--HATFGLS-----N---Q-KGLTTVLT----GDSNEVD-LSNVVQ
D0DSJ4      VLLIDADLRRS-TL--HATFGLS-----N---Q-KGLTTVLT----GDSNEVD-LSNVVQ
C0ZHV8      TVLLDFDLRNP-RV--HFTFDMP-----N---L-YGISSYFS------DMC-Q-IPDIIQ
H1BJT1      VLVIDCDLRRP-KM--HRYFQIS-----N---Q-VGLSDLLVFIDKQPDLS-T-YIQEVT
F8FCE2      VLIVDADMRRP-NV--HNMFRRP-----N---R-VGLSNLLA------GQY-T-VQELVT
H6NE43      VLIVDADMRRP-NV--HNMFRRP-----N---R-VGLSNLLA------GQY-T-VQELVT
I0BSG4      VLIVDADMRRP-NV--HNMFRRP-----N---R-VGLSNLLA------GQY-T-VQELVT
Q83VF9      VLLIDGDLRKP-TV--DITFKVQ-----N---R-VGLTNILM------HQS-S-IEDAIQ
G8P3D7      VLLIDGDLRKP-TV--NLTFKVQ-----N---R-VGLTNILM------HQS-S-IEDAIQ
O06030      VLLIDGDLRKP-TV--NITFKVQ-----N---R-VGLTNILM------HQS-S-IEDAIQ
G9M880      VLLIDSDLRKP-TV--NITFKVQ-----N---R-VGLTNILM------HQS-S-IEDAIQ
G6FD42      VLLIDGDLRKP-TV--NITFKVQ-----N---K-VGLTNILM------HQS-S-IEDAIQ
F9VC44      VLLIDGDLRKP-TV--NITFKVQ-----N---R-VGLTNILM------HQS-S-IEDAIQ
A9QSJ4      VLLIDGDLRKP-TV--NITFKVQ-----N---R-VGLTNILM------HQS-S-IEDAIQ
Q3ZK50      VLLIDGDLRKP-TV--NITFKVQ-----N---R-VGLTNILM------HQS-S-IEDAIQ
E3GPC6      VLLIDCDLRRP-RI--HRLFEQP-----N---K-RGLTNILL------REC-E-PTEAIQ
G0V447      VLVIDCDLRKP-TV--HKRFNLS-----N---Q-KGLTNLFV------EDI-T-FEETVQ
H7F1R7      TLLIDADMRKP-TG--HLTFRIR-----S---N-IGLSNLLA------SSDLA-AEEVCS
E6UHY4      VLLIDGDLRKP-VQ--HRVFSLT-----N---D-LGLSTLIS------GTN-T-FKEIVH
D9QTC6      VIVIDADMRKP-MQ--HRIFEIT-----N---F-GGLSDLLT------GEL-N-FAEGLQ
D9SR41      ILIIDADLRKP-SV--HKKFGIS-----N---Q-LGLTNVLT------EQC-E-IFSAIQ
P95696      TLVIDGDMRKP-TQ--NYIFNEQ-----N---N-NGLSSLII------GRT-T-MSEAIT
Q2G1K7      TLVIDGDMRKP-TQ--NYIFNEQ-----N---N-NGLSSLII------GRT-T-MSEAIT
A8YPQ5      TLIVDGDMRKP-TQ--HYIFNLP-----N---N-EGLSSLLL------NWS-T-YQDSII
Q2FUV2      TLIVDGDMRKP-TQ--HYIFNLP-----N---N-EGLSSLLL------NWS-T-YQDSII
P39851      TLIIDGDMRKP-TQ--HYIFDLP-----N---N-SGLSNLII------NKT-T-YSDSIK
C5QNG4      TLIIDGDMRKP-TQ--NYIFEEA-----N---Y-DGLSNLII------GKS-D-YDKAIR
Q4L9H7      TLIIDGDMRKP-TQ--HYVFETS-----N---Y-DGLSNLIV------GKS-D-FETAIR
E4Q5T5      VLVIDADLRRP-AI--HKVFGVS-----N---K-VGLTNLLV------ENK-K-FEEIVQ
E4SDX4      VLVIDADLRRP-AI--HKVFGVS-----N---K-VGLTNLLV------ENK-N-FEEIVQ
E4S7Y6      VLVIDADLRRP-AI--HKVFGVN-----N---R-FGLTNILA------ENK-L-FEEVVQ
C6CS80      TILVDADLRKP-TS--HYNFGLS-----N---R-TGLSHVLS------GQA-D-LSEVIK
E6LD64      VLLVDADLRKP-TV--HKTFHLQ-----N---N-VGFSNLLS------TKE-T-MSNVIQ
F0EKB9      VLLVDADMRKP-TV--YKTFSLN-----N---A-SGLSTVLS------TST-S-VLEAAQ
H7F571      TLLIDADMRKP-TV--HRAFGIR-----V---N-IGLSNLLT------GDV-E-YDEVFR
F5LE48      VLLIDADLRKP-TM--HKLFGIS-----N---R-SGLTNLLL------GEA-P-VREVAI
E7RDR3      VLLIDGDMRKP-TT--HYTFRMG-----N---T-IGLSSVLT------RQS-S-IQEVIR
E7RG08      VLLIDADMRKP-TM--HQTFKIS-----N---S-KGLSNVLV------RRF-S-LKMAIQ
F6CNF5      VILVDCDLRKP-TQ--HRIFEVE-----N---H-RGLTNCLL------QNL-D-PAEVSK
G2FWX4      VLVVDADLRNP-TQ--DKLFGLD-----N---G-KGLSVALT------QDQ-D-ISQYIQ
G2FM59      VLIIDADLRNP-TQ--HKLFGLD-----N---G-TGLSVSLV------QDQ-D-YCNYIR
G7WJV1      VLIIDADLRNP-TQ--HKLFGLD-----N---R-VGLSIYLV------EDG-D-YGGYIR
H5XZD4      VLIIDADLRNP-TQ--HKLFGLD-----N---R-AGLSVYLV------EDQ-D-YRKYIW
H5XZG7      VLLIDADMRNP-TQ--HKLFGLS-----N---M-EGLSVSLV------QDQ-G-SHAFIK
G7W773      VLVIDADLRNP-TQ--HKLFELE-----N---F-EGLSNFLV------QDD-Q-DKDFIR
G2FWT8      VIVVDADMRNP-TQ--HKLFGLD-----N---G-QGLSVALV------QDQ-D-YRQYVQ
I4DBG8      VLVVDADLRNP-TQ--HKLFGLP-----N---V-EGLSVALV------QDQ-D-YINYAR
C0EBA6      TLLIDADMRKP-TQ--YKIFRLT-----R---G-NGLSSLLG------GFT-K-PENTIV
Q9K6R0      VLFVDADLRKP-TA--HYTFRAV-----N---T-RGLTRVLM------RQE-T-LEEAIQ
I2HVL2      VLLVDADLRKP-TI--HETYQLE-----N---V-QGLTNVLV------GNA-S-LGETVQ
D4G1R2      VLLVDADLRKP-TI--NQTFQVD-----N---V-TGLTNVLV------GNA-S-LSETVQ
G4EQZ7      VLLVDADLRKP-TI--NQTFQVD-----N---V-TGLTNVLV------GNA-S-LSETVQ
P71051      VLLVDADLRKP-TI--NQTFQVD-----N---V-TGLTNVLV------GNA-S-LSETVQ
E0U2Z3      VLLVDADLRKP-TI--NQTFQVE-----N---V-TGLTNVLV------GNA-S-LSETVQ
G4P114      VLLVDADLRKP-TI--NQTFQVE-----N---V-TGLTNVLV------GNA-S-LSETVQ
A9VRC3      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C2QJY5      VLLIDADMRKP-AM--HQMFQTD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C2RG49      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C2T8T6      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C2MTG3      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C2SSX8      VLLIDADMRKP-AM--HQMFQVD-----N---I-VGLTNVLT------HSE-R-LEKCVQ
C2YZB2      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C3GBJ8      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------YSE-R-LEKCVQ
C2SBU4      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------YSE-R-LEKCVQ
C2NQN6      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C3GRR0      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C2PN22      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C2Y452      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLS------LSE-R-LEKCVQ
C2WVG6      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C3EBC0      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C2XJH9      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C2P8H3      VLLIDADMRKP-AM--HQMFQVD-----N---I-LGLTNVLT------NSE-R-LEKCVQ
C2ULR6      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------NSE-R-LEKCVQ
C2V4M2      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
C3H979      VLLIDADMRKP-AM--HQMFQVD-----N---I-FGLTNVLT------HSE-R-LEKCVQ
G2TR25      VLLVDADLRRP-TV--HYTFGMT-----N---T-FGLTTVLT------KQG-T-LEETAV
P96716      VLLIDADLRKP-TV--HTAFFLE-----N---T-VGLTSVLL------KKS-S-MEQAVQ
G4EQF3      VLLIDADLRKP-TV--HTAFFLE-----N---T-VGLTSVLL------KKS-S-MEQAVQ
D4G2E1      VLLIDADLRKP-TV--HTAFFLE-----N---T-VGLTSVLL------KKS-S-MEQAVQ
I0F9R6      VLLIDADLRKP-TV--HTAFFLE-----N---T-VGLTSVLL------KKS-S-MEQAVQ
E0TTZ6      VLLIDADLRKP-TV--HTAFHLE-----N---M-IGLTTVLL------KKS-S-LEQAVQ
G4P1M7      VLLIDADLRKP-TV--HTAFHFE-----N---M-IGLTTVLL------KKS-S-LEQAVQ
A8FHL9      VLLMDADLRKP-AV--HEYFDLS-----H---H-TGLTNVLL------NNC-S-LEEAIL
Q5KUM5      TLLIDADLRKP-TV--HYTFRLN-----N---Y-KGLTNVLT------GSA-P-LLSTCQ
D3FZP4      VLLLDADLRKP-TV--HYTFQVD-----N---T-FGLTNVLT------KQH-T-LSEAVK
I0JRK4      VLLVDADLRKP-TV--HYTFRAD-----N---T-SGLSNYLV------RNR-S-LKELAK
I3EBB3      VLLIDADMRKP-TV--HYTFNLM-----N---T-IGLTNVLT------RQM-D-LMEAVV
             :..* * * .                        ..   :                   

E3CP62      QTNI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMDVARSRYDYVIIDTPPIGLVIDAAII
C2KHF1      RTAM-DN-LDVITSGPIPPNPAELLGSGRMTELVTQLKSQYDLIIFDVPPFLMVTDAQVL
G9WIQ9      TSEQ-SN-LFIMTSGPMPPNPSELLASDKMVQIIDWMRRNFDLVVIDSTPLLLVPDAQSL
A0NKF6      STEI-PS-LYVMTSGPMPPNPSELLASDKMLRVVSWMREQFDMVVIDSTPLLLVPDAQAL
Q04DV8      STEI-PN-LYVMTSGPMPPNPSELLASDKMLRVVSWMREQFDMVVIDSTPLLLVTDAQAL
D3LB10      STEV-PN-LYVMASGPMPPNPSELLSSDKMLKVINWMKEQFEMVVIDSTPLLLVPDSQAL
B8D0N2      RKYLNPHEIEIVPCGTREKKSAPIIDRLSFTRLLKDLSNNRDLVIVDSPPL-VISDSLSM
F2I4B7      KSYV-PN-LFYLTCGAIPPNPSELLASKRMQELMDQLRNVFDIIVLDCPPVLAATDAQVV
C2CI44      DRDQ-AN-LDLIFTGPVPPNPAEILASQVFKKFIEDLSEVYDYVFIDTPPVGLFTDASIV
C7RGH6      DREQ-SN-LDMIFTGPVPPNPAEILASNAFKDFVEDLSKQYDYVFIDTPPVGLFTDASLV
C0CK73      RTSD-PN-LSIIFSGSYPPNPSELLSGIRFESLMETLRDAYDYIIVDAPPMGDLVDGAII
Q1WTC8      QSNI-EN-FSMIFSGPVPPNPSEILDGERFKHLIETVKEKFDIVIIDTPPMGSVIDAAVI
E8JWI5      ETDE-EN-LFVITSGQASPNPTALLQSERFTTMMSVLRRHYDYIIVDTPPIGMVVDATLI
F3AHH0      STNI-EN-MHIAYAGPVPPNPAELLGSKRFHDLLVSLRKVYDYILIDTPPLGSVIDSAIV
F7K0U1      KTQI-EG-LMVIFAGIIPPNPAELLGQERFGNLISSGRKVYDYIIIDAPPLGSVIDSAII
C4Z672      VSDE-PN-FCMIFAGPVPPNPSELVGNDRFAELIESARETFDMIIVDTPPIGSVIDAAVM
P0C0T9      ETNV-PR-LMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVVDAAII
Q04663      ETNV-PR-LMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVVDAAII
Q67AY4      ETNV-PR-LMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVVDAAII
Q3K0T0      ETNV-PR-LMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVVDAAII
C5NWJ8      ETDV-EH-LNVIPAGQVPPNPTGLLQNKNFNIMIEVFREYYDYVIIDTPPIGQVIDAAII
F3A499      ETDV-EH-LNVIPVGQVPPNPTGLLQNKNFNIMIEVFREYYDYVIIDTPPIGQVIDAAIV
Q4JZ55      ETTL-DN-LYILQAGVVSPNPLSLLRSVKFETLIDSMKKYFDYIIVDTPPIGQVIDAAII
G5JTD5      RTNI-PN-LTMIPAGQVPPNPTALFQSDNFKRMIEAVREHYDYVLLDTPPIGKVVDAAII
G3G7C1      ETNI-PN-LTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVVVDCPPLGMVIDAAII
G3G7J9      ETNI-PN-LTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVVVDCPPLGMVIDAAII
G3G7G6      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVIDAAII
G8DUB0      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVIDAAII
G3G7I8      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVIDAAII
G3G7J4      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVIDAAII
G7SG34      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVIDAAII
G8DTZ0      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVIDAAII
G8DU07      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVIDAAII
A4VTU3      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVVDAAII
G7SNU6      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVIDAAII
G8DU31      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVIDAAII
D5AGQ5      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVIDAAII
Q9X4U7      DTDI-PN-LTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVIDAAII
A3CQY2      DTDL-DN-LDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVIDAAII
E8KLY9      DTDL-EN-LDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVIDAAII
F0FHA8      DTDL-DN-LDVILSGPVSPNPTGLLQSKQFDALLADLRVRYDYIIVDTSPIGLVIDAAII
F0I4H5      DTDL-DN-LDVILSGPVSPNPTGLLQSKQFEALLTDLRVRYDYIIVDTSPIGLVIDAAII
F0IAY3      DTDL-EN-LDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVIDAAII
F0IJI2      DTDL-EN-LDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVIDAAII
F0IS53      DTDL-DN-LDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVIDAAII
F2C9N0      DTDL-DN-LDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVIDAAII
F2CH53      DTDL-EN-LDVILSGPVSPNPTGLLQSKQFEALLTDLRVRYDYIIVDTSPIGLVIDAAII
F3SM32      DTDL-DN-LDVILSGPVSPNPTGLLQSKQFEALLTDLRVRYDYIIVDTSPIGLVIDAAII
F3UDW7      DTDL-EN-LDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVIDAAII
F3UNJ4      DTDL-DN-LDVILSGPVSPNPTGLLQSKQFEALLTDLRVRYDYIIVDTSPIGLVIDAAII
F0FQQ5      DTDL-DN-LDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVIDAAII
D6R2T8      TTDI-AN-LHIILAGQPSPNPTGLLQSKNFEILLEALRTRYDYIIIDTSPIGLVIDAAII
F3UUQ2      TTDI-AN-LHIILAGQPSPNPTGLLQSKNFEILLEALRTRYDYIIIDTSPIGLVIDAAII
E6IZC2      ETNI-DN-LFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVIDAAII
G6A745      DTNV-EN-LFVIEAGQISPNPTALLQSKNFGMMVDILRNHYDYIIIDTPPIGIVIDAAII
A8AZR3      ETDV-PN-LFVIESGQSSPNPTALLQSKNFDEMMNILRRHYDYIIVDTPPIGLVIDAAII
F9HJP6      ETDV-KN-LFVIESGQSSPNPIALLQSKNFDIMMNILRRYYDYVIVDTPPVGLVIDAAII
Q4JYT9      DTNI-EN-LFVIQAGPVSPNPTALLQSENFATMIDTMRKYFDYVIVDTAPIGMVIDAAII
Q4JZY1      DTNI-EN-LFVIQAGPVSPNPTALLQSENFATMIDTMRKYFDYVIVDTAPIGMVIDAAII
E1LQJ7      DTNI-EN-LFVIQAGPVSPNPTALLQSENFATMIDTLRKYFDYVIVDTAPIGMVIDAAII
F9HC65      DTNI-DN-LFVIQAGPISPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVIDAAII
E1LPE7      ETNV-DN-LFVIESGVSSPNPTALLQSDNFGIVIETLRKYFDYIIVDTAPIGVVIDAAII
F9MJW5      ETNV-DN-LFVIESGVSSPNPTALLQSDNFGIMIETLRKYFDYIIVDTAPIGVVIDAAII
E8KDN2      ETNV-EN-LFVIQSGAISPNPTALLQSDKFETMIDTLRKYFDYIIVDTAPIGVVIDAAII
E8K322      ETNV-EN-LFVIQSGAVSPNPTALLQSDKFEAMIETLRKYFDYIIVDTAPIGVVIDAAII
F9PEU4      ETNV-EN-LFVIQSGAVSPNPTALLQSDKFEAMIETLRKYFDYIIVDTAPIGVVIDAAII
F9PZP7      ETNV-EN-LFVIQSGAVSPNPTALLQSEKFEAMIETLRKYFDYIIVDTAPIGVVIDAAII
C1CBD1      DTNI-EN-LFVVQSGAVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGVVIDSAII
Q7WVX0      DTNI-EN-LFVVQSGAVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGVVIDSAII
P96475      DTNI-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVIDAAII
Q9AHD2      DTNI-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIIDTPPIGIVIDAAII
Q4K2Q7      DTNT-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAAII
Q4K0T5      DTNI-EN-LFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAAII
Q4K0E1      DTNI-EN-LFVVQSGTVTPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVIDAAII
Q9AH95      DTNI-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVIDAAII
Q4K1M4      DTNI-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAAII
Q4JZ18      DTNI-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAAII
Q54520      DTNI-EN-LFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAAII
Q4JYH5      DTNI-EN-LFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVIDAAII
Q4K0V2      DTNI-EN-LFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAAII
A5M4L1      DTNI-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVIDAVII
B2ILP5      DTNI-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVIDAVII
C1CCB9      DTNI-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVIDAVII
Q4K1S7      DTNI-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVIDAVII
P72512      DTNI-EN-LFVVQSGPVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVIDAVII
Q4JZ84      DTNI-EN-LFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFAYIIVDTAPIGIVIDAAII
Q4K0X5      DTNI-EN-LFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAAII
Q4K0Z6      DTNI-EN-LFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAAII
Q4K195      DTNI-EN-LFVVQSGAVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAAII
Q4K0A0      DTNI-EN-LFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVIDAAII
Q4K0K2      DTNI-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAAII
Q4K1F9      DTNI-EN-LFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAAII
Q4K045      DTNI-EN-LFVIPAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
G6C7Z1      DTNV-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
D2ERX8      DTNI-EN-LFVIQAGTVSPNPTALLQSKNLSTMLETLRKYFDYIIVDTAPVGVVIDAAII
F9LZC4      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGAVIDAAII
F9P1W8      DTTI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGAVIDAAII
I0J9C9      DTNV-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
A6YIA8      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4K005      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4JZL7      DTNI-EN-LFVIQAGSVSPNPTALLQSENFTTMLETLRKYFDYIIVDTAPIGVVIDAAII
E5F5C5      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4JZG7      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4JZK1      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVIDAAII
A5LJS0      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q9AHB7      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4K1B7      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4JYK8      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4K0M3      DTNV-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q9AHA4      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q9X9A1      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q9ZII6      DTNI-EN-LFVIQAGSVSPNPTALLQRKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q8KWQ0      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4JZW7      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4JYX9      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4K0R7      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4K1K6      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4JZS3      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAII
Q4K0I2      DTNV-EN-LFVIQAGSVSPNPIALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVIDAAII
Q4K254      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVIDAAII
Q4K237      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVIDAAII
B1I967      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTAPVGVVIDAAII
G6J8A4      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTPPVGVVIDAAII
G6LKG5      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTPPVGVVIDAAII
Q9ZFT8      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIVVDTAPVGVVIDAAII
D6ZQI8      DTNI-EN-LFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTPPVGVVIDAAII
Q4K2A8      DTNI-EN-LFVIQAGSVSPNPIALLQSRNFSTMLETLRKYFDYIVVDTAPVGVVIDAAII
Q8VU31      DTNI-EN-LFVIQAGSVSPNPTALLQSRNFSTMLETVRKYFDYIVVDTAPVGVVIDAAII
Q4K2E1      DTNV-EN-LFVIQAGSISPNPTALLQSENFRTMIDTLRKYFDYIIVDTAPIGIVIDAVIV
Q4K2F7      DTNV-EN-LFVIQAGSISPNPTALLQSENFRTMIDTLRKYFDYIIVDTAPIGIVIDAVIV
A5YTV7      DTNV-EN-LFVVQAGSVSPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVIDAAII
F9Q345      DTNV-EN-LFVIQAGSVSPNPTALLQSENFKTMLDTLRKYFDYIIVDTAPIGVVIDAAII
Q6L5R0      DTNV-EN-LFVIQAGSVSPNPTALLQSENFKTMLDTLRKYFDYIIVDTAPIGVVIDAAII
A5YTT9      ETNV-EN-LFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVIDAAII
E6KKS0      ETNV-EN-LFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVIDAAII
F2QF90      ETNV-EN-LFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVIDAAII
E0Q2S8      DTNV-EN-LFVIQAGSVSPNPTALLQSENFATMLDALRKYFDYIIVDTAPIGVVIDAAII
A1ILY1      ETNV-EN-LFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVIDAAII
Q6L5T0      ETNV-EN-LFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVIDAAII
E9FEC5      DTNV-EN-LFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVIDAAIV
E0PPH9      DTNV-EN-LFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVIDAAIV
F5VSG9      DTNV-EN-LFVIQAGSVSPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVIDVAIV
E3CBS0      PTDF-PN-LDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGIVIDAAII
F9M366      PTDF-PN-LDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGIVIDAAII
E8K786      ATDF-PN-LDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGVVIDAAII
F8DFF4      TTEF-PN-LDIIESGQIAPNPTGLLQSKNFTMMMEALRRHYDYIIVDTPPIGVVIDAAII
I1ZPH7      TTEF-PN-LDIIESGQIAPNPTGLLQSKNFTMMMEALRRHYDYIIVDTPPIGVVIDAAII
E7S8W3      TTDY-PK-LDVLLSGQVSPNPTGLLQSKNFEVIIEALRNHYDYIIVDTPPIGMVIDAAII
D0RXH2      DTDY-PN-LDVFLSGQVSPNPTGLLQGKNFEVIMGVLREHYDYIVVDTPPIGMVIDAAII
Q83YR5      DTDY-PN-LDVFLSGQVSPNPTGLLQGKNFEVIMGVLREHYDYIVVDTPPIGMVIDAAII
Q8GP54      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVIDAVII
F8HDC3      ETDV-PG-LHVLSSGPVPPNPTSLLQNDNFVQLLEIVRAQYDYVIIDTPPIGLVIDAVII
F8LJ75      ETDV-PG-LHVLSSGPVPPNPTSLLQNDNFVQLLEIVRAQYDYVIIDTPPIGLVIDAVII
E9DM17      RTDI-AS-LDVISSGPVPPNPTSLLQNENFTHLMDVARSQYDYVIIDTPPIGLVIDAVIV
I0QIK6      RTDI-AG-LDVISSGPIPPNPTSLLQNENFTHLLDVARSQYDYVIIDTPPIGLVIDAVIV
E8KUY8      QTNI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMDVARSRYDYVIIDTPPIGLVIDAAII
Q7X553      QTDI-SG-LDVIASGRIPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGMFIDAAII
Q8GP92      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGRVIDAVII
Q7X561      QPYI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVILAVII
Q7X549      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVIDAVII
G6ERT1      QTDI-SG-LDVIASGPIPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGMFIDAAII
O87931      QTDI-SG-LDVIASGPIPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGMFIDAAII
Q8GPF6      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGRVIDAVII
Q7X555      QTDI-SG-LDVISSGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVIDAGII
Q7X557      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVIDAGII
Q7X563      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGRVIDAVII
Q8GMA5      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVIDAVII
Q8GPA8      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVIDAVII
Q55205      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGMVIDAVII
C2LSE6      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVIDAVII
Q7X559      QTNI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVIDAVII
F8LXJ4      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVIDAVII
Q1WCR1      QTDI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVIDAVII
Q8GPC3      QTNI-SG-LDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVIDAVII
E8JMT9      DTSI-DN-LMIIPAGQVPPNPTSLIQNDNFKAMIEIVRGLYDYVIIDTPPLGLVIDAAIL
F5X0J9      DTSI-DN-LMIIPAGQVPPNPTSLIQNDNFKAMIETVRGLYDYVIIDTPPLGLVIDAAIL
H2A602      DTNI-DN-LMIIPAGQVPPNPTSLIQNDNFKAMIEIVRGLYDYVIIDTPPLGLVIDAAIL
E0PD83      DTTI-DN-LMIIPSGQVPPNPTSLIQNDNFKAMIETVRGLYDYVIIDTPPLGLVIDAAIL
F5X652      DTTI-DN-LMIIPAGQVPPNPTSLIQNDNFKVMIETVRGLYDYVIIDTPPLGLVIDAAIL
G5KD11      STNI-DK-LMVIPAGQVPPNPTTLLQNAHFNQMIETLRGIFDYIIIDTPPIGLVIDSAIV
B9DUJ4      HTSV-EN-LMVIPAGQVAPNPTTLLQNNNFNYMIDTLKEVFDYIIIDSPPIGLVIDAAII
G5KAJ2      HTNI-SN-LMIIPAGQVPPNPTTLLQNNNFNYMIDTLREVFDYIIIDTPPIGLVIDSAIV
F1Z124      HTNI-EN-LMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVIDSAII
Q2KM74      RTDV-PN-LMLIPSGQVPPNPTTVLQNSNFNFMIDTVKELFDYIIIDTPPIGLLIDSAII
C6LDI8      QTNI-PY-FHIILSGAAAPNPSELLGNGKFSALLDGAREVYDYIFVDSPPIGSVIDAAVV
D4J4T6      KTNI-KN-MYMAFAGLNAPNPAELLGNPKFKAAIEAMKKSFNYIIVDCAPIGAVIDAAVV
D4LTH2      KTNI-EN-ASIVPCTQLLENPSPLLEDIRFRELLDKLATEYRFVIIDTPPLGSVSDGALI
D4LG06      KTNI-EN-AYIVPCTQLLENPSPLLEDARFRELLDRLAGEYRFVIVDTPPLGSVSDGALI
A7VF42      ETNI-PN-AYIVPCCNLLENPSALLEDARFAELLDKLAEQYRYVIIDSPPLGSVADAAQV
A8SQS8      ETQV-EN-AYIVPCMNLLENPSALLEDARFAEILDKLAETYRYVIIDSPPLGSVADAAQI
D5HFS4      ETQV-EN-AYIVPCMNILENPSALLEDARFAELLDKLAETYRYVIIDSPPLGSVADAAQI
C9LAS1      QTNF-LN-VDIIFAGPMAPNPSELLEEEAFRELLAEVRGYYDYIIIDTPPVGSVIDAAII
F3AH92      QTNF-EN-VDIVFAGPIAPNPSELLSSKEFDDFLKEKKEQYDYIFVDTPPIGSMIDAAVV
I5ASF8      QTNY-DN-LFLIFSGAYASNPSEMLADESFGRLLAASAESFDYVFIDTPPLGQIIDAAQI
E7GL81      TTNI-PN-LDVIFSGPLSPNPAELLEEPLFKKLIDHAREEYAYVIIDTPPMSTIIDGAIV
G5F9E2      TANI-PN-LDVIFSGPLSPNPAELLEEPLFKKLIDHAREEYAYVIIDTPPMSTIIDGAIV
E7GL57      KTNL-PN-LTMIFSGPYSPNPAELLAEPLFDKLVAWARENFDYVIIDTPPMGNLIDGAII
G5F9A9      KTNL-PN-LTMIFSGPYSPNPAELLAEPLFDKLVAWARENFDYVIIDTPPMGNLIDGAII
E7GL40      RTNI-PN-LNIIFSGPFSPNPAELLEGELFTKLIAWARECYDYILIDSPPMGSVIDGAVI
G5F9H2      RTNI-PN-LNIIFSGPFSPNPAELLEGELFTKLIAWARECYDYILIDSPPMGSVIDGAVI
A8RK85      ETDM-EN-LDMVLSGPFSPNPAELLEDELFKTMIESVKEIYDYIIIDTPPMANVIDGAII
G5HTB2      ATDV-EN-FDIILAGPYSPNPAELLEDSLFRELLEKAKERYDYIIIDTPPMANLIDGAII
G5HNC5      GTDV-EN-LDIILAGPYSPNPSELLEDPLFKELLDRARLKYDYIIIDTPPMANLIDGAII
C0CZV9      ATSV-EN-LHMIFSGPYSPNPAELLEEELFGALIRQMRQEYDYLIIDTPPMGNLIDGAIV
A8RSK9      DTNI-EN-LSIIFAGPYSPNPAELLEESLFSDMISKLKEKYDYVIIDTPPMANLIDGAIV
C5EN03      DTNV-EN-LSMVFAGPYSPNPAELLEEDLFGKMIDTLKKEYDYVIIDTPPMANLIDGAIV
G5HG45      DTNV-EN-LSMVFAGPYSPNPAELLEEDLFEQMVQELKKTYDYVIIDTPPMANLIDGAIV
D9ST44      KTKV-SN-LDIAMVGTKANNPSKLISSEKLKNLIEDLKETYDYIIIDTPPVTIATDAQLL
G2Z8Q3      KTSL-YN-VDLISAGQVPHNPSELLSKPILRKLLKEAKDYYDYILVDSPPVI-VADTTII
C8W5K2      NVGI-DG-LKLITTGSVPPNPVELISSNRTKEFISDLAEMFDIVLIDTPPVAPLTDAALM
F5LM71      ET-DIPG-LYVMTCGTVPPNPSEILGSRRMTDLLERLKQEFDVILVDTPPVLAVSDAQVV
D7VBW4      PV--LDH-LFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVIVDAPPILPVTDARIL
F9UQ54      PV--LDH-LFVMPSGPKPPNPAELLASDRMSEFLTVATRKLDLVIVDAPPILPVTDARIL
H6LKR8      KVKDLEK-FEILTAGDRQVSPTELLNSDAFEQLIIACRKEYDIILIDTPPVLNFADASIV
E0I7B5      AT-LVDN-LTVIPSGPVPPNPSELLGSQKMKQLLAELKNQYDMILIDTPPNLAVPDGMII
D7UYE4      DT-GIDN-LHLLTSGPIPPYPSELIGSVNFSLIFEELQKEYDFIVVDTPPVNTVTDAQLF
Q4A120      ST-EVLN-LDVLTSGPIPPNPSELIGSSNMMDLFEELKQRYDFILIDTPPVNTVTDAQLF
D9SVC7      ET-EVDN-LHILCGGKIETNSHQLIGSKKMSKLIDLVENNFDMVIIDGPPILLVTDSQLL
D9S1J9      TT-KVEN-LHVITSGPVPPNPAEVLGSAKMKNFLDEVASLYDMVLIDAPPVNSVADAAIL
C0GGR5      VS-PRPN-LYFLPCGPLPPNPAELLGSKKMRDFITSLEEHFDIILVDAPPALAVTDASVL
C6CSC8      AT-DIPN-MDVITAGPIPPNPAEMLASKRMTALLDELRTMYDIVLVDTPPLLAVTDAQIA
A3ICA3      ET-FVEG-VDIISSGAIPPNPTELLASETMTFLLHEVKEQYDIVMIDAPPLLFLSDAQIL
B1HR41      AT-FVDG-VEIISSGAIPPNPTELLASETMTLLLHEVKERYDIVMIDAPPLLFLSDAQIL
D6Y034      ES-QIEG-VSVLTCGPIPPNPAELLGSKQMDTVLQEAEEMYDYIIIDSPPILAVTDAQLL
Q8EME8      SS-DVEN-LDLISCGPIPPNPSELLGSKRMQFFIEEAKQSYDIVIFDMPPVLAVTDAQVM
F3Y922      PT-NLEN-LNILPSGPIPPNPSELLDSLQMKRLIEEWKNNYDLIIFDTPPILAVTDAQIL
G4L594      KT-AVEN-LSILTSGPKPPNPSELLGSAKMNQIMEEARNIFDIVIFDMSPVVAVTDAQIM
C9B454      RT-PVEN-LSILPSGPKPPNPSELLSSPRMDQILAEARQLFDVVIFDMPPVVAVTDAQIM
Q3XYS6      RT-PVEN-LSILPSGPKPPNPSELLSSPRMDQILAEARQLFDVVIFDMPPVVAVTDAQIM
C9ALZ9      RT-PVDN-LSILPSGPKPPNPSELLSSPRMDQILAEARQLFDVVIFDMPPVVAVTDAQIM
C9BUG7      RT-PVEN-LSILPSGPKPPNPSELLSSPRMDQILSEARQLFDVVIFDMPPVVAVTDAQIM
D4RJF4      RT-PVEN-LSILPSGPKPPNPSELLSSPRMDQILAEARQLFDVVIFDMPPVVAVTDAQIM
C8ZXT9      QT-VIDN-LSILPSGPKPPNPSELLGSSRMNQVMAEAKKLYDIVIFDMPPVVAVTDAQIM
G5IRQ6      QT-VIDN-LSILPSGPKPPNPSELLGSSRMNQVMAEAKKLYDIVIFDMPPVVAVTDAQIM
C9A6V5      KT-VIDN-LSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYDVVIFDMPPVVAVTDAQIM
C9CHY8      KT-VIDN-LSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYDVVIFDMPPVVAVTDAQIM
Q814Z0      TT-SIDN-LSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
B9IRQ6      TT-SVDN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDLIIFDLPPILAVTDAQIM
B7HXB4      TT-SVDN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDLVIFDLPPILAVTDAQIM
Q72XH8      TT-SVDN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDLVIFDLPPILAVTDAQIM
A0RL70      TT-SVDN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIM
Q6HB09      TT-SVDN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIM
F0PU64      TT-SVDN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIM
B7HFH1      KT-SVDN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
B7IQS8      TT-SVDN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
B3ZRD6      TT-SVDN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDLVIFDMPPILAVTDAQIM
B5UQ73      TT-LVDN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
G9QCG3      TT-SVDN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
Q3EV64      TT-SVDN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
Q5WBB4      ET-NVEN-VSLLTCGPIPPNPAELLNSKMMELVLQEAREKFDMVILDTPPVMAVADAQIL
B1YMM5      PT-KVDN-LSILTAGPIPPNPAELLSSKAMETLILKLRDEYDIIVLDAPPLLQVADSRIT
D7WMM8      NT-DIAN-LYVLTSGPIPPNPAELLASTLMGSVMEELKKEFDIIIFDAPPLLSVTDAQIL
A7Z921      KT-LIDN-LYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFDSPPLLAVADGQIL
I2CAF2      KT-LIDN-LYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFDSPPLLAVADGQIL
A7Z9K0      PA-DEAN-LDILTSGPIPPNPAELLSTGAMKDLLSEAAEVYDKVILDTPPVLAVADTKIL
I2CB16      PA-DEAN-LDILTSGPIPPNPAELLSTGAMKDLLSEAAAVYDKVILDTPPVLAVADTKIL
I2HW53      PA-DEAN-LDILTSGPIPPNPAELLSTGAMKDLLSEAAAVYDKVILDTPPVLAVADTKIL
G9QKR4      AT-DVEK-LDLLSSGPIPPNPAELLSSRMMEQMLAEAYKQYDLVIFDSPPVLAVTDAQVL
D5DBK3      ES-EVPN-LYLLTSGPIPPNPAELLSSNQMTELLKEMKQEFDMVIFDTPPILAVADAQIL
D5DY81      ST-EVPN-LYVLTSGPIPPNPSELLASKQMGEVLGEMTERFDMVIFDTPPILAVADAQIL
Q2BFS5      ET-AIEN-LSVLTSGPIPPNPAELLGSQAMEEFLVNVQKEFDVVLFDTPPILAVADAQIL
A4ITF3      DT-SVEN-LTVLTAGPIPPNPAELLSSKMMDRLLRELNEMYDLVIFDTPPVLAVTDAQIL
C5D961      ET-SVEN-LYVLTSGPIPPNPAELLSSKAMEQCIQQLYNEFDLLIFDTPPVLAVTDAQIL
G8MZ93      AT-EIDH-LSILTSGPIPPNPAELLSSNAMAQCLEQLYETFDLVIFDTPPVLAVTDAQIL
C6CW37      DGGI-DN-LEIITSGPTPPNPAELLGSHRMKVILEELRARYDLILFDTPPVLPVTDSLIM
G9RSY9      MKGLG---LHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIFDTPPVSVVTDAAVL
F7K9V1      KTNI-PD-FYVIFSGPVPPNPSELLGNDAFRLLLEYLRKEYDYVIVDTPPLGSVIDGAVA
F7K8E9      KTNI-PN-FYVIFSGPVPPNPSELLGNDAFGLLLEYLRKEYDYVIVDTPPLGSVIDGAVA
F7KL96      KTNI-PN-FYVIFSGPVPPNPSELLGNDAFQLLLEYLKKEYDYVVVDTPPLGSVIDGAVA
B9Y884      --QPYEN-VDVITAGTKIPFASEFIQSNALKEFIEERKKEYDLILLDCPPVGLVTDGIVA
A5Z5P9      -NTPLED-GDIIPNVENIINPSMLLESDKFGNMLNQLAEDYRYVFVDAPPLGLVSDAEKI
F2I6Z7      QYVAEVN-TYVIPAGPIPPNPAELLSSQRMSDLLEDVTAVFDLVIIDAPPLLPVTDAQII
D4YHG7      NYVADAN-IYILAAGPIPPNPSELLGSNRMAELIGELEEMFDLVIFDTPPILAVTDAQVV
C1J9I3      EETFVDN-LSVITSGPIPPNPSELLNSKRMANLLNWARENYDIIVLDTPPVLAVSDVQVL
B1MZT1      HHTRMDT-LDVITSGPVPPNPAELLASARMTTLITQLRDHYDLVIFDVPPFLMVTDAQVL
H1WR06      HHTRMDT-LDVITSGPVPPNPAELLASARMTTLITQLRDHYDLVIFDVPPFLMVTDAQVL
H1X4N2      HHTAMDN-LDVITSGPIPPNPAELLGSGRMTELVTQLKSQYDLIIFDVPPFLMVTDAQVL
Q03W95      HRTSMDN-LNVMPSGPIPPNPAELLGSGRMTNLITQLKTHYDMIIFDVPPFLMVTDAQVL
F0SX22      -TMSNST-ADVILSGDIPPNPSELLASDQMRLLLEQLAKKYDYIFLDSPPINLVTDAVIL
B6W7H4      KDQYEDN-LFVLLSGPVPPNPAEILASNHVKELIEELSQRFDYVFLDTPPVGLFTDASIV
F0GT81      ADTSQDN-LDIILTGPVPPNPAEVLASNVFKKLIEKLSSMYDYVLIDTPPVGLFTDASIV
B1R3X6      I--LNEN-FSVITSGRIPPNPSEILSSKSMENLLKALSVCYDYVILDTPPLTAVTDAQIL
Q8XN76      I--LNEN-FSVITSGRIPPNPSEILSSKSMENLLKALSVCYDYVILDTPPLTAVTDAQIL
B1BNK1      I--LNEN-FSVITSGRIPPNPSEILSSKSMENLLKALSVCYDYVILDTPPLTAVTDAQIL
B1V0N7      I--LNEN-FSVITSGRIPPNPSEILSSKSMENLLKALSVCYDYVILDTPPLTAVTDAQIL
Q0SVR8      K--HESG-LHVLPSGLVPPNPAEMLASRSMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
B1BNH3      K--HESG-LHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
Q8XN46      K--HESG-LHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
B1V1Z4      K--HESG-LHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVADSKIL
G5GFW0      -STNIED-MDIIFSGRFAPNPAELLEEELFIQLIDRASKEYDYIIIDTPPMANVIDSAVI
C2EFR6      -QSNIEN-FSMIFSGPVPPNPSEILDGERFKHLIETVKEKFDIVIIDTPPMGSVIDAAVI
F3ATF5      -RTNYEN-MDIIFSGSFAPNPSELLGQEAFGTLLGAVREHYDYIIVDTPPIGSIIDAAIV
D4M2S0      -STNYRN-LEIIFSGPYAPNPSELLEQGRFGRLIEETRKVYDYILIDTPPIISMSDAAIA
F4BS19      HKTSQEN-LELLTSGILPPNPSELLASQRMSQFIETVKQEYDLIVFDLPPVNVVTDAQVM
D4CG08      -TTDIQG-MDIIFAGPYSPNPSELLAEPLFKELILKKREEYDYILIDTPPMAGITDGAII
D4MP30      -TTDIQG-MDIIFAGPYSPNPSELLAEPLFKELILKKREEYDYILIDTPPMAGITDGAII
C6LCS5      -TTNYPS-LHIIFPGPEPPNPAELLGSEAFSDMLGHMRENYDYVIIDTPPLGNVIDSAVI
B0P2G2      -ETEVEG-LCITVAGPLTPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVIDAVII
D4MW29      -ETEVEG-LCITVAGPLTPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVIDAVII
E5VMX8      -ETEVEG-LCITVAGPLSPDPTSILDSEQFEQFIEKVRDMFDYVIIDTPPLGIVIDAVII
D4JMC2      -ATNIKG-VFILFAGHEVPNPTELLETKEFKELIEFGEKNFDYVLVDTPPTGAAIDAAVV
D6E0V4      -ATNIKG-VFILFAGHEVPNPTELLETKEFKELIEFGEKNFDYVLVDTPPTGAAIDAAVV
D6E330      -GTEIPG-LFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPIGAAIDAAVV
C4Z8M5      -GTEIPG-LFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPIGAAIDAAVV
D4JI67      -GTEIPG-LFMIFAGPSVPNPTEILEKKYFQEILNFGKEHFNYIIIDCAPIGAAIDAAVV
D3AC80      -NTDINN-MDMIFAGPVSPNPTELLSGDLFAELIQKAREEYDYVIIDAPPLGSVIDAALI
G5IFS3      -NTNIPG-MDIIIAGPVSPNPTELLSGRLFEQLLQSERDNYDYIIVDAPPLGSVIDAAII
D4RX67      -TTNVEN-LDMILSGPVPPNPAELLGGKLLKEMITRLKKVYDYIIIDTPPLGNVVDSAII
A6BIG7      -KTQDSN-LHMIFAGAIPPNPAELLNSRRFQALLASARKLYDYVIIDAPPLGSVIDAAVI
C0C0F8      -KTQEPG-LMVIFSGVVPPNPAELLGNKRFSSFITSARKIYDYIIIDAPPLGSVIDSAIA
Q97EP8      --WYNQN-LCILTAGKIPPNPAEMLSSKRMKAFLNEAKGVFKYIILDAPPVIAVTDPQIL
Q97ER5      --WYSKN-LCILTAGKIPPNPAEMLASKRMKAFLAEARGVFKYIILDAPPVIAVTDPQIL
D2RIR2      -PNVFRN-LDVLTSGPVPPNPSELIGSEKMEQLLDRAGNAYDYVLIDLPPVLAVTDAALL
G0VNK6      -ADVFPN-LDVVTSGPVPPNPAELLGSKKMEALLQEAAETYDYVFLDMPPVLAVTDAALM
I0GRR2      -NNVIQN-LDVLPSGPVPPNPSEMLGSERMDNLLKTVGENYDYVFIDMPPILAVTDATII
A0PZ02      --NYNEN-LYLLPAGTIPPNPAEMVASKKMKKFLESLKENFDYIVIDTPPVIAVTDAQIL
B1B736      --KYNEN-LYLLPAGTIPPNPAEMVASKTMRNFLESLKETFDYIVLDTPPVIAVTDAQIL
F6BI62      SDKEFDN-LGIITSGPIPPNPSELIGSNRMKVFLDRLKEDYDYVLLDAPPVLLVTDPTVL
Q8RBS5      VDNSYDN-LHILTSGPLPPNPTELLGSNKMKKLISLIRENYDYLFIDSPPVVTVTDAVVL
G2MWC2      IDNSYNN-LHILTSGPIPPNPAELLGSNKMKKLLSNIQKDYDYVFIDSPPVVTVTDAVVL
B0K4N1      VDTSYSN-LHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTVTDAVVL
B0KAR5      VDTSYSN-LHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTVTDAVVL
E8UV29      VDTSYSN-LHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTVTDAVVL
C7ISF7      VDTSYSN-LHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTVTDAVIL
C9AAE5      QVILEDCEFSIITSGAIMSNPNDLLASSKMTAALQEVKQRYDVIIIDTPPVNVVSDALIL
H7F6C8      EVELRASTLSILTSGPIPPNPNDLLSSKKMSELIEALRDSFDKIIIDTPPVTIVSDALVL
H7F5T6      PVTD-TN-LYVLPVGARPLSPYSILNSAKLGQLIEQLKEIFDMIIIDTPPVMMVKDALLV
B1R3V1      KHE--SG-LHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
D4YF13      YSED-FD-LYILPSGPIPPNPAELVGSQEFSVLLDQITELFDLVIFDTPPLHSVTDGQII
E6U7N4      YLSD-LN-LYVMTSGPIPPNPAELIGSDRMQHLIRRLEEKFDYILIDTPPVSVVTDAALA
C8VYQ6      DVGI-EG-LKLLPTGPTPPNPSELLGSQRMKNFIAELYEVFDIILVDTPPVVPVTDAALM
D3AE78      RTNI-DN-MDVIFAGPSTPNPAELLGNAKFEEMLRGAREHYDYVLIDSPPLGSVIDAAII
A4J8V0      PSPM-KN-LHIVTTGPIPPNPAELLGSQRMTALLTSFREHADIIIIDSPPIIAVTDAALL
A8U9F4      RLET-EG-LFVITSGAIPPNPSELLASNRMNKLITEFEELFDLIIFDMPPVIAVTDAQVM
F4BSD9      RLDT-EG-LFVITSGVIPPNPSELLASNRMNQLMSEFEELFDLIIFDMPPVIAVTDAQVM
F7V792      ATKT-EG-AHIIPNLNNVVNPSILFEGDRMKSLLDELTKTHRYVFVDTPPLELASDGQLL
F6IR93      PV-L-AH-LFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPVLPVTDARIL
G0M0F9      PA-L-AH-LFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPVLPVTDARIL
F6ITB4      PV-I-GN-LFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLVIVDAPPILPVTDSQLL
G0M1X9      PV-I-GN-LFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLVIVDAPPILPVTDSQLL
G0LYN9      PV-I-GN-LFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLVIVDAPPILPVTDSQLL
D7VC13      PV-I-GN-LFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLVIVDAPPILPVTDSQLL
F9UMZ6      PV-I-GN-LFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLVIVDAPPILPVTDSQLL
I5AV01      ATDI-PN-FFMIYSGPFPPNPTELLGGKIFHSMLDSLRKVFDYIIIDTPPLGSVIDSAVI
B0GAL3      GTNY-EN-MDVIFAGPMAPNPSELLNGKVFAKLMIELKQRYDYVLIDTPPMANVVDAAIV
G1WUK2      GTNY-EN-VDMIFAGPMAPNPSELLNGRVFAKLMGELKQRYDYVLIDTPPMASVVDAAIV
E0RZL3      ETDT-PN-LYVIFSGPVPPNPSELLGGRIFSKALENMKQVFDYIIVDTPPLGSVIDAAVV
D8FLF8      ESGV-EN-LSILTAGPIPPNPSELLSSKHMLDLIEDLKQEYDMVVIDLAPILDAAETQQL
F0K0J7      ESGV-EN-LSILTAGPIPPNPSELLSSKHMLDLIEDLKQEYDMVVLDLAPILDAGETQQL
Q1G8E4      ESGV-EN-LSILTAGPIPPNPSELLSSKHMLDLIEDLKQEYDMVVLDLAPILDAGETQQL
C4VP08      ESGI-EN-LSILTAGPIPPNPAELMGSKRMKTFIDFIKSYYEMVIIDLAPILEVSDTQEL
D6S4X4      DSGI-EN-LSILTAGPIPPNPAELVGSKRMKTFIDLVRNYYEMVIIDLAPILEVSDTQEL
D0DJH0      ESGI-DN-LSILTSGPIPPNPAELIGSRRMETFIELVKSHYDMVIIDLPPVLEVSDTQEL
C7XKF3      ESGI-DN-LSILTSGPIPPNPAELIGSRRMETFIELVKSHYDMVIIDLAPVLEVSDTQEL
E3R264      ESGI-DN-LSILTSGPIPPNPAELIGSRRMETFIELVKSHYDMVIIDLAPVLEVSDTQEL
D5GZJ8      ESGI-EN-LSILTSGPIPPNPAELIGSRRMETFIELVKSHYDMVIIDLAPVLEVSDTQEL
C2EPK5      DSGV-KN-LSVLTAGPMPPNPSELISSKRMHDFIDLTEEHYDLVIIDLAPVLEVSDTQSL
A4ZGZ8      ESGI-DD-LAILTAGPTPPNPSELIGSKRMQDFISLVEDHYDMVIIDLAPVIEVSDTQEL
A8YX89      ESGI-DD-LAILTAGPTPPNPSELIGSKRMQDFISLVEDHYDMVIIDLAPVIEVSDTQEL
F0NWJ7      ESGI-DD-LAILTAGPTPPNPSELIGSKRMQDFISLVEDHYDMVIIDMAPVLEVSDTQEL
E4SMV5      ESGV-DN-LYVLTAGPMPPNPAELIGSKRMRDFVKLTEERYDLVIIDLAPVLEVSDTQEL
F0TGY2      ESGV-DN-LYVLTAGPMPPNPAELIGSKRMRDFVKLTEERYDLVIIDLAPVLEVSDTQEL
Q5FIC7      ESGV-DN-LYVLTAGPMPPNPAELIGSKRMRDFVKLTEEHYDLVIIDLAPVLEVSDTQEL
F2M2M6      ESGV-DN-LYVLTAGPMPPNPAELIGSKRMRDFVKLTEERYDLVVIDLAPVLEVSDTQEL
G7M0Q3      GYN--EK-LFVLTSGKIPPNPSEMLASLAMTYLIEKLKQDYDMIILDTAPLNLVTDAQIL
G7M1R9      KRN--DN-LDILTSGKIPPNPSEMLSSSSMTKLIEALRERYDIVILDSAPLQAVTDAQIL
A6M2L9      KRN--DN-FYFLTSGKIPPNPSEMLSSSAMSNLIERLKVEFNIVVLDTAPLKAVTDAQIL
G7M566      KRN--DN-LYFLTSGKIPPNPSEMLASSAMSNLIEELKKRYDFVVLDTAPIKAVTDAQIL
G2KUP1      KTDV-DN-LDVMVGGPVPPNPAELIGSDRFKNLLNTLSKDYEWVLIDTPPVNSATDASLI
G8PE06      ETPI-KD-LSIMTSGPIPPNPSELLGSERMGEIMKSLSEKFDVVIIDAPPVNTVTDAQVL
Q03GL8      ETII-NN-LSVMPSGPIPPNPSELLGSGKMAALLDQLTDHYDLVIIDAPPVNTVTDAQVL
E0NHP4      STVV-EN-LSVMPSGPIPPNPSELLGSPKMVNLLGVLTTKFDLVIIDAPPVNTVTDAQVL
F4FXQ7      KTEI-DN-LSVITSGPIPPNPSDLLASNRMKELISYFKKIYDVIILDVPPLLSVTDTQII
C0WV35      KTEI-DN-LSVITSGPIPPNPSDLLASNRMKELISYFKKIYDVIILDVPPLLSVTDTQII
H1LCW3      KTEI-DN-LSVITSGPIPPNPSDLLASNRMKELISYFKKIYDVIILDVPPLLSVTDTQII
C2JZS1      DTFV-DN-LSVITSGPIPPNPSELLNSKRMGQLLDWTREKFDIIVLDAPPVLAVSDVQVL
Q58Z10      ETFV-DN-MSIITSGPVPPNPSELLNSKRMAGLLEWAREKYDIIVLDAPPVLAVSDVQVL
E9SAU1      ADVI-EN-LDVVTCGPIPPNPSELMGSDNMKMLLEQLAAHYDYIIIDTPPINIVTDALTL
Q38VG5      KTPV-EH-LFVLPCGVVPPNPSELLNTKKMDKLIVELTKHFDLVIFDAPPVISVTDAQIL
F0HVF1      KSGV-EN-LSILTAGPIPPNPSELLSSKHMLDLIEDLKQEYDMVVLDLAPILDAAETQQL
G6F8G9      ESGV-EN-LSILTAGPIPPNPSELLSSKHMLDLIEDLKQEYDMVVLDLAPILDAGETQQL
C2EWM3      ETEI-DN-LSILTSGPIPPNPAELLNSQRMQALIASVEQSYDVVILDVPPILAVSDTQAL
F8DRU2      PSGV-NN-LDILTAGPIPPNPAELLNSQRMKTLLDTVKGIYDMVIVDVPPMLEVTDTQIL
B3XL23      PSGV-DN-LDILTAGPIPPNPAELLNSQRMRTLLDTVKGIYDMVIVDVPPMLEVTDTQIL
F8KGP1      PSGV-DN-LDILTAGPIPPNPAELLNSQRMKTLLDTVKGIYDMVIVDVPPMLEVTDTQIL
H4GK03      ATEV-PN-LDVLTVGPVPPNATGLLNSQRMRDLVATFEQMYDVVIIDVPPILEVNDTQVL
B2GF33      KSGV-EN-LEVLTAGPVPPNPSELLGSQRMKSLINGVRDAYDLVVLDVPPMLQVTDTQVL
C0WW26      KSGV-EN-LEVLTAGPVPPNPSELLGSQRMQSFINGVREAYDIVVLDVPPMLQVTDTQVL
D0DSJ4      KSGV-EN-LEVLTAGPVPPNPSELLSSQRMQSLIKGVREAYDLVVLDVPPMLQVTDTQVL
C0ZHV8      PSGV-SE-LSIITAGPIPHNPAEMLGTPRLLELMDYLRHSYDFVIVDSPPLI-VSDAMVL
H1BJT1      VTDCENA-ISVLTSGSKVPNPQELLGSSKFKKLLQALSKQYDFIILDCPPISMISDTFYV
F8FCE2      ETHI-PH-LEMLSAGVIPHNPSELLSSERWVQFIEFAKNKYDVVIIDTPPALSLPDAQLV
H6NE43      ETHI-PH-LEMLSAGVIPHNPSELLSSERWVQFIEFAKNKYDVVIIDTPPALSLPDAQLV
I0BSG4      ETHI-PH-LEMLSAGVIPHNPSELLSSERWVQFIEFAKNKYDVVIIDTPPALSLPDAQLV
Q83VF9      GTRLSEN-LTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLIDTPPLSAVTDAQIL
G8P3D7      GTRISEN-LTIITSGPIPPNPSELLASSAMKDLIDSVSDFFDVVLIDTPPLSAVADAQIL
O06030      GTRLSEN-LTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLIDIPPLSAVTDAQIL
G9M880      GTRLSEN-LTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLIDTPPLSAVTDAQIL
G6FD42      GTRLSEN-LTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLIDTPPLSAVTDAQIL
F9VC44      GTRLSEN-LTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLIDTPPLSAVTDAQIL
A9QSJ4      GTRLSEN-LTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLIDTPPLSAVTDAQIL
Q3ZK50      GTRLSEN-LTIITSGPIPPNPSELLASSAMKNLIDSVSDSFDVVLIDAPPLYAVTDAQIL
E3GPC6      TTDV-EN-LFMISSGPIPPNPSEILASKRLIELINQFKLAFDYILIDAPPVGVVTDAAVL
G0V447      RIN--DN-LYVLTSGILPPNPAEMLSSSKFKSFIENLRQSFDVIILDTPPVIAVTDAQVL
H7F1R7      QTAI-EN-LDILTSGTLPPNPNELLASKKMGQILEELASCYDQIIIDTPPILASSDALVL
E6UHY4      HNVI-DN-LDIVTCGPIPPNPSEMLGSDNMKQLLDQLSAHYDYIIIDTPPINIVTDCLTL
D9QTC6      KTNI-EG-ISLISGGNVPPNPAELLGSQKMEEVIKQAENKADIVLIDSPPVIAVTDSRLL
D9SR41      KSEV-RN-LYILASGPIPPNPSELLGSKKMQNLLDLLKSKFDMVIIDTPPVLAVTDSQIL
P95696      STEI-EN-LDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLY
Q2G1K7      STEI-EN-LDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLY
A8YPQ5      STEI-ED-LDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLF
Q2FUV2      STEI-QD-LDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLF
P39851      ETRV-EN-LNVLTAGPTPPNPSELIASSKFATIFNELLNHYDFIVIDTPPINTVTDAQVY
C5QNG4      STRV-PN-LDLLTSGPIPPNPSELIDSDRFYEIYNELLRRYDFVLIDTPPVNTVTDAQVF
Q4L9H7      STRV-EN-LDLLTSGPIPPNPSELIASEKFENILNDLFKYYDFILIDTPPVNTVTDAQVF
E4Q5T5      KDGV-EG-LDLITSGPIPPNPAELLGSKKFENFLNTISQSYDYIIIDTPPCGSLTDAAII
E4SDX4      KDGV-EG-LDLITSGPIPPNPAELLGSKKFENFLNTISQSYDYIIIDTPPCGSLTDAAII
E4S7Y6      KDGI-EN-LDLLTSGPIPPNPAELLGSKKFENFLSYVRERYDYVIIDTPPCGSITDAAIV
C6CS80      ETRI-KG-LDVLPSGPVPPNPSELLGSSRMEELLGKLREQYDMVLIDTPPVLAVADAQVV
E6LD64      ASVV-PN-LSLLTSGPKPPNPSELLSTARMDQLIRELRGAFDLVIFDMPPIVQVTDAQIM
F0EKB9      KTVI-DN-LSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYDVVIFDMPPVVAVTDAQIM
H7F571      ETEI-DN-LFVLTSGTIPPNPNELLASKKMGKFMQQFIQDFDQVIVDTPPILASSDALVI
F5LE48      PSHL-PN-LYLIPSGPSTPNPAEMLASKRMTQFIEQAKAEYDIVLIDSPPILAVTDAQIL
E7RDR3      ATAV-ER-LDLMTCGPIPPNPAELLASKSMDTLIAQLKNTYDLIIFDAPPVLSVTDGQIL
E7RG08      ASGI-EN-LDLLPSGPIPPNPAELLGSSNMDLLFESALDTYDMIIFDSPPVLSVTDSVIL
F6CNF5      NGLV-EN-LTLVTSGPIPPNPAELLGSGRVRALWPALLERFDYLIIDSPPVLAVTDAALL
G2FWX4      ETSV-PG-VMVLTAGPVPLNPAELIGTVRMKQLVKEVSELYDMVLFDTPPIIAVTDGSIL
G2FM59      ETDV-PG-VMVLPAGPVPPNPAELVGSKRMKLLIEEVSEQFDMILIDTPPVIAVTDAAIL
G7WJV1      DTAV-PS-VRVLPAGPVPPNPAELLGSKGMEHLLEGAGGEFDMVLIDTPPVIAVTDALIL
H5XZD4      ETVV-PG-VRVLPAGPVPPNPAELVGSKRMKCLIEEVSGEFDMVLMDTPPVIAVTDAAIL
H5XZG7      ETEV-PG-VSVLPGGPIPPNPAELVGSKRMKHLIEELSGQFDVVIIDTPPIIAVTDAAII
G7W773      ETAV-PR-VKVLTGGPIPPNPAELVGSQRMKRLIEEVSELYDVVLIDTPPIIAVTDAAVL
G2FWT8      ETAV-PG-VMVLTGGPIPPNPAELVGSKRMKRLIEEFSEQFDTVLIDTPPIIAVTDAAII
I4DBG8      ETSV-SG-LRVITGGPIPPNPAELVGSKRMKRLIEEASEQFDMVLIDTPPVVAVTDASIL
C0EBA6      EDVR-EN-LDLITSGPIPPNPTELLSSSKMRELLEELNKTYEYIILDTPPINIVSDALAL
Q9K6R0      ETKV-EN-LSLLTSGPIPPNPAELLNSKMMELIIKEVRDQFDIVIIDSPPLNAVTDAQIL
I2HVL2      KTLI-DN-LYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFDSPPLLAVADGQIL
D4G1R2      KTPI-DN-LYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIFDSPPLLAVADAQIL
G4EQZ7      KTPI-DN-LYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIFDSPPLLAVADAQIL
P71051      KTPI-DN-LYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIFDSPPLLAVADAQIL
E0U2Z3      KTPI-DN-LYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIFDSPPLLAVADAQIL
G4P114      KTPI-DN-LYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIFDSPPLLAVADAQIL
A9VRC3      TTLV-DN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVVFDLPPILAVTDAQIM
C2QJY5      MTSV-DN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIM
C2RG49      TTSI-DN-LSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
C2T8T6      TTSI-DN-LSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
C2MTG3      TTSV-EN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDLVIFDLPPILAVTDAQIM
C2SSX8      TTSV-DN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIM
C2YZB2      ATLV-DN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDLVIFDLPPILAVTDAQIM
C3GBJ8      TTSV-DN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIM
C2SBU4      TTSV-DN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDLVIFDLPPILAVTDAQIM
C2NQN6      TTSV-DN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIM
C3GRR0      TTSV-DN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDLVIFDMPPILAVTDAQIM
C2PN22      TTSV-DN-LHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIM
C2Y452      TTLV-DN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDLPPILAVTDAQIM
C2WVG6      TTLV-DN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
C3EBC0      TTLV-DN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
C2XJH9      TTLV-DN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
C2P8H3      TTSV-DN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
C2ULR6      TTSV-DN-LHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
C2V4M2      TTSV-DN-LSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDLPPILAVTDAQIM
C3H979      TTSI-DN-LSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIM
G2TR25      KTDV-DH-LHVLTSGPIPPNPAELLSSKAMKEFFKEAKEQYDIILLDTPPVLAVTDAQVL
P96716      ASNE-KH-LDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVADAQIL
G4EQF3      ASNE-KH-LDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVADAQIL
D4G2E1      ASNE-KH-LDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVADAQIL
I0F9R6      ASNE-KH-LDVLTSGPIPPNPAELLSSKWMKELADEASVAYDMVIFDTPPILAVADAQIL
E0TTZ6      ASNE-KY-LDVLTSGPIPPNPAELLSSKWMKELADEACAAYDMVIFDTPPILAVADAQIL
G4P1M7      ASNA-TH-LDVLTSGPIPPNPAELLSSKWMNELADEVCAAYDMVIFDTPPILAVADAQIL
A8FHL9      PTPI-EH-LELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYEMVIVDSAPLLPVADAKIL
Q5KUM5      ATEI-DH-LSILTSGPIPPNPAELLSSNAMAQCLEQLYETFDLVIFDTPPVLAVTDAQIL
D3FZP4      ETKV-EE-LHVLTCGPIPPNPSELLSSKAMADLLEDAFQYYDYVLLDTPPTLAVTDAQIL
I0JRK4      ESRV-EN-LDLLPSGPIPPNPSELLGSTMMEKLIEEAKEHYDMIIFDTPPVLAVADSQVL
I3EBB3      QTDE-KK-LYVLPSGPIPPNPAELLGSKAMDEFLERVYEEFDVVLFDTPPILAVTDAQIM
                                .  ..                  :..* .*          

E3CP62      AHQADASILVTAAGKIKRRFVAKAVEQL-EQSSPQFLGVVLNKVDMT-------------
C2KHF1      MSKVDGVAIVVNGGKINKGALKRTNEIL-KIAEAPVLGFIYNDQSRR-------------
G9WIQ9      IPRSDGVVLVATLGKTKKKSLLEAAHIL-TLARAHLLGLVSRDPERA-------------
A0NKF6      IPRADGVVLVAMLNKTRRRSMATAANIL-KLAKANVLGVVSRDQRRA-------------
Q04DV8      IPRADGVVLVAMLDKTKRRSMATAAHIL-KLAKANVLGVVSRDQRRA-------------
D3LB10      IPRSDGIVLTAMLGKTKRKSMASAAHIL-KLAKANVLGVVSRDPHRA-------------
B8D0N2      AASVDGVILVVSIGESNKRGFRDGLKML-ENAEANLLGIVANKIPHKQK-----------
F2I4B7      SARVDGTVVVVPYGQCTKDEVKESQALL-DKVNTNVLGVIMNRTERT-------------
C2CI44      STLCDGVIFVIKSSDTKKEDITLALDNL-KKVDAHILGAVLTYVPMK-------------
C7RGH6      STISDGVIFVIKSSDTKKEDISLAIENL-KKVDAHILGAVLTHMPMK-------------
C0CK73      SRQVDGTLLVVRNDFVKTKAVKKVKQQI-EQNGGRVLGVALNRIKKN-------------
Q1WTC8      AKNCDGGIIVINSGQASYRQIRKTKEQL-ERADSKIIGCVLNKVDAS-------------
E8JWI5      AKVCDASLLVVSTNEVKRKMVQKSKTQL-EQSSTPFLGVVLNKYNVQ-------------
F3AHH0      AEECDGAILVIEAGVISHRFAQEVKGQL-DKTNCPVLGVVLNKVDMS-------------
F7K0U1      ARVCDASVLVISANAISHKFARVVKEQL-ERSECPILGVVLNKVDMS-------------
C4Z672      SKFCDGGILVIGAGDISYKFARKSKEQL-DLVGCKILGCVLNKVDMA-------------
P0C0T9      ASACDGFVLVTQAGRIKRNYVEKAKEQM-EQSGSKFLGIILNKVNES-------------
Q04663      ANACDGFILVTQAGRIKRNYVEKAKEQM-EQSGSKFLGIILNKVNES-------------
Q67AY4      ANACDGFILVTQAGRIKRNYVEKAKEQM-EQSGSKFLGIILNKVNES-------------
Q3K0T0      ANACDGFILVTQAGRIKRNYVEKAKEQM-EQSGSKFLGIILNKVSES-------------
C5NWJ8      APKTDGVVLLVEANRVKKKSIEKAKEQL-EKGGAEFLGVILNKVNSN-------------
F3A499      APKTDGVILLVEANRVKKKSIEKAKEQL-EKGGAEFLGVILNKVNSN-------------
Q4JZ55      AQQCDGIFLVTEMRKTTRRQIFSSLQQL-EQTGVPVLGLVANKAIIK-------------
G5JTD5      AQDCDASVLITEAGVIRSRFVKKAIEQM-EKSGAQFLGVILNKVDEK-------------
G3G7C1      AQKCDAMVLVAGAGHVKRSAVKKVKEQL-EQTGTQFLGVILNKYDIA-------------
G3G7J9      AQKCDAMVLVAGAGHVKRSAVKKVKEQL-EQTGTQFLGVILNKYDIA-------------
G3G7G6      AQKCDAMVAVVEAGNVRRSAVKKVKEQL-EQTGTPFLGVILNKYDVV-------------
G8DUB0      AQKCDAMVLVAEAGNVKRSSLKKVKEQL-DQTGTPFLGVILNKYDIA-------------
G3G7I8      AQKCDAMVAVVEAGYVKRSSLKKVKEQL-DQTGTPFLGVILNKYDIA-------------
G3G7J4      AQKCDAMVAVVEAGNVKRSSLKKVKEQL-DQTGTPFLGVILNKYDIA-------------
G7SG34      AQKCDAMVLVAEAGNVKRSSLKKVKEQL-DQTGTPFLGVILNKYDIA-------------
G8DTZ0      AQKCDAMVLVAEAGNVKRSSLKKVKEQL-DQTGTPFLGVILNKYDIA-------------
G8DU07      AQKCDAMVLVAEAGNVKRSSLKKVKEQL-DQTGTPFLGVILNKYDIA-------------
A4VTU3      AQKCDAMVAVVEAGNVKCSSLKKVKEQL-EKTGTPFLGVILNKYDIA-------------
G7SNU6      AQKCDAMVAVVEAGSVKCSSLKKVKEQL-DQTGTPFLGVILNKYDIA-------------
G8DU31      AQKCDAMVAVVEAGSVKCSSLKKVKEQL-DQTGTPFLGVILNKYDIA-------------
D5AGQ5      AQKCDAMVAVVEAGNVKCSSLKKVKEQL-EQTGTPFLGVILNKYDIA-------------
Q9X4U7      AQKCDAMVAVVEAGNVKCSSLKKVKEQL-EQTGTPFLGVILNKYDIA-------------
A3CQY2      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
E8KLY9      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
F0FHA8      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
F0I4H5      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
F0IAY3      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
F0IJI2      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
F0IS53      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
F2C9N0      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
F2CH53      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
F3SM32      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
F3UDW7      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
F3UNJ4      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTPFLGVVLNKYNID-------------
F0FQQ5      AQKCDASFLVTQAGHIKRKAVMKAKEQL-EQTGTSFLGVVLNKYNID-------------
D6R2T8      AQKCDASLLVTEAGAVKRKAVAKAKEQL-AQTGTPFLGVVLNKFNVQ-------------
F3UUQ2      AQKCDASLLVTEAGAVKRKAVAKAKEQL-AQTGTPFLGVVLNKFNVQ-------------
E6IZC2      AQKCDASVLVVESGNVKRKTLQKAKEQL-EQTGTPFLGVILNKYDTQ-------------
G6A745      AQKCDASALVVESGNVKRKALQKAKEQL-EQTGTPFLGVILNKYDTQ-------------
A8AZR3      SQKCDASILVAEAGSVKRKALQKSKEQL-EQTGTPFLGVVLNKYDVS-------------
F9HJP6      SQKCDASILVAESGSVKRKALQKAKEQL-EQTSTPFLGVILNKYDVS-------------
Q4JYT9      TQKCDASILVTAARETKRRDILKAKEQL-EQTGVPFLGVVLNKFNTE-------------
Q4JZY1      TQKCDASILVTAARETKRRDILKAKEQL-EQTGVPFLGVILNKFNTE-------------
E1LQJ7      TQKCDASILVTATGETKRRDVLKAKEQL-EQTGTPFLGVVLNKFNIE-------------
F9HC65      TQKCDASILVTAAGETKRRDILKAKEQL-EQTGTPFLGVVLNKFNTE-------------
E1LPE7      VQKCDASILVVESGAAKRREVQKAKSQL-EQAGKPFLGVVLNKFDVQ-------------
F9MJW5      VQKCDASILVVESGAAKRREVQKAKSQL-EQAGKPFLGVVLNKFDVQ-------------
E8KDN2      AQKCDASILVTEASVTKRREVQKAKTQL-EQTGTPFLGVILNKFNIH-------------
E8K322      VQKCDASILVTEASATKRREVQKAKDQL-EQTGTPFLGVILNKFNIQ-------------
F9PEU4      VQKCDASILVTEASATKRREVQKAKDQL-EQTGTPFLGVILNKFNIQ-------------
F9PZP7      VQKCDASILVTEASATKRREVQKAKDQL-EQTGTPFLGVILNKFNIK-------------
C1CBD1      TQKCDASILVTATGEVNKRDVPKAKQQL-EQTGKLFLGVVLNKFNVQ-------------
Q7WVX0      TQKCDASILVTATGEVNKRDVPKAKQQL-EQTGKLFLGVVLNKFNVQ-------------
P96475      TQKCDASILITATGEANKRDVQKAKQQL-EQTGELFLGVVLNKLDIS-------------
Q9AHD2      TQKCDASILVTATGEANKRDIQKAKQQL-KQTGKLFLGVVLNKLDIS-------------
Q4K2Q7      TQKCDASILVTATGEVNKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
Q4K0T5      TQKCDASILVTATGEVNKRDVQKAKQQL-EQTEKLFLGVILNKFDVQ-------------
Q4K0E1      TQKCDASILITATGEANKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
Q9AH95      TQKCDASILITATGEVNKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
Q4K1M4      TQKCDASILVTATGEVNKRDVQKAKQQL-EQTGKLFLGVILNKFDVQ-------------
Q4JZ18      TQKCDASILVTATGEVNKRDAQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
Q54520      TQKCDASILVTATGEVNKRDVQKAKQQL-EQTGKLFLGVVFNKLDIS-------------
Q4JYH5      TQKCDAFILVTATGDVNKRDVQKAKQQL-EQAGKLFLGVVLNKLDIS-------------
Q4K0V2      TQKCDASILVTATGEVNKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
A5M4L1      TQKCDASILVTATGEANKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
B2ILP5      TQKCDASILVTATGEANKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
C1CCB9      TQKCDASILVTATGEANKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
Q4K1S7      TQKCDASILVTATGEANKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
P72512      TQKCDASILVTATGEANKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
Q4JZ84      TQKCDASILVTATGEVNKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
Q4K0X5      TQKCDASILVTATGEVNKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
Q4K0Z6      TQKCDASILVTATGEVNKRDVQKAKQQL-EQTGKLFLGVVLNKLDIS-------------
Q4K195      TQKCDASILVTATGETNKRDVQKAKQQL-KQTGKLFLGVVLNKLDIS-------------
Q4K0A0      TQKCDASILVTATGEANKRDVQKVKQQL-EQTGKLFLGVVLNKLDIS-------------
Q4K0K2      TQKCDASILVTATGEANKRDVQKAKQQL-KQTGKLFLGVVLNKLDIS-------------
Q4K1F9      TQKCDASILVTATGEANKRDVQKAQQQL-KQTGKLFLGVVFNKLDIS-------------
Q4K045      TRKCDASILVTEAGGVNRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
G6C7Z1      TQKCDASILVTAAGETNRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
D2ERX8      TRKCDASILVTAAGETNRRDIQKAKEQL-EQTGKPFLGVVLNKFDTS-------------
F9LZC4      TRKCDASILVTAAGETNRRDIQKAKEQL-EQTGKPFLGVVLNKFDTS-------------
F9P1W8      TRKCDASILVTAAGETNRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
I0J9C9      TQKCDASILVTEVGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
A6YIA8      TRKCDAFYFMDEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q4K005      TRKCDASILVTEAGEVNRRDIQKAKEQL-EHTGKPFLGIVLNKFDTS-------------
Q4JZL7      TRNCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGIVLNKFDTS-------------
E5F5C5      TRNCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGIVLNKFDTS-------------
Q4JZG7      TRNCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGIVLNKFDTS-------------
Q4JZK1      TRNCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGIVLNKFDTS-------------
A5LJS0      TRKCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q9AHB7      TRKCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q4K1B7      TRNCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q4JYK8      TRKCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNRFDTS-------------
Q4K0M3      TRKCDASILVTEVDEVNRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q9AHA4      TRKCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q9X9A1      TRKCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q9ZII6      TRKCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q8KWQ0      TRKCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGIVLNKFDTS-------------
Q4JZW7      TRKCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q4JYX9      TRKCDASILVTEAGEITRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q4K0R7      TRKCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q4K1K6      TRKCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q4JZS3      TRKCDASILVTEAGEINRRDIQKAKEQL-EHTGKPFLGVVLNKFDTS-------------
Q4K0I2      MQKCDASILVTKAGETKRRELQKAKEQL-EQTGKSCLGVVLNKFDTS-------------
Q4K254      MQKCDASILVTKAGETKRRDLQKAKEQL-EQTGKSCLGVVLNKFDTS-------------
Q4K237      MQKCDASILVTKAGETKRRDLQKAKEQL-EQTGKSCLGVVLNKFDTS-------------
B1I967      MQKCDASILVTKAGETKRRDLQKAKEQL-EQTGKSCLGVVLNKLDTS-------------
G6J8A4      MQKCDASILVTKAGETKRRDLQKAKEQL-EQTGKSCLGVVLNKLDTS-------------
G6LKG5      MQKCDASILVTKAGETKRRDLQKAKEQL-EQTGKSCLGVVLNKLDTS-------------
Q9ZFT8      MQKCDASILVTKAGETKRRDLQKAKEQL-EQTGKSCLGVVLNKLDTS-------------
D6ZQI8      MQKCDASILVTKAGETKRRDLQKAKEQL-EQTGKSCLGVVLNKLDTS-------------
Q4K2A8      MQKCDASILVTKAGETKRRDIQKAKEQL-EQTGKPCLGVVLNKFDTS-------------
Q8VU31      TQKCDASILVTKAGETKRRDIQKAKEQI-EQTGKPCLGVVLNKFDTS-------------
Q4K2E1      TQKCDASVLITAVGEVHRRDVQKAKEHL-EQTGKPFLGVVLSKLNTS-------------
Q4K2F7      TQKCDASVLITAVGEVHRRDVQKAKEHL-EQTGKPFLGVVLSKLNTS-------------
A5YTV7      TQQCDASVLITAAGETNRRDVQKAKEQL-EQTGKPFLGIVLNKLNTS-------------
F9Q345      TQKCDASILVTAAGETNRRDIQKAKEQL-EQTSKPFLGIVLNKLNTS-------------
Q6L5R0      TQKCDASILVTAAGETNRRDIQKAKEQL-EQTSKPFLGIVLNKLNTS-------------
A5YTT9      TQQCDASVLVTAAGETNRRDVQKAKEQL-EQTSKPFLGVVLNKFNTS-------------
E6KKS0      TQQCDASVLVTAAGETNRRDVQKAKEQL-EQTSKPFLGVVLNKFNTS-------------
F2QF90      TQQCDASVLVTAAGETNRRDVQKAKEQL-EQTSKPFLGVVLNKFNTS-------------
E0Q2S8      TQKCDASILVTAVGETNRRDVQKAKGQL-EQTSKPFLGIVLNKLNTS-------------
A1ILY1      TQKCDASVLVTAAGETNRRDVQKAKEQL-EQTGKPFLGIVLNKLNTS-------------
Q6L5T0      TQKCDASVLVTAAGETNRRDVQKAKEQL-EQTGKPFLGIVLNKLNTS-------------
E9FEC5      TQKCDASVLVTAAGETNRRDVQKAKEQL-EQTGKPFLGIVLNKLNTS-------------
E0PPH9      TQKCDASVLVTAVGEANRRDVQKAKGQL-EQTSKPFLGIVLNKLNTS-------------
F5VSG9      TQKCDASVLVTAVGETNRRDVQKAKGQL-EQTSKPFLGIVLNKLNTS-------------
E3CBS0      AQRCDGTVLITESGANGRKAVQKAKEQL-EQTGTPFLGVVLNKFNIK-------------
F9M366      AQRCDGTVLITESGANGRKAVQKAKEQL-EQTGTPFLGVVLNKFNIK-------------
E8K786      AQRCDGTVLITESGANGRKAVQKAKEQL-EQTGTPFLGVVLNKFNIK-------------
F8DFF4      AQRCDGTVLVVESGTNRRKMVQKAKEQL-EQTGTPFLGVILNKFNIK-------------
I1ZPH7      AQRCDGTVLVVESGTNRRKMVQKAKEQL-EQTGTPFLGVILNKFNIK-------------
E7S8W3      AQRCDGSLIVTAAGAVSRKAVQKAKEQL-EQTGTPFLGVVLNKFDIQ-------------
D0RXH2      AQRCDGSFLVSASGAVSRKAVQKAKEQL-EQTGTPFLGVVLNKFDVK-------------
Q83YR5      AQRCDGSFLVSASGAVSRKAVQKAKEQL-EQTGTPFLGVVLNKFDVK-------------
Q8GP54      AHQADASLLVTEAGKIKRRFVTKTVEQL-EQSGSQFLGVVLNKVDMT-------------
F8HDC3      AHQADASLLVTAAGRIKRRFVTKAVEQL-QQSGSEFLGVVLNKVDLA-------------
F8LJ75      AHQADASLLVTAAGRIKRRFVTKAVEQL-QQSGSEFLGVVLNKVDLA-------------
E9DM17      AHQADASLLVTAAGKIKRRFVTKAVEQL-TQSGSQFLGVVLNKVDMT-------------
I0QIK6      AHQADASLLVTAAGKIKRRFVTKAVEQL-TQSGSQFLGVVLNKVDMT-------------
E8KUY8      AHQADASILVTAAGKIKRRFVAKAVEQL-EQSSSQFLGVVLNKVDMT-------------
Q7X553      AHQADASLLVTAAGKIKRRFVTKAVEQL-EQSGSQFLGVVLIKVDMT-------------
Q8GP92      AHQADASLLVTEAGKIRRRLVTKAVEQL-AESGSQFLGVVLNKVDMT-------------
Q7X561      AHQADASLLVTAAGKITRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
Q7X549      AHQADASLLVTEAGKIKRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
G6ERT1      AHQADASLLVTAAGKIKRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
O87931      AHQADASLLVTAAGKIKRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
Q8GPF6      AHQADASLLVTEAGKIKRRFVTKAVEQL-AESGSQFLGVVLNKVDMT-------------
Q7X555      AHQADASLLVTAAGKIKRRFVTKAVEQL-KQSGSQFLGVVLNKVDMT-------------
Q7X557      AHQADASLLVTAAGKIKRRFVTKAVEQL-KQSGSQFLGVVLNKVDMT-------------
Q7X563      AHQADASLLVIAAGKIKRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
Q8GMA5      AHQADASLLVTAAGKIKRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
Q8GPA8      AHQADASLLVTAAGKIKRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
Q55205      SHQADASLLVTEAGKIKRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
C2LSE6      AHQADASLLVTAAGKIKRRFVAKAVEQL-EQSGSQFLGVVLNKVDMT-------------
Q7X559      AHQADAKFLVTAAGKIKRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
F8LXJ4      AHQADASLLVTAAGKIKRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
Q1WCR1      AHQADASLLVTAAGKIKRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
Q8GPC3      AHQADASFLVTAAGKIKRRFVTKAVEQL-EQSGSQFLGVVLNKVDMT-------------
E8JMT9      AHHSDASLLVTKAGADKRRTITKLKEQL-EQSGSVFLGVILNKYDIH-------------
F5X0J9      AHHSDASLLVTKAGEDRRRTVTKLKEQL-EQSGSVFLGVILNKYDIH-------------
H2A602      AHYSDASLLVVKAGADKRRTVTKLKEQL-EQSGSAFLGVILNKYDIH-------------
E0PD83      AHYSDASLVVAKAGVDKRRTITKLKEQL-EQSGSIFLGVILNKYDIH-------------
F5X652      AHYSDASLVVAKAGVDKRRTITKLKEQL-EQSGSIFLGVILNKYDIH-------------
G5KD11      AQKADASILVTQEGVIKKRFIQKAKDQM-EQSGATFLGIILNKVENT-------------
B9DUJ4      GQKADGSIIVTQAGAIKRRFIQKAKDQM-EQSGALFLGVILNKVEEV-------------
G5KAJ2      AQKADASVLVTEAGVIKRRFVQKAKEQM-EQSGAQFLGVILNKVEHT-------------
F1Z124      SQKADANILVTEAGAIKRRFIQKAKEQM-EQSGALFLGVILNKVEET-------------
Q2KM74      AQKADATILVTEAGSIKRRFVQKAKEQM-EQSGAQFLGVILNKVDQQ-------------
C6LDI8      AKQCDGVVYVVESGVTSYHLAKRGKEQI-EKSGCRILGAVLNKVE-R-------------
D4J4T6      AKSVDGMVMVIEQKKVSRRMAQKMKEQL-EASGCPLLGVVLNKVKIS-------------
D4LTH2      ASMCDGALLVIRAGSVPKTIIRQSLHEI-DQAGCKLLGTVLNCVEGA-------------
D4LG06      ASLCDGAILVVRAGQTPKAMIKQSLYEI-EQSGCKLLGTVLNRAEVS-------------
A7VF42      ASLCDGAVLVVRSGETSRNVIRQSMQQL-EQVNCRLLGVILNRVEAS-------------
A8SQS8      ASLCDGAVLVVRAGETSRNLIKQSFQQL-SQVGCTLLGVILNRVETA-------------
D5HFS4      ASLCDGAALVVRAGETSKSLIKQSFQQL-DQVGCTLLGVILNRAQTT-------------
C9LAS1      AKESDGAVLVIESERVSYKVAQKSMEQL-EKTGCKILGAVLNKVNIE-------------
F3AH92      AEKSDGAILIVESDAVSYKVAQKAKQQL-ERSKCHILGAVLNKADLK-------------
I5ASF8      GRFCDGCIIVIESGAVSYRAAQKVKRQL-EQADIHILGVALNKVDRT-------------
E7GL81      AGHCDGAIMVVESGGVSYRVLQKVKRQL-ERSGCRILGTVLNRVNMQ-------------
G5F9E2      AGHCDGAIMVVESGGVSYRVLQKVKRQL-ERSGCRILGTVLNRVNMQ-------------
E7GL57      SRNCDGAILVIESGNISHRLLQKVKGQL-EKSGCRILGAVLNKVDVR-------------
G5F9A9      SRNCDGAILVIESGNISHRLLQKVKGQL-EKSGCRILGAVLNKVDVR-------------
E7GL40      SRHCDGAILVIESGAISYRLLQKVKNQL-EKSGCRILGTVLNKVDIK-------------
G5F9H2      SRHCDGAILVIESGAISYRLLQKVKNQL-EKSGCRILGTVLNKVDIK-------------
A8RK85      ASQCDGAVIVIESGAISYRLVQKVRSQL-EKSGCRILGAVLNRVGGG-------------
G5HTB2      ANQCDGAVIVIESGTISYHLVQKVKGQL-EKSGCRILGAVLNRVDKE-------------
G5HNC5      ASLCDGAVIVINSGTISYHLVQKVKSQL-EKSGCRILGAVLNRVGTD-------------
C0CZV9      ARQCDGAVMVVESGAVSYRLEQRVKNQL-EKSGCRILGVVLNKIDPE-------------
A8RSK9      ARQCDGAVMVIESGSISYRLEQRVKGQL-EKSGCRILGVVLNKVSME-------------
C5EN03      ARQCDGAVMVVESGCISYRLEQRVKSQL-DKSGCRILGVVLNKMSME-------------
G5HG45      ARQCDGAVMVVESGCISYRLEQRVKGQL-EKSGCRILGVVLNKVSME-------------
D9ST44      STYADGCVLVVASSQVEKAAALKAKALL-EKVKAKILGVVLNK---L---DVKQNG----
G2Z8Q3      SQQMDGIIMVAEESKTQKQKFHKALTTL-RSTHTPIIGIILNK-------TKQDKS----
C8W5K2      ASNMDGVLLVVAQSKSKIAMVQKSKELL-LNVNARIIATVLNMTDDP-------------
F5LM71      ATQCDGVVLVVNAGGVKRELVQKARDSL-QFVHARILGVVLNK-------VARKDA----
D7VBW4      AGQVDGTVLVVRQNFVEKVAVRQAVSAL-KNARAQLLGTILND--------VDIKT----
F9UQ54      AGQVDGTVLVVRQNFVEKVAVRQAVSAL-KNARAQLLGTILND--------VDIKT----
H6LKR8      SKVADGSLLVVAANETKKAMIVEAKKTI-DKVGGVLLGVILTK--------VKFKK----
E0I7B5      SANCDGVVLVVQAGKVKRDMVRKAKTNL-DHVNARILGVVLNN--------VERKQ----
D7UYE4      AELAKHVVYVVDAKKSHRDDVKKGKELL-EKAGAKILGVVLNK--------ATPEK----
Q4A120      GELTKNAVYIIDVETNNKESVKKGKNLL-EKSGTKILGAVLNK--------AQLDK----
D9SVC7      ANQVDGVLLVTCYGKTEKKALVKAKKTL-DSVNANTLGVVITK-------VPKPPK----
D9S1J9      STLVDGVILVVEEGSTEREAAVAAKQQL-DKVNARILGVVLNK-------VKQQKG----
C0GGR5      ASYLDGVILIAASGQAPLEQVVAAKEQL-LKVKANILGVVLNK-------VPQGNG----
C6CSC8      ATKSDGVVLVVDQGRVKRQFAQKAIQNL-QNVNARILGVVLNN-------VKRRSN----
A3ICA3      SNKCDGTLLVVNTGTVGKAAVVKSKSIL-TISKANILGVILNN--------YKMKG----
B1HR41      SNKCDGTLLVVNTGTVGKAAVVKSKSIL-TIAKANILGVILNN--------YKMKG----
D6Y034      AAKVEGVVLVTSSGKTEREAAKKSKELL-DNAHARILGVILNR--------KDKKE----
Q8EME8      SNFVDGTILVVRSKQTENDAANRAMEAL-QSVNANVLGAVLND--------RDKKD----
F3Y922      ASKVDGTILVAREKIAEKSALLKAKELL-IMVKATIIGAIYND--------ASSVK----
G4L594      SSKADGTLLVVRENWTRKDALSKAKELL-DLVQARVLGVIYNG--------SEQGK----
C9B454      SSKTDGTLLVVRENTSRKESLTKTKELL-EMVQARVLGVVYNG--------AEHSK----
Q3XYS6      SSKTDGTLLVVRENTSRKESLNKAKGLL-DMVQARVLGVVYNG--------AEHSK----
C9ALZ9      SSKTDGTLLVVRENTSRKESLTKAKELL-DMVQARVLGVVYNG--------AEHSR----
C9BUG7      SLKTDGTLLVVRENMSRKESLTKAKELL-EMVQARVLGVVYNG--------AEHSK----
D4RJF4      SSKTDGTLLVVRENTSRKESLSKAKELL-EMVQARVLGVVYNG--------AEHSK----
C8ZXT9      ASKADGTILVVRENVSRKEPLTKAKELL-NMVQARVLGVVYNG--------AENNK----
G5IRQ6      ASKADGTILVVRENVSRKEPLTKAKELL-NMVQARVLGVVYNG--------AENSK----
C9A6V5      ASKADGTILVVRENVARKESLTKARDLL-NMVQARIIGVVYNG--------AEHTK----
C9CHY8      ASKADGTILVVRENVARKESLTKARDLL-NMVQARIIGVVYNG--------AEHSK----
Q814Z0      ANVCDASILVVRSESTEKETAVKAKGLL-ESANGKLLGVVLND--------REREQ----
B9IRQ6      ANVCDASILVVRSELTEKETAVKAKALL-ESAKGKLLGVVLND--------REREQ----
B7HXB4      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND--------REREQ----
Q72XH8      ANVCDASILVVRSESTDKETAVKAKGLL-ESAKGKLLGVVLND--------REREQ----
A0RL70      ANQCDASILVVRSESTEKESAVKAKGLL-ESAKGKLLGVVLND--------REREQ----
Q6HB09      ANVCDASILVVRSESTEKESAVKAKGLL-ESAKGKLLGVVLND--------REREQ----
F0PU64      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND--------REREQ----
B7HFH1      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND--------REREQ----
B7IQS8      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND--------REREE----
B3ZRD6      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND--------REREQ----
B5UQ73      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND--------REREN----
G9QCG3      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND--------REREQ----
Q3EV64      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND--------REREE----
Q5WBB4      ANKVDGTIIVTSSGKTDREQLQKTKENL-VKANAHLLGVVLNN--------KPIDD----
B1YMM5      SKLTDGVVLVVGCTTSDRQRVLKAKEQL-ELAEAKILGVVLNR--------RELTD----
D7WMM8      SNKCDGTLLIVNSGVAENENVLKAKSYL-EASKANILGVVLNN--------YKMPL----
A7Z921      ANQTDGSVLVVLSGKTKMDTVQKARDAL-QQSKAKLLGALLNK--------KKIKK----
I2CAF2      ANQTDGSVLVVLSGKTKMDTVQKARDAL-QQSKAKLLGALLNK--------KKIKK----
A7Z9K0      GSYTDGAIMVISSGKTDKEKAAKAKEAL-DYCPCKLLGAVMNG--------KKQTK----
I2CB16      GSYTDGAIMVISSGKTDKEKAAKAKEAL-DYCPCKLLGAVMNG--------KKQTK----
I2HW53      GSYTDGAIMVISSGKTDKEKAAKAKEAL-DYCPCKLLGAVMNG--------KKQTK----
G9QKR4      ANQCQGTVLVVKSGVTELESALKAKELL-QAAKAKLLGAVLNN--------KALKS----
D5DBK3      ASQVDGSILVVSSGKTDKEAALKAKELL-VNAKSKLLGAVLNN--------RKVYD----
D5DY81      ANQVDASLLIVSSSKTEKEAALKAKDLL-TQAKSKLLGAVLNN--------RKMKE----
Q2BFS5      ANKVEGTMLVISSGYTEMEQAEKATELL-RTSKGKLLGAVLNQ--------KKLQD----
A4ITF3      ANKCDCTVLVVSSGNTETDAAVKAKELL-EAANAKLVGVVLNQ--------RKQRE----
C5D961      ANQCDGTILVIESGGTEIEAAVKAKELL-EAANAKLLGVVLNK--------RKHRE----
G8MZ93      ANQCDGTVLVIESGGTEIEAAVKAKELL-EAANAKLLGVVLNK--------RKHRD----
C6CW37      SSYCDGVLLVIHAGKVKKAYVRKAKERL-DFVQSRIIGAVFNQ---M---KRQDIAFV--
G9RSY9      SQYADGVILVVRQNYATFDEVGLAKKNL-DAVNANILGAVLNGFDTK---STEKK-----
F7K9V1      AQHCDGTVIVVESGAISYKFAQKVKEQL-EKVDCRILGVILNK---V---NMSGKGY---
F7K8E9      ARYCDGTLIVIESGAISYKFAQKVTEQL-EKVDCRILGVILNK---V---NMSGKGY---
F7KL96      AQHCDGTLIVIESGAISYKFAQKVTEQL-KKVGCRILGVILNK---V---NMSGKGY---
B9Y884      ASYCDGTILVCASNRNDRKELLRVKDQF-EQTQVNVIGIVMTM---M---PVQRKYYNS-
A5Z5P9      GSMCDGAILVIRSGETSKSEVKSSIKQL-ERSGCKILGVVLNR---A---TDAKGKKNE-
F2I6Z7      ASRTDASVFVLREGVASYQDIQKSKRLL-ESVDANVIGAIYNG---A---DGQ-------
D4YHG7      ATRVDGVIVVVRSGIANKNEVRKTKDLL-DVVNANVIGAVYNG---E---DANKLGY---
C1J9I3      VPKTDGVVVVANMGKTLKGDLRRTVEVL-KLANAKILGSV--E---R---VKAKHGDR--
B1MZT1      MSRMDGVAIVVSGGRTTKGALQRTSEIL-KIAEAPVVGFIYND---Q---DQKKKAGS--
H1WR06      MSRMDGVAIVVSGGKVTKGALQRTSEIL-KIAGAPVVGFIYND---Q---NQKKKAGS--
H1X4N2      MSKVDGVAIVINGGKTNKGALQRTNEIL-KIAEAPVLGFIYND---Q---SRRKKGSSV-
Q03W95      MSKMDGVAIVVNGGKTNRGAIQRTHEIL-KIAEAPVLGFIYND---Q---SRKKKGSA--
F0SX22      SKWLTGILFVVRAGLSEKGSVINAVNHL-TFVGGNILGFLLNG---I------KTKST--
B6W7H4      STYCDGVIFAIKSNDTKKDEVSHALENL-NKVKGKVLGAILTF---A---DLSESSYK--
F0GT81      STLSDAVIFAIKSSDTKRDEISQALDNL-KKVDAHILGCVLTH---M---PRKDNQYG--
B1R3X6      AGKCDGTILVVRAESTSKESIIKAYKEL-EKVRANVLGSVLNG---I---KGNNKNYY--
Q8XN76      AGKCDGTILVVRAESTSKESIIKAYKEL-EKVRANVLGSVLNG---I---KGNNKNYY--
B1BNK1      AGKCDGTILVVRAESTSKESIIKAYKEL-EKVRANVLGSVLNG---I---KGNNKIYY--
B1V0N7      AGKCDGTILVVRAESTSKESIIKAYKEL-EKVRANVLGSVLNG---I---KGNNKIYY--
Q0SVR8      STKVDGTILVVKYGYTKKDGVIEAVKGL-RAVKANIIGTVFNG---E---ENQRGKYY--
B1BNH3      STKVDGTILVVKYGYTKKDAVIEAVKGL-RAVKANIIGTVFNG---E---ETQRGKYY--
Q8XN46      STKVDGTILVVKYGYTKKDAVIEAVKGL-RAVKANIIGTVFNG---E---ENQRGKYY--
B1V1Z4      STKVDGTILVVKYGYTKKDAVIEAVKGL-RAVKANIIGTVFNG---E---ESQRGKYY--
G5GFW0      AKSCDGAVIVIESGKISYKTAQKVKLQL-EKSGCRILGAVLNK---T---AVQERG----
C2EFR6      AKNCDGGIIVINSGQASYRQIRKTKEQL-ERADSKIIGCVLNK---V---DASNN-----
F3ATF5      AKQCDGAVLVFESELVSSKEAARVKEQL-LMTGCRLIGAVLNK---V---DVKKNKYY--
D4M2S0      AKQCDGAILVIESEAVSRRDAMKAKEQL-TKSGCKILGAVLNK---V---DMKKEKYY--
F4BS19      GNKSDGTVFVIRKEVADLSEILKAKELL-NLVQANVLGAVFNS---KERMKSLNNGY---
D4CG08      STVCDGAVLVIAAGTVSRRIERRIKEQL-EKSGCRILGAVLNK---V---TSEHGGYY--
D4MP30      STVCDGAVLVIAAGTVSRRIERRIKEQL-EKSGCRILGAVLNK---V---TSEHGGYY--
C6LCS5      AKECDGAAIVIAADAVSYKFVRKVKEQI-ERSQCRLLGVILNK---V---SLNEKGYY--
B0P2G2      GKYTDGAVIVIEQGVIKRKIVQDVIKQL-KRGEVRILGAVLNK---V---DERIGAY---
D4MW29      GKYTDGAVIVIEQGVIKRKIVQDVIKQL-KRGEVRILGAVLNK---V---DERIGAY---
E5VMX8      GKYTDGAVIVIEQGVIKRKIVQDVIKQL-KRGEVRIFGAVLNK---V---DERIGAY---
D4JMC2      GKNVDGAVIVAAQNVTSSRAIINTKRTL-EDSGVKILGAVLNK---CRFEESKYGHYY--
D6E0V4      GKNVDGAVIVAAQNVTSSRAIINTKRTL-EDSGVKILGAVLNK---CRFEESKYGHYY--
D6E330      AKYCDGAIIVIGQGMASARMIQSVKKQL-EASGVRILGAVLNK---V---NNKKNSHV--
C4Z8M5      AKYCDGAIIVIGQGMASARMIQSVKKQL-EASGVRILGAVLNK---V---NNKKNSHV--
D4JI67      AKYCDGAIIVIGQGMASARMIQSVKKQL-EASGVRILGAVLNK---V---NNKKNSHV--
D3AC80      ARHVDGTIIVVESGAISYKMVQHVKEQL-EKGECRILGVVLNK---V---DLDRDSYY--
G5IFS3      AKHIDGAIIVVESGAISYKLAQNVKSQL-EKSECRILGVVLNK---M---DLEKNGYY--
D4RX67      SSQCDGTALVMASGVISARFAEEIVEQI-KNTGTKFLGIILNK---V---SMSGNGYY--
A6BIG7      AKYCDASVLVVASKTVGHKFAKDVKEQL-EKADCPILGVVLNK---V---SVSNSRYY--
C0C0F8      AAVCDAAVLVIAANAISYKFARVVKEQL-EKSNCPILGVVLNK---V---NMKQNKYY--
Q97EP8      STMVDGVVLVVSSGVADIEAAKRAKELL-ENVNANIIGSVLNR---V---DTESRR----
Q97ER5      STMVDGVILVVTSGVADIEAAKRAKELL-ENVNANIIGSVLNR---V---DTESRK----
D2RIR2      GNLADGVVLVVHSGMVAPEEVQEAKKRL-QAGKANILGVVLNG---V---PQQHKG-Y--
G0VNK6      SSRVDGTVIILGSGDIGPDEGKQAKSLL-EKVHANILGVILNK---V---PQHHKS----
I0GRR2      GTKMDGVVFVVRSGKVTPDEAKEAKQRL-VQSQVNIIGTVLNG---V---PKKNKAGY--
A0PZ02      STIVDGVLLVAASGQAEKEAAIRAKELL-LKVKANILGVVLTK---V---PLNEGK----
B1B736      STVVDGVLLVTASGQAEKEAAIRAKELL-LKVKANILGVVLTK---V---PLNEGK----
F6BI62      APVVDGVILVIQANKTEIEATKRAKEIL-TNLKANILGAVLNK---V---KEQRS-----
Q8RBS5      APVVDGVILVVHAGKTEIEAASRAKEIL-ESVKANILGVVLNR---V---KESRN-----
G2MWC2      APVVDGVILVIQAGKTEIEAISRAKEIL-ESVKANILGVVLNR---V---KESHR-----
B0K4N1      APVVDGVILVIQAGKTEIGAVSRAKEIL-ESVKANILGVVLNR---V---KESHG-----
B0KAR5      APVVDGVILVIQAGKTEIGAVSRAKEIL-ESVKANILGVVLNR---V---KESHG-----
E8UV29      APVVDGVILVIQAGKTEIGAVSRAKEIL-ESVKANILGVVLNR---V---KESHG-----
C7ISF7      APVVDGVILVIQAGKTEIGAVSRAKEIL-ESVKANILGVVLNR---V---KESHG-----
C9AAE5      AKKVDGVLLVVHAEKTNKQSAKNAVKKL-RLVNANILGVVANGTTDT---AVNY------
H7F6C8      ADSADGTVLVCRYHKTLKEKAKHAVNQL-RLSKAKLIGVIFNG---T---KNAENY----
H7F5T6      SKWAEASVLIARGGYSNKIDIKKSLKNM-QDANANILGVIFNN---P---QMKQDH----
B1R3V1      STKVDGTILVVKYGYTKKDAVIEAVKGL-RAVKANIIGTVFNG---E---ETQRGK----
D4YF13      SGKVDGTILVVRQNYVRRDQVVEAKVSL-DNVKANLIGYILND---V---PINKNK----
E6U7N4      SRLVHGVIFVLRQKYTTTEIAQQAQNNL-KNVGARIVGCVFNA---F---NAQKSR----
C8VYQ6      AANVDGVLLVVASGQAKIEMTLKAKELL-LNVNARIIGTVLNM---L---NVQGEE----
D3AE78      ARNVDGAVIVVESGVISYKMVQKVKGQL-EKSGCRILGAVLNK---V---NQESKG----
A4J8V0      APQADGVVLVVASGQAKIETAQKAKQML-LNGKAKILGTILNM---V---EEDSQD----
A8U9F4      SSKADGTIFVITKNGTDKEMVTKSKELL-EKVKANVIGVVFNR---V---ELKGDN----
F4BSD9      SSKTDGTIFVVNKDGADKEMVTKSKNLL-EKVNANVIGVVLNR---V---ELKGDN----
F7V792      GTLCDGVILVVRADSTSKRLVQKSIHQI-ERSGCQLLGIVLNR---A---GSKKNS----
F6IR93      AGQVDGTMLVVRQNGVEKTAVRQAVGAL-KKAHTQLLGAVLND---V----DVKTH----
G0M0F9      AGQVDGTMLVVRQNGVEKTAVRQAVGAL-KKAHTQLLGAVLND---V----DVKTH----
F6ITB4      ANKVDGTVLVVRQGVAQKVAVRDAVHSL-KKSHANILGSVLND---V---RDSSHH----
G0M1X9      ANKVDGTVLVVRQGVAQKAAVRDAVRSL-KKSHANILGSVLND---V---RDSSHH----
G0LYN9      ANKVDGTVLVVRQGVAQKAAVRDAVNSL-KKVQANILGAVLND---V---RDGSHH----
D7VC13      ANKVDGTVLVVRQGVAQKAAVRDAVNSL-KKSQANILGAVLND---V---RDGSHH----
F9UMZ6      ANKVDGTVLVVRQGVAQKAAVRDAVNSL-KKSQANILGTVLND---V---RDSSHH----
I5AV01      AGHCDGSILVIAAEEVSRRFAMDVKDQL-ERANCPILGCVLNK---A---SQENER----
B0GAL3      GKVCDGAILLIESGFVGYRAAQKAIKQL-EKSGTHMLGAVLNK---V---DARKE-----
G1WUK2      GKVCDGAILVIESGFVGYRAAQKAIKQL-EKSGTHMLGAVLNK---V---DTKKE-----
E0RZL3      AKQCDGTVMVIESNAISYRFAQRVKDQL-DKAGAKMLGVVLNK---V---DIAGKG----
D8FLF8      TSSLDGTILVVRQAHSQKSAVKRAVELL-KLTKSPILGYVMND---V---DADGD-----
F0K0J7      TSSLDGTILVVRQAHSQKSAVKRAVELL-KLTKSPILGYVMND---V---DADGD-----
Q1G8E4      TSFLNGTILVVRQAYSQKSAVKRAVELL-KLTKSPILGYVMND---V---DADGD-----
C4VP08      ARELDGVVLVVRQAKTQKQAVKRAVEML-EFAQAHVLGYIMND---V---KSEDA-----
D6S4X4      ARKLDGVVLVVRQGKTQKQAVKRAVEML-EIAQAHVLGYIMND---V---KSEDA-----
D0DJH0      ASHLDGVVLVVRQSVTQKAGITRAVQML-KFAKARILGYVMND---I---RAENG-----
C7XKF3      ASHLDGVVLVVRQGVTQKAGITRAVQML-KFAKARILGYVMND---I---RAENG-----
E3R264      ASHLDGVVLVVRQGVTQKAGITRAVQML-KFAKARILGYVMND---I---RAENG-----
D5GZJ8      ASHLDGVVLVVRQGVTQKAGITRAVQML-RFAKARILGYVMND---I---RAENG-----
C2EPK5      ARHLDGIILVVRQGHTQKLAIKRSVEML-RFAKARILGYIMND---I---SSDNAG----
A4ZGZ8      ARRLDGIILVVRQGKTQKAAIKRAVEML-NFSKAKVLGFIMND---I---SSDNA-----
A8YX89      ARRLDGIILVVRQGKTQKAAIKRAVEML-NFSKAKVLGFIMND---I---SSDNAG----
F0NWJ7      ARRLDGIILVVRQGKTQKAAIKRAVEIL-NFSKAKVLGFIMND---I---SSDNA-----
E4SMV5      ASHLDGVVLVVRQGKTQKMAIKRAVEML-EFAKARILGYIMND---V---SSDNA-----
F0TGY2      ASHLDGVVLVVRQGKTQKMAIKRAVEML-EFAKARILGYIMND---V---SSDNA-----
Q5FIC7      ASHLDGVVLVVRQGKTQKMAIKRAVEML-EFAKARILGYIMND---V---SSDNA-----
F2M2M6      ASHLDGVVLVVRQGKTQKMAIKRAVEML-EFAKARILGYIMND---V---SSDNA-----
G7M0Q3      SAKVDGTILVVRAAKTKKDVVIEAKSLL-DKVGANIIGTILYA---A---ENKYNK----
G7M1R9      STKADGTILVVRAKRTSRESVIDAKRLL-DKVGANILGTVLHA---V---ENTRGK----
A6M2L9      STKVDGTILVIRAGETKRDIVMDAKNLL-DKVGANIIGTVLHA---V---ENTRGK----
G7M566      STKVEGTILVVRAAVTKRDAVIEAKNLL-DKVGANIIGAVLHA---V---ENTRGK----
G2KUP1      AAASNGTIIVVPQGIADKSSVKVAVEQL-KKVNAKILGSVMNR---V---NAKESA----
G8PE06      AARADGTILVVPQGYADKAGVRHAKQLL-DVVHAKILGAIMNR---V---TAEKST----
Q03GL8      AARADGTILVVPQGIADKAGVRHAKQLL-EAVQANILGAILNR---A---TAEKST----
E0NHP4      AARADGTVLVVPQGIADKAGVRHAKQML-ETVQANILGAILNR---A---SAEKST----
F4FXQ7      AAQADGVVLVVRQGLAQKLAIKRSIELL-KMVKANLLGYVLND---V---APKNGY----
C0WV35      AAQVDGVVLVVRQGLAQKLAIKRSTELL-KMVKANLLGYVLND---V---APKN------
H1LCW3      AAQVDGVVLVVRQGLAQKLAIKRSTELL-KMVKANLLGYVLND---V---APKNGY----
C2JZS1      VPRSDGVVVVANMGKTLKGDLKRTVEVL-KLAKAKILGSVERV---K---ARRG------
Q58Z10      VPKTDGVVVVANMGKTLKGDLKRTVEVL-KLANAKILGSVERV---K---AKHG------
E9SAU1      LDTIAGVLLVAKHGQSTYDALEEAIEAV-RMADGSLLGVVINN---V---SVTGGKYGGK
Q38VG5      ASKVDGTILVAPQGIADKRSVIKSKELL-DVVHARILGTIMNR---V---KPENTG----
F0HVF1      TSSLDGTILVVRQAYSQKSAVKRAVELL-KLTKSPILGYVMND---V---DADGDG----
G6F8G9      TSSLDGTILVVRQAHSQKLAVKRAVELL-KLTKSPILGYVMND---V---DADGDD----
C2EWM3      VSHLDGVVLVVKMGQTEKAGLKRSVELL-KLAHANILGYVMND---V---GRNGDS----
F8DRU2      SRHLDAVVLVVKQGQTQKLAVKRAVELL-NLAHANLLGYVMND---V---NADGDA----
B3XL23      SRHLDAVVLVVKQGQTQKLAVKRAVELL-NLAHANLLGYVMND---V---NAEGDA----
F8KGP1      SRHLDAVVLVVKQGQTQKLAVKRAVELL-NLAHANLLGYVMND---V---NAEGDA----
H4GK03      SSMLDGVVLVVRSGVTQKVAIKRAVEML-NISKANLLGYVMND---V---ASGDDD----
B2GF33      SGSLDGVVVVVRQGVTQKAAVRRAVEML-RISKTNILGYVMND---V----YDADA----
C0WW26      SSNLDGVILVVRQGVTQKAAIRRAVEML-KISQANVLGYVMND---V----YDDDA----
D0DSJ4      SSNLDGVILVVRQGVTQKAAIRRAVEML-KISQANVLGYVMND---V----YDDDA----
C0ZHV8      AREMDGCVMVVDASKTKRDSAVKAVEQL-KAAGANLLGVVLNN---K---KVGK------
H1BJT1      SNVSDGTIFVISMKDTKKDIALSSIRQL-ERSRSKILGIVLTK---------TQNL----
F8FCE2      AGHSCGVVIVIDVGKVKREAVKKMKSNL-EHAKGRILGVVLNN---M---NKKEAG----
H6NE43      AGHSCGVVIVIDVGKVKREAVKKMKSNL-EHAKGRILGVVLNN---M---NKKEAG----
I0BSG4      AGHSCGVVIVIDVGKVKREAVKKMKSNL-EHAKGRILGVVLNN---M---SKKEAG----
Q83VF9      SSYVGGVVLVASAYETKKESLAKTKKML-EQVNANILGVVLNG---V---DSSD------
G8P3D7      SSYVGGVVLVVRAYETKKESLAKTKKFL-EQVNVNILGVVLHG---V---DSSD------
O06030      SSYVGGVVLVVRAYETKKESLAKTKKKL-EQVNANILGVVLHG---V---DSSD------
G9M880      SSYVGGVVIVVRAYETKKESLAKTKKML-EQVNANILGVVLHG---V---DSSD------
G6FD42      SSYVGGVVIVVRAYETKKESLAKTKKML-EQVNANILGVVLHG---V---DSSD------
F9VC44      SSYVGGAVIVVRAYETKKESLAKTKKML-EQVNANILGVVLHG---V---DSSE------
A9QSJ4      SSYVGGVVLVVRAYETKKESLAKTKKIL-EQVNANILGVVLHG---V---DSSE------
Q3ZK50      SVYVGGVVLVVRAYETKKESLAKAKKIL-EQVNANILGVVLHG---V---DSSE------
E3GPC6      SHVTDGYIVVAAISVTNKEGVRMALETL-RNVNGNIVGVVANN---A---PVSK-R----
G0V447      STISDGVILVVSSGQADKEAAKRAKELL-ESVRANIIGVVLNKVEIN---SRNK------
H7F1R7      TSYVNGVILVLRSDKTLKERAKIAVEQL-RNTHVHIIGTVLNY---V---KSDS------
E6UHY4      LDSIAGVLLIAKFAQSTYDALQEAIEAI-KMADGSLLGVVVNNVSVM---SGKY------
D9QTC6      ANKVDGVMLVVAAQETDEEALAKSQQML-EKVQANVIGTVLTKYPAE---ESNSYY----
D9SR41      STEVDGVILVAVYGKTDKKALIKAKERL-DKVDANLLGSILTR---V---PANSKN----
P95696      ARAIKDSLLVIDSEKNDKNEVKKAKALM-EKAGSNILGVILNK---T---KVDK-S----
Q2G1K7      ARAIKDSLLVIDSEKNDKNEVKKAKALM-EKAGSNILGVILNK---T---KVDK-S----
A8YPQ5      SKFTGNVVYVVNSENNNKDEVKKGKELI-EATGAKLLGVVLNR---M---PKDK-S----
Q2FUV2      SKFTGNVVYVVNSENNNRDEVKKGKELI-EATGAKLLGVVLNR---M---PKDK-S----
P39851      ARIVKNCVLVIDAEKNNKSEVKKAKGLL-TKAGGKVLGAVLNK---M---PIDK-N----
C5QNG4      LQYVKDAIIVIDAEKNNKYEVKKAKSLI-EKADGKIIGAVLNK---T---PRDK-S----
Q4L9H7      MQYVKECVLIIDVENNNKDELKKAKSLI-EKAEGRLLGAVLNK---T---PVDK-S----
E4Q5T5      GRIVDGVILVAAAGEVQIEAIQQAKENL-QKVNANIIGVVLNK---V---KRQT------
E4SDX4      GRIVDGVILVAAAGEVQIEAIQQAKENL-QKVNANIIGVVLNK---V---KRQT------
E4S7Y6      GRIVDGVILVASAGEVEIEAIQHAKENL-QKVNANIIGVVLNK---V---NKQT------
C6CS80      ANKCDGVLLVVNARTGKKQHAIKAKNAL-KFVQARIVGIALNQ---T---AHRE------
E6LD64      ASKVDGTMLVVREDVSSKDAVVKAQKLL-QMVNANILGAIYHG---T---KNAV-D----
F0EKB9      ASKADGTILVVRENVARKESLTKARDLL-NMVQARIIGVVYNG---A---EHSK-D----
H7F571      TPYVDGTVVVLRSEKTLKDRAKIAIDQL-RKTKIPIIGTVLNC---V---KNRV------
F5LE48      ATKCEGVILVLNHGKVKREVAKRAVDRL-EHVGVKPLGVVINN---K---TNTKTS----
E7RDR3      ANKCEGTILVVSSGNTEKDKALKAKEAI-ESSNSRLIGAVLNN---F---ELPK------
E7RG08      ANKCEGTILVLNSGKTERAHALKAKDAITASTKTRLLGTVLNN---V---QVEK------
F6CNF5      AAQVDGVILVIRAATTRVEIAQEARDQL-LKANARIIGVVLNQ---V---KMPA------
G2FWX4      AQEVDWVVLVMDLGEENKNYVQHAKELL-DKVDAKFLGAVLNK---V---DMKP------
G2FM59      AQEVDGVILVLAAGEVNKGYAQKAKEQL-DKLGVKILGAVLNK---V---GMNT------
G7WJV1      AQEVDGVILVLASGEVDKGYAQKAKGLL-DKLEIKILGAVLNK---V---GMNS------
H5XZD4      ALEVDGVILVLASGEVDKGHAQKAKGLL-DKLGIKILGAVLNK---V---AMNT------
H5XZG7      AQKVDGVILVLASGEVNKDFALRAKDQL-DKVGAKILGAVLNK---A---DIKT------
G7W773      AQEVDGVILVLASGEVNKEYAQRAKDQL-DKVGAKILGAVINK---A---DLKT------
G2FWT8      AQEVDGVILVLASGEVNKEFAQRAKEQL-DKVGAKILGAVLNK---A---DMKT------
I4DBG8      AQEVDGVILILASGEVNKDYAQRAKEQL-DKVGAKILGAVLNK---A---DLKT------
C0EBA6      ADICAGVVLVIRQNQTKHETLQKAIKSL-EFAEMKILGAVVTH---A---GNER------
Q9K6R0      SSKCDGTVLVISSGKTQKEEALKAKDLL-DKSNANLLGVVLNN---K---ELRN------
I2HVL2      ANQTDGSVLVVLSGKTKMDTVQKARDAL-QQSKAKLLGALLNK---K---KIKK------
D4G1R2      ANQTDGSVLVVLSGKTKTDTVLKAKDAL-EQSNAKLLGALLNK---K---KMKK------
G4EQZ7      ANQTDGSVLVVLSGKTKTDTVLKAKDAL-EQSNAKLLGALLNK---K---KMKK------
P71051      ANQTDGSVLVVLSGKTKTDTVLKAKDAL-EQSNAKLLGALLNK---K---KMKK------
E0U2Z3      ANQTDGSVLVVLSGKTKTDTVLKAKDAL-EQSNAKLLGALLNK---K---KLKK------
G4P114      ANQTDGSVLVVLSGKTKTDTVLKAKDAL-EQSNAKLLGALLNK---K---KMKK------
A9VRC3      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2QJY5      ANVCDASILVVRSEATEKEAAVKAKGLL-QSAKGKLLGVVLND---R---E-RE------
C2RG49      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2T8T6      ANVCDASILVVRSESTEKETAVKAKGLL-ESANGKLLGVVLND---R---E-RE------
C2MTG3      ANVCDASILVVRSEATEKETALKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2SSX8      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2YZB2      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C3GBJ8      ANLCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2SBU4      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2NQN6      ANQCDASILVVRSESTEKESAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C3GRR0      ANQCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2PN22      ANVCDASILVVRSESTEKETAVKAKVLL-ESAKGKLLGVVLND---R---E-RE------
C2Y452      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2WVG6      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C3EBC0      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2XJH9      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2P8H3      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2ULR6      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C2V4M2      ANVCDASILVVRSEATEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
C3H979      ANVCDASILVVRSESTEKETAVKAKGLL-ESAKGKLLGVVLND---R---E-RE------
G2TR25      TNQCDGTILVVSSGKAEVEAVKKAKELL-ESANANLLGVVLNN---K---KTQN------
P96716      GNVADGSVLVISSGKTEKEQAAKAKEAL-ATCKSKLLGAIMNG---K---KLSK------
G4EQF3      GNVADGSVLVISSGKTEKEQAAKAKEAL-ATCKSKLLGAIMNG---K---KLSK------
D4G2E1      GNVADGSVLVISSGKTEKEQAAKAKEAL-ETCKSKLLGAIMNG---K---KLSK------
I0F9R6      GNVADGSVLVISSGKTEKEQAAKAKEAL-ESCNSKLLGAIMNG---K---KLSK------
E0TTZ6      GNVADGSVLVISSGKTEKEQAAKAKEAL-ESCKSKLLGAIMNG---K---KLSK------
G4P1M7      GNVADGSVLVISSGKTEKEQAAKAKEAL-ESCKSKLLGAIMNG---K---KLSK------
A8FHL9      ANRTDGSILVVLSGKTKIAAVKKSKEVL-DGTTGKLLGAMLNG---K---KEKK------
Q5KUM5      ANQCDGTVLVIESGGTEIEAAVKAKELL-EAANAKLLGVVLNK---R---KHRD------
D3FZP4      ANLTDGSILVVSSGKTNRDGAKKATEQL-KQAQAKLIGAVLND---K---KKDN------
I0JRK4      SKFVDGALLVVRSKQTEQEAAGKAKEQL-EQSRANILGVVLND---M---DAKD------
I3EBB3      ANRCDGTILVVSSGKTEIEQAIKAKEML-QAANARILGVVLNN---K---KVKG------
                                       .        ..                      

E3CP62      ------------------------VD------KYGSYGSYGS-------------YG---
C2KHF1      ------------------------KK------GSYGYGYGYG-------------YGYGY
G9WIQ9      ------------------------EK---------AYGYGYG-------------YGYTT
A0NKF6      ------------------------DK-------------GYG-------------YGYTS
Q04DV8      ------------------------DK---------GYGYGYG-------------YGYTS
D3LB10      ------------------------DKG-----YGYNYRYDYASTNMMKTDDVSKDASRHS
B8D0N2      ------------------------EY------YYS-----YY------------------
F2I4B7      ------------------------ED------YYY-----YYE-----------------
C2CI44      ---------------D--------KR--------------------------YGNYY---
C7RGH6      ---------------E--------KK--------------------------YGNYY---
C0CK73      ---------------Q----------------KGA---YPYGK--------KYYSYE---
Q1WTC8      ---------------N--------ND------Y-------Y-----------YGYYH---
E8JWI5      ---------------A--------DK------YGF-----YGS---------YGHYG---
F3AHH0      ---------------R--------QKY-----YGK-----YYG-------RHYGRYY---
F7K0U1      ---------------Q--------NKY-----YGK-----YYG-------KYYGKYG---
C4Z672      ---------------G--------NSY-----YGR-----YYGKYYGKYYGKYGEES---
P0C0T9      ---------------V--------AT--------------YGD---------YGNYG---
Q04663      ---------------V--------AT------YGD-----YGD---------YGNYG---
Q67AY4      ---------------V--------AT------YGD-----YGD---------YGNYG---
Q3K0T0      ---------------V--------AT------YGD-----YGD---------YGNYG---
C5NWJ8      ---------------E--------LG------YGG-----Y--------YGHYGSYGIKG
F3A499      ---------------E--------LG------YGG-----Y--------YGHYGSYGLNG
Q4JZ55      ---------------K--------DS------YGY-----YGK---------NTASE---
G5JTD5      ---------------S--------EN------YGN-----YGS------YGSYGDYG---
G3G7C1      ---------------T--------EK------YGD-----YGN---------YGNYG---
G3G7J9      ---------------T--------EK------YGD-----YGN---------YGNYG---
G3G7G6      ---------------T--------EK------YGE-----YGN---------YGNYG---
G8DUB0      ---------------T--------EK------YGE-----YGN---------YGNYG---
G3G7I8      ---------------T--------EK------YSE-----YGN---------YGNYG---
G3G7J4      ---------------T--------EK------YSE-----YGN---------YGNYG---
G7SG34      ---------------T--------EK------YGE-----YGN---------YGNYG---
G8DTZ0      ---------------T--------EK------YGE-----YGN---------YGNYG---
G8DU07      ---------------T--------EK------YGE-----YGN---------YGNYG---
A4VTU3      ---------------T--------EK------YSE-----------------YGNYG---
G7SNU6      ---------------T--------EK------YSG-----------------YGNYG---
G8DU31      ---------------T--------EK------YSG-----------------YGNYG---
D5AGQ5      ---------------T--------EK------YSE-----------------YGNYG---
Q9X4U7      ---------------T--------EK------YSE-----------------YGNYG---
A3CQY2      ---------------L--------ER------YGA-----CGT---YGGYGSYGNYG---
E8KLY9      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
F0FHA8      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
F0I4H5      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
F0IAY3      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
F0IJI2      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
F0IS53      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
F2C9N0      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
F2CH53      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
F3SM32      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
F3UDW7      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
F3UNJ4      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
F0FQQ5      ---------------L--------ER------YGA-----YGT---YGGYGSYGNYG---
D6R2T8      ---------------L--------ER------YGS-----YGS---YGGYGDYGNYG---
F3UUQ2      ---------------L--------ER------YGS-----YGS---YGGYGDYGNYG---
E6IZC2      ---------------L--------EK------YGS-----YGN------YGNYGNYG---
G6A745      ---------------L--------EK------YGS-----YGN------YGDYGNYG---
A8AZR3      ---------------G--------DR------YGV-----YGA------YGNYGAYG---
F9HJP6      ---------------N--------DR------YGA-----YGA------YGNYGNYG---
Q4JYT9      ---------------V--------EK------YGA-----YGG---YGTYGFYGNYR---
Q4JZY1      ---------------V--------EK------YGA--------------YGVYGDYR---
E1LQJ7      ---------------V--------GK------YGA-----YGGYGAYGAYGSYGNYG---
F9HC65      ---------------V--------EK------YGA-----YGG---YGAYGSYGNYR---
E1LPE7      ---------------R--------EK------YGS-----YGG------YGN---YG---
F9MJW5      ---------------R--------EK------YGS-----YGG------YGN---YG---
E8KDN2      ---------------L--------EK------YGS-----YGS------YGSYGAYG---
E8K322      ---------------L--------EK------YGS-----YGS------YGNYGSYG---
F9PEU4      ---------------L--------EK------YGS-----YGS------YGNYGSYG---
F9PZP7      ---------------L--------EK------YGT-----YGG------YGNYGAYG---
C1CBD1      ---------------H--------EK------YG--------S---------YGNYG---
Q7WVX0      ---------------H--------EK------YG--------S---------YGNYG---
P96475      ---------------V--------DK------YGV--------------------YG---
Q9AHD2      ---------------V--------NK------YGV-----YGS---------YGNYG---
Q4K2Q7      ---------------V--------DK------YGV-----YGS---------YGSYG---
Q4K0T5      ---------------H--------EK------YGS-----YGG---------YGNYG---
Q4K0E1      ---------------V--------DK------YGV-----YGS---------YGNYG---
Q9AH95      ---------------V--------DK------YGA-----YGS---------YGNYG---
Q4K1M4      ---------------H--------KK------YGS-----YGD---------YGNYG---
Q4JZ18      ---------------V--------DK------YGV-----YGS---------YGNYG---
Q54520      ---------------V--------DK------YGV-----YGF---------YGNYG---
Q4JYH5      ---------------V--------DK------YGV-----YGS---------YGNYG---
Q4K0V2      ---------------V--------DK------YGV-----YGF---------YGNYG---
A5M4L1      ---------------V--------DK------YGV-----YAS---------YGNYG---
B2ILP5      ---------------V--------DK------YGV-----YAS---------YGNYG---
C1CCB9      ---------------V--------DK------YGV-----YAS---------YGNYG---
Q4K1S7      ---------------V--------DK------YGV-----YAS---------YGNYG---
P72512      ---------------V--------DK------YGV-----YAS---------YGNYG---
Q4JZ84      ---------------V--------DK------YGV-----YGS---------YGNYG---
Q4K0X5      ---------------V--------DK------YGV-----YGS---------YGNYG---
Q4K0Z6      ---------------V--------DK------YGV-----YGF---------YGNYG---
Q4K195      ---------------V--------DK------YGV-----YGF---------YGNYG---
Q4K0A0      ---------------V--------DK------YGV-----YGS---------YGNYG---
Q4K0K2      ---------------V--------DK------YGV-----YGF---------YGNYG---
Q4K1F9      ---------------V--------DK------YGV-----YGF---------YGNYG---
Q4K045      ---------------V--------DK------YGS-----YGK---------YGDYE---
G6C7Z1      ---------------V--------YK------HSP-----YGN---------YGDYG---
D2ERX8      ---------------V--------YK------HSP-----YGN---------YGDYG---
F9LZC4      ---------------V--------DK------YGS-----YGN---------YGDYG---
F9P1W8      ---------------V--------DK------YGS-----YGN------------YG---
I0J9C9      ---------------V--------DK------YGS-----YGG---------YGNYG---
A6YIA8      ---------------I--------DK------YGS-----YGN---------YGNYG---
Q4K005      ---------------V--------DK------YGS-----YGN---------YGDYG---
Q4JZL7      ---------------V--------DK------YGS-----YGG---------YGNYG---
E5F5C5      ---------------V--------DK------YGS-----YGN---------YGNYG---
Q4JZG7      ---------------V--------DK------YGS-----YGD---------YGDYG---
Q4JZK1      ---------------V--------DK------YGS-----YGN---------YGDYG---
A5LJS0      ---------------V--------DK------YGS-----YGN---------YGDYG---
Q9AHB7      ---------------V--------DK------YGS-----YGN---------YGDYG---
Q4K1B7      ---------------V--------DK------YGS-----YGN---------YGDYG---
Q4JYK8      ---------------V--------DK------YGS-----YGN---------YGNYG---
Q4K0M3      ---------------V--------DK------YGS-----YGN---------YGDYG---
Q9AHA4      ---------------V--------NK------YGS-----YGN---------YGDYG---
Q9X9A1      ---------------V--------NK------YGS-----YGN---------YGDYG---
Q9ZII6      ---------------V--------DK------YGS-----YGD---------YG------
Q8KWQ0      ---------------V--------DQ------YGS-----YGN---------YGDYG---
Q4JZW7      ---------------V--------DK------YGS-----YGN---------YG------
Q4JYX9      ---------------V--------DK------YGS-----YGN---------YGDYG---
Q4K0R7      ---------------V--------DK------YGS-----YGN---------YGDYG---
Q4K1K6      ---------------V--------DK------YGS-----YGN---------YGDYG---
Q4JZS3      ---------------V--------DK------YGS-----YGN---------YGDYG---
Q4K0I2      ---------------V--------DK------YGF-----YGS---------YGSYR---
Q4K254      ---------------V--------EK------YGS-----YGN---------YGNYR---
Q4K237      ---------------V--------EK------YGS-----YGS---------YGNYR---
B1I967      ---------------V--------EK------YGS-----YGS---------YGNYR---
G6J8A4      ---------------V--------EK------YGS-----YGS---------YGNYR---
G6LKG5      ---------------V--------EK------YGS-----YGS---------YGNYR---
Q9ZFT8      ---------------V--------EK------YGS-----YGS---------YGNYR---
D6ZQI8      ---------------V--------EK------YGS-----YGS---------YGNYR---
Q4K2A8      ---------------V--------DK------YGS-----YGS---------YGNDR---
Q8VU31      ---------------V--------DE------YGS-----YGS---------YGKKK---
Q4K2E1      ---------------I--------EK------YSS-----YGG---------YGNYG---
Q4K2F7      ---------------I--------EK------YSS-----YGG---------YGNYG---
A5YTV7      ---------------V--------EK------YGS-----YGA------YGSYGNYG---
F9Q345      ---------------V--------EK------YGS-----YGA---------YGSYG---
Q6L5R0      ---------------V--------EK------YGS-----YGA---------YGSYG---
A5YTT9      ---------------V--------EK------YGS-----YGA---------YGNYG---
E6KKS0      ---------------V--------EK------YGS-----YGA---------YGNYG---
F2QF90      ---------------V--------EK------YGS-----YGA---------YGNYG---
E0Q2S8      ---------------V--------EK------YGS-----YGA---------YGNYG---
A1ILY1      ---------------V--------EK------YGS-----YGA------YGNYGNYG---
Q6L5T0      ---------------V--------EK------YGS-----YGA------YGNYGNYG---
E9FEC5      ---------------V--------EK------YGS-----YGA------YGNYGNYG---
E0PPH9      ---------------V--------EK------YGS-----YGA------YGSYGNYG---
F5VSG9      ---------------V--------EK------YGS-----YGA---------YGNYG---
E3CBS0      ---------------A--------TE------YGS-----YGG---------YGSYG---
F9M366      ---------------A--------TE------YGS-----YGG---------YGSYG---
E8K786      ---------------A--------AE------YGS-----YGG---------YGSYG---
F8DFF4      ---------------A--------AE------YGS-----YGG---------YGSYG---
I1ZPH7      ---------------A--------AE------YGS-----YGG---------YGSYG---
E7S8W3      ---------------L--------EK------YGS-----YGN---------YGNYG---
D0RXH2      ---------------S--------EK------YGS-----YGN---------YGNYG---
Q83YR5      ---------------S--------EK------YGS-----YGN---------YGNYG---
Q8GP54      ---------------V--------DK------YGS-----YGS------YGSYGEYG---
F8HDC3      ---------------I--------DK------YGS-----YGS------YGSYGSYGEY-
F8LJ75      ---------------I--------DK------YGS-----YGS------YGSYGSYGEY-
E9DM17      ---------------V--------DK------YGT-----YGS------YGSYGDYG---
I0QIK6      ---------------V--------DK------YGT-----YGS------YGAYGDYG---
E8KUY8      ---------------V--------DK------YGS-----YGS------YGSYGSYGEYG
Q7X553      ---------------V--------DK------YGS-----YGS------YGSYGEYG---
Q8GP92      ---------------V--------DK------YGF-----YGS------YGLYGEYG---
Q7X561      ---------------V--------DR------YGS-----YGS------YGSYGSNGSYG
Q7X549      ---------------V--------DK------YGS-----Y-------------------
G6ERT1      ---------------V--------DK------YGS-----YGS------YGSYGEYG---
O87931      ---------------V--------DK------YGS-----YGS------YGSYGEYG---
Q8GPF6      ---------------V--------DK------YGS-----YGS------YGSYGEYG---
Q7X555      ---------------V--------DK------YGS-----YGS------YGSYGEYG---
Q7X557      ---------------V--------DK------YGS-----YGS------YGSYGEYG---
Q7X563      ---------------V--------DK------YGS-----YGS------YGSYGSYGSYG
Q8GMA5      ---------------V--------DK------YGS-----YGS------YGSYGSYGSYG
Q8GPA8      ---------------V--------DK------YGS-----YGS------YGSYGSYGSYG
Q55205      ---------------V--------DK------YGS-----YGS------YGSYGEYG---
C2LSE6      ---------------V--------DK------YGS-----YGS------YGSYGEYG---
Q7X559      ---------------V--------DK------YGS-----YGS------YGSYGEYE---
F8LXJ4      ---------------V--------DK------YGS-----YGS------YGSYGEYG---
Q1WCR1      ---------------V--------DK------YGS-----YGS------YGSYGEYG---
Q8GPC3      ---------------V--------DK------YGS-----YGS------YGSYGEYE---
E8JMT9      ---------------L--------DK------YGS-----YGS------YGGYGEYG---
F5X0J9      ---------------L--------DK------YGS-----YGS------YGGYGSYG---
H2A602      ---------------L--------DK------YGS-----YGS------YGGYGSYG---
E0PD83      ---------------L--------DN------YGA-----YGS------YGGYGAYG---
F5X652      ---------------L--------DN------YGA-----YGS------YGGYGTYG---
G5KD11      ---------------V--------DSYGGYGAYGG-----YGA------YGAYGSYG---
B9DUJ4      ---------------I--------DS------YGG-----YGA------YGAYGNYG---
G5KAJ2      ---------------V--------DS------YGS--------------YGSYGNYG---
F1Z124      ---------------L--------DS------YGG--------------YGSYGAYG---
Q2KM74      ---------------L--------GS------YGA--------------YGSYGDYG---
C6LDI8      ---------------K--------SKG-----Y-G-----YGR--------YYGDYY---
D4J4T6      ---------------E--------NKG-----YGG-----YGQ--------YYGHYG---
D4LTH2      -----------------GGRYGKYGH------YGK-----YGKYGHYGQYGYGPQAE---
D4LG06      ---------------T-RGYG---K-------YGK-----YG----NYGYG-YGY-----
A7VF42      ---------------G-RAYK---SY------YGK-----YGK---DYGYG-YGYGE---
A8SQS8      ---------------G-RAYK---KY------YGK-----YGKYYKQYGYGEYGRYG---
D5HFS4      ---------------G-RAYK---KY------YGK-----YGKYYSQYGYG-YGTYG---
C9LAS1      ---------------K-NKYYGKYDY------Y------YKSK-----------------
F3AH92      ---------------K-SKYYS--SY------YGKKYGGYRGR-----------------
I5ASF8      ---------------AAGAYG----H------YGK-----YGKYGKYGKYGRYGYDK---
E7GL81      ---------------V-QGYY---RY------YGK-----YGRYHYVYGYGYGRENK---
G5F9E2      ---------------V-QGYY---RY------YGK-----YGRYHYVYGYGYGRENK---
E7GL57      ---------------Q-NSYY----Y------YGK-----YGKY-----YGKEYSSE---
G5F9A9      ---------------Q-NSYY----Y------YGK-----YGKY-----YGKEYSSE---
E7GL40      ---------------Q-GSYY----Y------YGK-----YGKY-----YGYGHENA---
G5F9H2      ---------------Q-GSYY----Y------YGK-----YGKY-----YGYGHENA---
A8RK85      ---------------YEHSYYE--KY------YGRRGGKYYGKYGRHYGRYEEGKAP---
G5HTB2      ---------------YENGYYK--KY------YGK-----Y-----------YGKYG---
G5HNC5      ---------------YDNGYYK--KY------YGK-----Y--YGRYYGKTYGGGGE---
C0CZV9      ---------------Y-NSY----GY------YTR-----YGKYG---KYSRYEKYA---
A8RSK9      ---------------R-NGYYS--KY------YGK-----YG------KYSKYGHYG---
C5EN03      ---------------R-SGYYS--KY------YGR-----YGKYGKYSKYGKYGKYG---
G5HG45      ---------------R-NGYYS--KY------YSR-----YGKYGKYSKYGKYGKYG---
D9ST44      ----------------------------------------YY------------------
G2Z8Q3      ------------------------SK------YYY-----YN------------------
C8W5K2      ---------------G--------ED------YRY-----YN-------------YG---
F5LM71      ------------------------KM------NTY-----YD-------------YSS--
D7VBW4      ------------------------HG------YGY-----GY-------------YGTET
F9UQ54      ------------------------HG------YGY-----GY-------------YGTET
H6LKR8      ---------------S--------SD------YYG-----YG-------------EDKGH
E0I7B5      ---------------T--------EG------YYY-----YY-------------YGSKE
D7UYE4      ------------------------AS------SYY-----YY-------------YGDDK
Q4A120      ------------------------SS------SSY-----YY-------------YGEES
D9SVC7      ---------------I--------EE------NYS-----YY-------------YSEED
D9S1J9      ------------------------GG------YYY-----YY-------------YYYGE
C0GGR5      ------------------------SY------YYH-----YH-------------YGQ--
C6CSC8      ------------------------EE------AYY-----YY-------------YSADV
A3ICA3      ------------------------ST------YE------QY-------------YGKE-
B1HR41      ------------------------ST------YE------QY-------------YGKE-
D6Y034      ------------------------TT------YY------YY-------------YGND-
Q8EME8      ------------------------AN------YY------YY-------------YGS--
F3Y922      ------------------------DQ------GY-------Y-------------YGVK-
G4L594      ------------------------DK------A-Y-----YY-------------YSD--
C9B454      ------------------------DA------G-------YY-------------YRN--
Q3XYS6      ------------------------DV------G-------YY-------------YGN--
C9ALZ9      ------------------------DA------G-------YY-------------YGN--
C9BUG7      ------------------------DA------G-------YY-------------YGN--
D4RJF4      ------------------------DA------G-------YY-------------YGN--
C8ZXT9      ------------------------DS------GYY-----YY-------------YGN--
G5IRQ6      ------------------------DS------GYY-----YY-------------YGN--
C9A6V5      ------------------------DS------GYY-----YY-------------YGN--
C9CHY8      ------------------------DS------GYY-----YY-------------YGN--
Q814Z0      ------------------------GL------YY-------Y-------------YGAN-
B9IRQ6      ------------------------SL------YY-------Y-------------YGTN-
B7HXB4      ------------------------GL------YY-------Y-------------YGAN-
Q72XH8      ------------------------GL------YY-------Y-------------YGAN-
A0RL70      ------------------------GL------YY-------Y-------------YGAN-
Q6HB09      ------------------------GL------YY-------Y-------------YGAN-
F0PU64      ------------------------GL------YY-------Y-------------YGAN-
B7HFH1      ------------------------GL------YY-------Y-------------YGAN-
B7IQS8      ------------------------GL------YY-------Y-------------YGAN-
B3ZRD6      ------------------------GL------YY-------Y-------------YGAN-
B5UQ73      ------------------------GL------YY-------Y-------------YGAN-
G9QCG3      ------------------------GL------YY-------Y-------------YGAN-
Q3EV64      ------------------------GL------YY-------Y-------------YGAN-
Q5WBB4      ------------------------TT------YY------YY-------------K----
B1YMM5      ------------------------DS------AYQ-----YY-------------YSYE-
D7WMM8      ------------------------HQ------YY------EQ-------------YYR--
A7Z921      ------------------------TE------HY------SY------------------
I2CAF2      ------------------------TE------HY------SY------------------
A7Z9K0      ------------------------HS------DY------AY-------------YGQ--
I2CB16      ------------------------HS------DY------AY-------------YGQ--
I2HW53      ------------------------HS------DY------AY-------------YGQ--
G9QKR4      ------------------------SS------YY------YY-------------YGDK-
D5DBK3      ------------------------EN------YY------YY-------------YGSN-
D5DY81      ------------------------GN------YY------YY-------------YGSN-
Q2BFS5      ------------------------SH------YY------YY-------------YGGK-
A4ITF3      ------------------------GS------GY------YQ-------------YQYK-
C5D961      ------------------------GG------YY------YY-------------YRYK-
G8MZ93      ------------------------GG------YY------YY-------------YQYK-
C6CW37      ----------------------------------------KY-------------YGTSK
G9RSY9      ---------------N--------GY------YYS-----YN-------------YSYEN
F7K9V1      ---------------Y--------GA------YYG-----KY-------------YGKYY
F7K8E9      ---------------Y--------GA------YYG-----KY-------------YGKYY
F7KL96      ---------------Y--------GA------YYG-----KY-------------YGKYY
B9Y884      ---------------Y--------GY------RYS-----DS-------------QKK--
A5Z5P9      ---------------K--------KY------YNG-----K-------------------
F2I6Z7      ------------------------GM------NAY-----YG-------------YG---
D4YHG7      ------------------------GY------GYG-----YG-------------YG---
C1J9I3      ------------------------GY------GYG-----YG-------------YG---
B1MZT1      ------------------------GY------GYG-----YG-------------YG---
H1WR06      ------------------------GY------GYG-----YG-------------YG---
H1X4N2      ---------------Y--------GY------GYG-----YG-------------YG---
Q03W95      --------------------------------GYG-----YG-------------YG---
F0SX22      ------------------------SS------RYS-----KY-------------YR---
B6W7H4      ------------------------GY------Y---------------------------
F0GT81      ------------------------SY------Y---------------------------
B1R3X6      ------------------------YA------E---------------------------
Q8XN76      ------------------------YA------E---------------------------
B1BNK1      ------------------------YA------E---------------------------
B1V0N7      ------------------------YA------E---------------------------
Q0SVR8      ------------------------HY------Y---------------------------
B1BNH3      ------------------------HY------Y---------------------------
Q8XN46      ------------------------HY------Y---------------------------
B1V1Z4      ------------------------HY------Y---------------------------
G5GFW0      --------------------------------YYA-----KY-------------YGGRN
C2EFR6      ------------------------DY------YYG-----YY-------------HK---
F3ATF5      ------------------------HR------YDY-----YY-------------HG---
D4M2S0      ------------------------SK------YSS-----YY------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------GK------RYR-----KY-------------YG---
D4MP30      ------------------------GK------RYR-----KY-------------YG---
C6LCS5      ------------------------GK------YYG-----NY-------------YGKD-
B0P2G2      ------------------------GN------YEY-----KY-------------SYSY-
D4MW29      ------------------------GN------YEY-----KY-------------SYSY-
E5VMX8      ------------------------GN------YEY-----KY-------------SYSY-
D4JMC2      ------------------------GN------YYG-----NY-------------YGNY-
D6E0V4      ------------------------GN------YYG-----NY-------------YGNY-
D6E330      ------------------------SG------YYG-----NY-------------YGSY-
C4Z8M5      ------------------------SG------YYG-----NY-------------YGSY-
D4JI67      ------------------------SG------YYG-----NY-------------YGSY-
D3AC80      ------------------------GN------YYG-----KY-------------YGKYY
G5IFS3      ------------------------GS------YYG-----KY-------------YGKNY
D4RX67      ------------------------GK------YYG-----KY-------------YGR--
A6BIG7      ------------------------GK------YYG-----KY-------------TGY--
C0C0F8      ------------------------GK------YYG-----KY-------------YGE--
Q97EP8      ------------------------GY------YGG-----YY-------------YY---
Q97ER5      ------------------------GY------YGS-----YY-------------YY---
D2RIR2      ------------------------GY------GYY-----YY-------------DY---
G0VNK6      --------------------------------GYY-----YY-------------YY---
I0GRR2      ------------------------GY------GYG-----YY-------------YY---
A0PZ02      ------------------------GY------GYS-----YY-------------YY---
B1B736      ------------------------GY------GYS-----YY-------------YY---
F6BI62      ------------------------D--------YY-----YY-------------YY---
Q8RBS5      ------------------------G-------YYY-----YY-------------YY---
G2MWC2      ------------------------GY------YYY-----YY-------------YY---
B0K4N1      ------------------------G--------YY-----YY-------------YY---
B0KAR5      ------------------------G--------YY-----YY-------------YY---
E8UV29      ------------------------G--------YY-----YY-------------YY---
C7ISF7      ------------------------G--------YY-----YY-------------YY---
C9AAE5      ----------------------------------------YY------------------
H7F6C8      ----------------------------------------YY------------------
H7F5T6      ----------------------------------------YY-------------YPESE
B1R3V1      ----------------------------------------YY-------------HYYKK
D4YF13      ---------GYGY---------------------------YE-------------YYNV-
E6U7N4      ---------KYAYGHY--------RY------KRY-----YT-------------EAYK-
C8VYQ6      ----------------------------------------YY-------------YYYYY
D3AE78      ---YYGGYYSKYYG-K--------NY------VKY-----SG-------------YGSGG
A4J8V0      ---------------Y--------YY------Y-------YY-------------YGEG-
A8U9F4      ----------------------------------------YY-------------YYYG-
F4BSD9      ----------------------------------------YY-------------YYYG-
F7V792      ---------RYYYG-K--------EK--------------YG-------------YGYYR
F6IR93      ---------GY------------------------------G-------------YGYY-
G0M0F9      ---------GY------------------------------G-------------YGYY-
F6ITB4      ---------GY----Y--------GY------D-------NG-------------YGYY-
G0M1X9      ---------GY----Y--------GY------D-------NG-------------YGYY-
G0LYN9      ---------GY----Y--------GY------S-------SG-------------YGYY-
D7VC13      ---------GY----Y--------GY------N-------SG-------------YGYY-
F9UMZ6      ---------GY----Y--------GY------N-------SG-------------YGYY-
I5AV01      -----YGRYGRYGR-Y--------GK------YGR-----YG-------------KYYGH
B0GAL3      ---------KYYSY-Y--------SY------GSK-----YG-------------YGYG-
G1WUK2      ---------KYYSY-Y--------SY------GSK--------------------YGYG-
E0RZL3      ----YYGHYGNYYG-K--------YY------GKY-----YG-------------KYYGK
D8FLF8      ------DGYGYGYG-Y--------GY------G-------YG-------------YGYG-
F0K0J7      ------D------G-Y--------GY------G-------YG-------------YGYG-
Q1G8E4      ------D----GYG-Y--------GY------G-------YG-------------YGYG-
C4VP08      ------------------------GY------G-------YG-------------YGYG-
D6S4X4      -----------GYG-Y--------GY------G-------YG-------------YGYG-
D0DJH0      -----------GYG-Y--------GY------G-------YG-------------YGYG-
C7XKF3      ---------GYGYG-Y--------GY------G-------YG-------------YGYG-
E3R264      ---------GYGYG-Y--------GY------G-------YG-------------YGYG-
D5GZJ8      ---------GYGYG-Y--------GY------G-------YG-------------YGYG-
C2EPK5      ----YGYGYGYGYG-Y--------GY------G-------YG-------------YGYGY
A4ZGZ8      -------GYGYGYG-Y--------GY------G-------YG-------------YGYG-
A8YX89      ----YGYGYGYGYG-Y--------GY------G-------YG-------------YGYG-
F0NWJ7      -------GYGYGYG-Y--------GY------G-------YG-------------YGYG-
E4SMV5      ---------GYGYG-Y--------GY------G-------YG-------------YGYG-
F0TGY2      ---------GYGYG-Y--------GY------G-------YG-------------YGYG-
Q5FIC7      ---------GYGYG-Y--------GY------G-------YG-------------YGYG-
F2M2M6      ---------GYGYG-Y--------GY------G-------YG-------------YGYG-
G7M0Q3      -------------------------K------Y-------CY-------------YES--
G7M1R9      -------------------------Y------Y-------YY-------------YGTK-
A6M2L9      -------------------------Y------S-------YY-------------YGND-
G7M566      -------------------------Y------S-------NY-------------YGNE-
G2KUP1      -------------G-Y--------GG------Y-------YG-------------GGYY-
G8PE06      -------------G-Y--------YG------G-------NY-------------GGYY-
Q03GL8      -------------G-Y--------YG------G-------YY-------------GGYY-
E0NHP4      ---------GYYGG-Y--------YG------G-------YY-------------GGYY-
F4FXQ7      ---------GYGYG-Y--------GY------G-------YG-------------YGYG-
C0WV35      -----------GYG-Y--------GY------G-------YG-------------YGYG-
H1LCW3      ---------GYGYG-Y--------GY------G-------YG-------------YGYG-
C2JZS1      -----------DKG-Y--------GY------G-------YG-------------YGYT-
Q58Z10      -----------DRG-Y--------GY------G-------YG-------------YGYG-
E9SAU1      YSYKYKYGYKYGYG-Y--------GY------G-------YS-------------YGNN-
Q38VG5      ---------GY----Y--------GG------Y-------YG-------------GYYG-
F0HVF1      ---------GYGYG-Y--------GY------G-------YG-------------YGYG-
G6F8G9      -----------GYG-Y--------GY------G-------YG-------------YGYG-
C2EWM3      ---------AYGYG-Y--------GY------G-------YG-------------YGYG-
F8DRU2      ---------AYGYG-Y--------GY------G-------YG------------------
B3XL23      ---------AYGYG-Y--------GY------G-------YG-------------YG---
F8KGP1      ---------AYGYG-Y--------GY------G-------YG-------------YG---
H4GK03      ---------GYGYG-Y--------GY------G-------YG-------------YGTV-
B2GF33      ---------GYGYG-Y--------GY------G-------YG-------------Y----
C0WW26      ---------GYGYG-Y--------GY------G-------YE-------------D----
D0DSJ4      ---------GYGYG-Y--------GY------G-------YE-------------G----
C0ZHV8      ---------------R--------EG------Y-------YG-------------YGYNA
H1BJT1      ---------------S--------SY------D-------YY-------------YTYE-
F8FCE2      ---------------T--------YA------Y-------QY------------------
H6NE43      ---------------T--------YA------Y-------QY------------------
I0BSG4      ---------------T--------YA------Y-------QY------------------
Q83VF9      ---------------S--------PS------Y-------YY-------------YGVE-
G8P3D7      ---------------S--------PS------Y-------YY-------------YGVE-
O06030      ---------------S--------PS------Y-------YY-------------YGVE-
G9M880      ---------------S--------PS------Y-------YY-------------YGVE-
G6FD42      ---------------S--------PS------Y-------YY-------------YGVE-
F9VC44      ---------------S--------PS------Y-------YY-------------YGVE-
A9QSJ4      ---------------S--------PS------Y-------YY-------------YGVE-
Q3ZK50      ---------------S--------PS------Y-------YY-------------YGVE-
E3GPC6      ---------------S--------GY------Y-------YY-------------YSAYE
G0V447      ---------------Y--------GY------Y-------YY-------------YGEAE
H7F1R7      ---------------D--------NY------Y-------YY-------------YQ---
E6UHY4      ---------------G--------GK------Y-------GYRYRYGYRYGYGYGYGYSY
D9QTC6      ---------------S--------GY------Y-------NY-------------YG---
D9SR41      ---------------G--------SS------Y-------YY-------------YYYGE
P95696      ---------------S--------SY------Y-------HY-------------YGDE-
Q2G1K7      ---------------S--------SY------Y-------HY-------------YGDE-
A8YPQ5      ---------------A--------SY------Y-------AY-------------YGTDE
Q2FUV2      ---------------A--------SY------Y-------AY-------------YGTDE
P39851      ---------------S--------SY------Y-------YY-------------YGED-
C5QNG4      ---------------S--------SY------Y-------SY-------------YGEEE
Q4L9H7      ---------------S--------SY------Y-------YY-------------YGEDE
E4Q5T5      ---------------S--------S-------Y-------YY-------------YYYYY
E4SDX4      ---------------S--------S-------Y-------YY-------------YYYYY
E4S7Y6      ---------------S--------GY------Y-------YY-------------YYYYY
C6CS80      ---------------A--------GP------Y-------YE-------------YVDRT
E6LD64      ---------------Q--------G-------Y-------YY-------------YGS--
F0EKB9      ---------------S--------GY------Y-------YY-------------YGN--
H7F571      ---------------D--------NY------Y-------DY-------------S----
F5LE48      ---------------S--------SY------Y-------SY-------------YGESK
E7RDR3      ---------------D--------SY------Y-------YQ-------------YYGNA
E7RG08      ---------------D--------FN------Y-------AQ-------------YYTRA
F6CNF5      ---------------R--------DY------H-------YY-------------YYYHR
G2FWX4      ---------------S--------E-------Y-------YY-------------YEYNE
G2FM59      ---------------K--------E-------Y-------YY-------------YYYYN
G7WJV1      ---------------H--------E-------Y-------YY-------------YNYYN
H5XZD4      ---------------K--------G-------Y-------YC-------------YNYYN
H5XZG7      ---------------S--------E-------Y-------YY-------------YYYYH
G7W773      ---------------S--------E-------Y-------YY-------------YYYYH
G2FWT8      ---------------S--------E-------Y-------YY-------------YYYYH
I4DBG8      ---------------S--------E-------Y-------YY-------------YYYYH
C0EBA6      ---------------K--------SR------Y-------YR-------------YMKYK
Q9K6R0      ---------------S--------NM------Y-------YY-------------YGESD
I2HVL2      ---------------T--------EH------Y-------SY------------------
D4G1R2      ---------------S--------EH------Y-------SY------------------
G4EQZ7      ---------------S--------EH------Y-------SY------------------
P71051      ---------------S--------EH------Y-------SY------------------
E0U2Z3      ---------------S--------EH------Y-------SY------------------
G4P114      ---------------S--------EH------Y-------SY------------------
A9VRC3      ---------------Q--------GL------Y-------YY-------------YGAN-
C2QJY5      ---------------Q--------GL------Y-------YY-------------YGAN-
C2RG49      ---------------Q--------GL------Y-------YY-------------YGAN-
C2T8T6      ---------------Q--------GL------Y-------YY-------------YGAN-
C2MTG3      ---------------H--------GL------Y-------YY-------------YGAK-
C2SSX8      ---------------H--------GL------Y-------YY-------------YGAN-
C2YZB2      ---------------Q--------GL------Y-------YY-------------YGAN-
C3GBJ8      ---------------Q--------GL------Y-------YY-------------YGAN-
C2SBU4      ---------------Q--------GL------Y-------YY-------------YGAN-
C2NQN6      ---------------Q--------GL------Y-------YY-------------YGAN-
C3GRR0      ---------------Q--------GL------Y-------YY-------------YGAN-
C2PN22      ---------------Q--------GL------Y-------YY-------------YGAN-
C2Y452      ---------------Q--------GL------Y-------YY-------------YGAN-
C2WVG6      ---------------Q--------GL------Y-------YY-------------YGAN-
C3EBC0      ---------------Q--------GL------Y-------YY-------------YGAN-
C2XJH9      ---------------Q--------GL------Y-------YY-------------YGAN-
C2P8H3      ---------------E--------GL------Y-------YY-------------YGAN-
C2ULR6      ---------------E--------GL------Y-------YY-------------YGAN-
C2V4M2      ---------------E--------GL------Y-------YY-------------YGAN-
C3H979      ---------------E--------GL------Y-------YY-------------YGAN-
G2TR25      ---------------T--------HY------Y-------YY-------------YGKD-
P96716      ---------------H--------SE------Y-------GY-------------YGTKD
G4EQF3      ---------------H--------SE------Y-------GY-------------YGTKD
D4G2E1      ---------------H--------SE------Y-------GY-------------YGNKD
I0F9R6      ---------------H--------SE------Y-------GY-------------YGNKD
E0TTZ6      ---------------H--------SE------Y-------GY-------------YGNKE
G4P1M7      ---------------H--------SE------Y-------GY-------------YGNKE
A8FHL9      ---------------G--------RL------Y-------MY------------------
Q5KUM5      ---------------G--------GY------Y-------YY-------------YQYK-
D3FZP4      ---------------T--------SY------Y-------YY-------------YGDK-
I0JRK4      ---------------S--------NY------Y-------YY-------------YGN--
I3EBB3      ---------------N--------QY------Y-------YY-------------YGGK-
                                                                        

E3CP62      ---SYGEYGKKENKKKVIQEHIVVEKDSVNGDNAAPYALIFKEELRVKEKQEIRRIEIGV
C2KHF1      GDTKSKWLINRHDRER--------------------------------------------
G9WIQ9      TNVMSSDAMKRASNAQVH-------------QNTHHHRPEKKSETVQNQAKSTEVTPTKA
A0NKF6      TNVMKTNDASKASSSKTAPAKPKVPKASVTDTDASKVEQQVPSDVKKEAAHSTAVAEKKT
Q04DV8      TNVMKTNDASKASSRKTAPAKPKVLKASV--TDASKVEQQVPSDTKKEASRPNAAASK--
D3LB10      TPVKAETQSTSLKNTEQLKHAAAKESSPSPKAQAPKSGRFFNKETVQETPRAPRVKKPQA
B8D0N2      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ---YKKEK----------------------------------------------------
Q1WTC8      ---K--------------------------------------------------------
E8JWI5      ---DNLSKEE--------------------------------------------------
F3AHH0      ---GKDE-----------------------------------------------------
F7K0U1      ---EK-------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ---KRDRKRK--------------------------------------------------
Q04663      ---KRDRKRK--------------------------------------------------
Q67AY4      ---KRDRKR---------------------------------------------------
Q3K0T0      ---KRDRKRK--------------------------------------------------
C5NWJ8      NKDKK-------------------------------------------------------
F3A499      NKDKK-------------------------------------------------------
Q4JZ55      ---TERY-----------------------------------------------------
G5JTD5      ---KRTAVTRTNHASHTRRSK---------------------------------------
G3G7C1      ---KKA------------------------------------------------------
G3G7J9      ---KKA------------------------------------------------------
G3G7G6      ---RK-------------------------------------------------------
G8DUB0      ---KKA------------------------------------------------------
G3G7I8      ---KKA------------------------------------------------------
G3G7J4      ---KKA------------------------------------------------------
G7SG34      ---KKA------------------------------------------------------
G8DTZ0      ---KKA------------------------------------------------------
G8DU07      ---KKA------------------------------------------------------
A4VTU3      ---KESLISQIT------------------------------------------------
G7SNU6      ---KKA------------------------------------------------------
G8DU31      ---KKA------------------------------------------------------
D5AGQ5      ---KKA------------------------------------------------------
Q9X4U7      ---KKA------------------------------------------------------
A3CQY2      ---K--------------------------------------------------------
E8KLY9      ---K--------------------------------------------------------
F0FHA8      ---K--------------------------------------------------------
F0I4H5      ---K--------------------------------------------------------
F0IAY3      ---K--------------------------------------------------------
F0IJI2      ---K--------------------------------------------------------
F0IS53      ---K--------------------------------------------------------
F2C9N0      ---K--------------------------------------------------------
F2CH53      ---K--------------------------------------------------------
F3SM32      ---K--------------------------------------------------------
F3UDW7      ---K--------------------------------------------------------
F3UNJ4      ---K--------------------------------------------------------
F0FQQ5      ---K--------------------------------------------------------
D6R2T8      ---K--------------------------------------------------------
F3UUQ2      ---K--------------------------------------------------------
E6IZC2      ---KKK------------------------------------------------------
G6A745      ---KK-------------------------------------------------------
A8AZR3      ---KKH------------------------------------------------------
F9HJP6      ---KKH------------------------------------------------------
Q4JYT9      ---KG-------------------------------------------------------
Q4JZY1      ---KG-------------------------------------------------------
E1LQJ7      ---KKK------------------------------------------------------
F9HC65      ---KKK------------------------------------------------------
E1LPE7      ---KK-------------------------------------------------------
F9MJW5      ---KK-------------------------------------------------------
E8KDN2      ---KK-------------------------------------------------------
E8K322      ---KK-------------------------------------------------------
F9PEU4      ---KK-------------------------------------------------------
F9PZP7      ---KK-------------------------------------------------------
C1CBD1      ---KR-------------------------------------------------------
Q7WVX0      ---KR-------------------------------------------------------
P96475      ---RK-------------------------------------------------------
Q9AHD2      ---KK-------------------------------------------------------
Q4K2Q7      ---KK-------------------------------------------------------
Q4K0T5      ---KK-------------------------------------------------------
Q4K0E1      ---KK-------------------------------------------------------
Q9AH95      ---KK-------------------------------------------------------
Q4K1M4      ---KK-------------------------------------------------------
Q4JZ18      ---KK-------------------------------------------------------
Q54520      ---KK-------------------------------------------------------
Q4JYH5      ---KK-------------------------------------------------------
Q4K0V2      ---KKII-----------------------------------------------------
A5M4L1      ---KK-------------------------------------------------------
B2ILP5      ---KK-------------------------------------------------------
C1CCB9      ---KK-------------------------------------------------------
Q4K1S7      ---KK-------------------------------------------------------
P72512      ---KK-------------------------------------------------------
Q4JZ84      ---KK-------------------------------------------------------
Q4K0X5      ---KK-------------------------------------------------------
Q4K0Z6      ---KK-------------------------------------------------------
Q4K195      ---KK-------------------------------------------------------
Q4K0A0      ---KK-------------------------------------------------------
Q4K0K2      ---KK-------------------------------------------------------
Q4K1F9      ---KK-------------------------------------------------------
Q4K045      ---KNKKYVEG-------------------------------------------------
G6C7Z1      ---KK-------------------------------------------------------
D2ERX8      ---KK-------------------------------------------------------
F9LZC4      ---KK-------------------------------------------------------
F9P1W8      ---KK-------------------------------------------------------
I0J9C9      ---NK-------------------------------------------------------
A6YIA8      ---KNKK-----------------------------------------------------
Q4K005      ---KNKK-----------------------------------------------------
Q4JZL7      ---NK-------------------------------------------------------
E5F5C5      ---KNKK-----------------------------------------------------
Q4JZG7      ---KNKK-----------------------------------------------------
Q4JZK1      ---KNKK-----------------------------------------------------
A5LJS0      ---KNKK-----------------------------------------------------
Q9AHB7      ---KNKK-----------------------------------------------------
Q4K1B7      ---KNKK-----------------------------------------------------
Q4JYK8      ---KE-------------------------------------------------------
Q4K0M3      ---KNKK-----------------------------------------------------
Q9AHA4      ---KNKK-----------------------------------------------------
Q9X9A1      ---KNKK-----------------------------------------------------
Q9ZII6      ---KNKK-----------------------------------------------------
Q8KWQ0      ---KNKK-----------------------------------------------------
Q4JZW7      -----KK-----------------------------------------------------
Q4JYX9      ---KNKK-----------------------------------------------------
Q4K0R7      ---KNKK-----------------------------------------------------
Q4K1K6      ---KNKK-----------------------------------------------------
Q4JZS3      ---KNKK-----------------------------------------------------
Q4K0I2      ---KQKK-----------------------------------------------------
Q4K254      ---KQKK-----------------------------------------------------
Q4K237      ---KQKK-----------------------------------------------------
B1I967      ---KQKK-----------------------------------------------------
G6J8A4      ---KQKK-----------------------------------------------------
G6LKG5      ---KQKK-----------------------------------------------------
Q9ZFT8      ---KQKK-----------------------------------------------------
D6ZQI8      ---KQKK-----------------------------------------------------
Q4K2A8      ---KK-------------------------------------------------------
Q8VU31      ---K--------------------------------------------------------
Q4K2E1      ---NK-------------------------------------------------------
Q4K2F7      ---NK-------------------------------------------------------
A5YTV7      ---RK-------------------------------------------------------
F9Q345      ---KK-------------------------------------------------------
Q6L5R0      ---KK-------------------------------------------------------
A5YTT9      ---KK-------------------------------------------------------
E6KKS0      ---KK-------------------------------------------------------
F2QF90      ---KK-------------------------------------------------------
E0Q2S8      ---KK-------------------------------------------------------
A1ILY1      ---KK-------------------------------------------------------
Q6L5T0      ---KK-------------------------------------------------------
E9FEC5      ---KK-------------------------------------------------------
E0PPH9      ---KK-------------------------------------------------------
F5VSG9      ---KK-------------------------------------------------------
E3CBS0      ---EYG---KK-------------------------------------------------
F9M366      ---EYG---KK-------------------------------------------------
E8K786      ---EYG---KK-------------------------------------------------
F8DFF4      ---EYG---KK-------------------------------------------------
I1ZPH7      ---EYG---KK-------------------------------------------------
E7S8W3      ---NYGK--KR-------------------------------------------------
D0RXH2      ---NYGNYGKK-------------------------------------------------
Q83YR5      ---NYGNYGKK-------------------------------------------------
Q8GP54      ---KKSDQKEGHSRAHRRRKG---------------------------------------
F8HDC3      ---GGDKHTENKSRKHRRKRG---------------------------------------
F8LJ75      ---GGDKHTENKSRKHRRKRG---------------------------------------
E9DM17      ---KKSEQKSSHSRSQRRRKG---------------------------------------
I0QIK6      ---KKSEQKSSHSRSQRRRKG---------------------------------------
E8KUY8      ---KKGKQKESHSRAHRRRKG---------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ---KKSDQKEGHSRAYRRRKGKH-------------------------------------
Q7X561      SQ----------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ---KKSNQKEGHSRAHRRRKVGWN------------------------------------
O87931      ---KKSNQKEGHSRAHRRRKVGWN------------------------------------
Q8GPF6      ---KKSDQKEGHSRAYRRRK----------------------------------------
Q7X555      ---KKTDQ----------------------------------------------------
Q7X557      ---KKTDQ----------------------------------------------------
Q7X563      EY----------------------------------------------------------
Q8GMA5      EYRKKTDQTEGHSRAHRRRKG---------------------------------------
Q8GPA8      EYRKKTDQTEGHSRAHRRRKG---------------------------------------
Q55205      ---KKSNQKEGHSRAHRRRKG---------------------------------------
C2LSE6      ---KKSDQKEGHSRAHRRRKG---------------------------------------
Q7X559      ---KKTDQ----------------------------------------------------
F8LXJ4      ---KKYDQKEGHSRAHRRRKG---------------------------------------
Q1WCR1      ---KKYDQKEGHSRAHRRRKG---------------------------------------
Q8GPC3      ---KKTDQTEGHSRAHRRRKG---------------------------------------
E8JMT9      ---EKN------------------------------------------------------
F5X0J9      ---NYGKSEEKTKIGRGKRKK---------------------------------------
H2A602      ---NYGKSEEKTKIGRGKRKK---------------------------------------
E0PD83      ---NYGKGKEKTKTGRVKRKK---------------------------------------
F5X652      ---A---KEEKSKKGKGRRRK---------------------------------------
G5KD11      ---SYGKENEKSRKASRRRK----------------------------------------
B9DUJ4      ---NYGKEDSKSKKKNRRRK----------------------------------------
G5KAJ2      ---KKEKPRKHVRKSSRKRK----------------------------------------
F1Z124      ---NYGKPAK---KKSRKRR----------------------------------------
Q2KM74      ---KTKKSSK---SKKHSRK----------------------------------------
C6LDI8      ---KK-------------------------------------------------------
D4J4T6      ---KYGEY----------------------------------------------------
D4LTH2      ---EENKKSKK-------------------------------------------------
D4LG06      ----EPDTKHKKHSEK--------------------------------------------
A7VF42      ---KKYSGKKEK------------------------------------------------
A8SQS8      ---QEAASSKDK------------------------------------------------
D5HFS4      ---KEAAAASDSTPSK--------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ---SAQTQ----------------------------------------------------
E7GL81      ---K--------------------------------------------------------
G5F9E2      ---K--------------------------------------------------------
E7GL57      ---H--------------------------------------------------------
G5F9A9      ---H--------------------------------------------------------
E7GL40      ---KQGKEVKTASV----------------------------------------------
G5F9H2      ---KQGKEAKVL------------------------------------------------
A8RK85      ---PVNEVSGARIKNDTTAQSQDT------------------------------------
G5HTB2      ---EA-------------------------------------------------------
G5HNC5      ---KYQILDEAR------------------------------------------------
C0CZV9      ---KYDKSEITEG-----------------------------------------------
A8RSK9      ---KYDRYEKAEA-----------------------------------------------
C5EN03      ---KYEKYEKANA-----------------------------------------------
G5HG45      ---KYEKYEKAEA-----------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      N-----------------------------------------------------------
F9UQ54      N-----------------------------------------------------------
H6LKR8      SKKEKKLKKKK-------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      K-----------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      DDE---------------------------------------------------------
D9S1J9      GDHKRKKKKIT-------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      K-----------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ADR---------------------------------------------------------
F7K9V1      GKYYGNSEEGGLHAAVVQKGTKGAKAVKGEGNLHSHDNKSTRESGKEKAAEEDVIAEDDM
F7K8E9      GKYYGNNEEGGLHAAVVQKGLKSGKAAKGEENTHSHEIKNGSDPVKEKIPEESQIPEDDM
F7KL96      GKYYGNNEEGGLHAAVVQKGLKSGKTAKGEENTHSHENKNGPELVKEKNPEESLVPEEDM
B9Y884      ---TAQKKKKNSIMSSITKKGDKKK-----------------------------------
A5Z5P9      ------------------------------------------------------------
F2I6Z7      ---YRDEDIDSEDLQS--------------------------------------------
D4YHG7      ---YGQSETSK-------------------------------------------------
C1J9I3      ---YGTNTGKK-------------------------------------------------
B1MZT1      ---YGDAK----------------------------------------------------
H1WR06      ---YGDAKS---------------------------------------------------
H1X4N2      ---YGETKTK--------------------------------------------------
Q03W95      ---YGETKA---------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      --------------DNKKKKLKVRS-----------------------------------
Q8XN76      --------------DNKKKKLKVRS-----------------------------------
B1BNK1      --------------DNKKKKLKVRS-----------------------------------
B1V0N7      --------------DNKKKKLKVRS-----------------------------------
Q0SVR8      --------------KKD-------------------------------------------
B1BNH3      --------------KKD-------------------------------------------
Q8XN46      --------------KKD-------------------------------------------
B1V1Z4      --------------KKD-------------------------------------------
G5GFW0      KYKYSKDTEQAGRSKWIQRDKAER------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ---YQEKKEV----TKKNKEK---------------------------------------
D4M2S0      ---YGKSKQE--------------------------------------------------
F4BS19      ---YAKEKELDSVG----------------------------------------------
D4CG08      ---YGAEK----------------------------------------------------
D4MP30      ---YGAEK----------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ---YGESDTE----KNHPNT----------------------------------------
D4MW29      ---YGESDTE----KNHPNT----------------------------------------
E5VMX8      ---YGESDTE----KNHQNT----------------------------------------
D4JMC2      ---YGRDDDE----K---------------------------------------------
D6E0V4      ---YGRDDDE----K---------------------------------------------
D6E330      ---YGQSDKA--------------------------------------------------
C4Z8M5      ---YGRSDKA--------------------------------------------------
D4JI67      ---YGRSDKA--------------------------------------------------
D3AC80      GKYYGNYGEE----TKKQDKK---------------------------------------
G5IFS3      GN-YGDYGN---------------------------------------------------
D4RX67      ---YGHGGDS----TDSQKG----------------------------------------
A6BIG7      ---YGEYKY---------------------------------------------------
C0C0F8      ---YGKK-----------------------------------------------------
Q97EP8      ---YGDEGEK----VKKHKDR---------------------------------------
Q97ER5      ---GHEEEN---------------------------------------------------
D2RIR2      ---YDENHVK----HHKKKGKREE------------------------------------
G0VNK6      ---YDENHNK----KRKRR-----------------------------------------
I0GRR2      ---YDEKHEK----HKGRHKSKQKD-----------------------------------
A0PZ02      ---YGDEDEK---SKKRRKSKK--------------------------------------
B1B736      ---YGNEEEKSKTSKKRRKNEK--------------------------------------
F6BI62      ---YNNDGSK----HKRKRRKK--------------------------------------
Q8RBS5      ---YGDHKSQ----SKKRRKR---------------------------------------
G2MWC2      ---YDDNKPQ----HKKRRKR---------------------------------------
B0K4N1      ---YDDNKPQ----HRKRRKR---------------------------------------
B0KAR5      ---YDDNKPQ----HRKRRKR---------------------------------------
E8UV29      ---YDDNKPQ----HRKRRKR---------------------------------------
C7ISF7      ---YDDNKPQ----HRKRRKR---------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      V-----------------------------------------------------------
B1R3V1      D-----------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      YSGEDGGKKPKNKGHRKKNLPAATM-----------------------------------
D3AE78      SSGKAEKSEEKTEMKTAAAGGEENQVKRSRRRK---------------------------
A4J8V0      -------SGDKKKGKKRGHKAACL------------------------------------
A8U9F4      -------EGE--------------------------------------------------
F4BSD9      -------EE---------------------------------------------------
F7V792      KSDYYGKHAAENAKS---------------------------------------------
F6IR93      -------GNDAN------------------------------------------------
G0M0F9      -------GNDAN------------------------------------------------
F6ITB4      -------SNEDK------------------------------------------------
G0M1X9      -------SNEDK------------------------------------------------
G0LYN9      -------SDEDK------------------------------------------------
D7VC13      -------SDEDK------------------------------------------------
F9UMZ6      -------SDEDK------------------------------------------------
I5AV01      YGYYAASDDSKDSGKTKGEKAKKRKKK---------------------------------
B0GAL3      -------QNHENA-----------------------------------------------
G1WUK2      -------QNHENE-----------------------------------------------
E0RZL3      YGEDNIDVPTKPNATVTDPEPDEDDLDELNYLAGVMRKD---------------------
D8FLF8      -------EEKEKKGLFGRKK----------------------------------------
F0K0J7      -------EEDEKKGLFGRKK----------------------------------------
Q1G8E4      -------EEKEKKGLFGRKK----------------------------------------
C4VP08      ------KENKEKKSLFLWLKK---------------------------------------
D6S4X4      ------EPEKEKKSIFSWMNK---------------------------------------
D0DJH0      --------AEKKKGLFGRKKSDDQ------------------------------------
C7XKF3      --------AEKKKGLFGRKKSDDQ------------------------------------
E3R264      --------AEKKKGLFGRKKSDDQ------------------------------------
D5GZJ8      --------AEKKKGLFGRKKSDGQ------------------------------------
C2EPK5      GYGYGYGEEKKKKSWFSRLKK---------------------------------------
A4ZGZ8      ------EEDKKKKGFFSRRKK---------------------------------------
A8YX89      ------EEDKKKKGFFSRRKK---------------------------------------
F0NWJ7      ------EEDKKKKGFFSRRKK---------------------------------------
E4SMV5      ------EEDTKKKGLFSKFRK---------------------------------------
F0TGY2      ------EEDTKKKGLFSKFRK---------------------------------------
Q5FIC7      ------EEDTKKKGLFSKFRK---------------------------------------
F2M2M6      ------EEDTKKKGLFSKFRK---------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      -------DDEKKN-----------------------------------------------
A6M2L9      -------EDKDNL-----------------------------------------------
G7M566      -------EDKE-------------------------------------------------
G2KUP1      -------GVDDK------------------------------------------------
G8PE06      -------GTGGK------------------------------------------------
Q03GL8      -------GTDNK------------------------------------------------
E0NHP4      -------GTDDK------------------------------------------------
F4FXQ7      -------YDNEGK-----------------------------------------------
C0WV35      -------YDNEGK-----------------------------------------------
H1LCW3      -------YDNEGK-----------------------------------------------
C2JZS1      -------TENQR------------------------------------------------
Q58Z10      -------NESNK------------------------------------------------
E9SAU1      -------ASVGSGKSNDNDE----------------------------------------
Q38VG5      -------AEESKK-----------------------------------------------
F0HVF1      -------EEKEKKGLFGRKK----------------------------------------
G6F8G9      -------EEKEKKGLFGRKK----------------------------------------
C2EWM3      -------YSSDNK-----------------------------------------------
F8DRU2      ---------ENTK-----------------------------------------------
B3XL23      --------EDAGK-----------------------------------------------
F8KGP1      --------EDTNK-----------------------------------------------
H4GK03      -------EPED-------------------------------------------------
B2GF33      -------EDER-------------------------------------------------
C0WW26      -------ER---------------------------------------------------
D0DSJ4      -------DEE--------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      EDQHQSKKEKKHRKIKEKRGK---------------------------------------
G0V447      GKK---------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E6UHY4      SRKPSDEGENDE------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      KKAK--------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      S-----------------------------------------------------------
Q2FUV2      S-----------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
E4Q5T5      YYYTDESGETVKKKKVGRRRKKDDRYTLPSDGRR--------------------------
E4SDX4      YYYQDENGEVVKKKKTGRRRKKDDRYTLPSDGGR--------------------------
E4S7Y6      YYYQDDSGEIIKKKKGERRKKRKERYTAPVESKN--------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      E-----------------------------------------------------------
E7RG08      PNEK--------------------------------------------------------
F6CNF5      REKEEEVRL---------------------------------------------------
G2FWX4      SKH----PKKRHRRHKAG------------------------------------------
G2FM59      ASDD---TKKKHNRRSL-------------------------------------------
G7WJV1      SAKD---M----------------------------------------------------
H5XZD4      AADD---TKKKQSKMAYL------------------------------------------
H5XZG7      GSDD---PGKKRKSRGNP------------------------------------------
G7W773      GSDD---PKKKRTRKNRS------------------------------------------
G2FWT8      GSDD---SAKKPKRHKAR------------------------------------------
I4DBG8      GSEDPNESKRKHKRQRAH------------------------------------------
C0EBA6      SYKE--------------------------------------------------------
Q9K6R0      R-----------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      NFMQK-------------------------------------------------------
G4EQF3      NFMQK-------------------------------------------------------
D4G2E1      NFMQNK------------------------------------------------------
I0F9R6      NFMQNK------------------------------------------------------
E0TTZ6      NFIQNK------------------------------------------------------
G4P1M7      NFIQNK------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
                                                                        

E3CP62      V---------QLVVVVFAAWLASKLPYTEITKGSMVILGVVHVVTYYISSYYENLKYRGY
C2KHF1      ----------RKRLMVYRRFLKR-------------------------------------
G9WIQ9      V---------VEPTKVWSSFEATNRIASRQTKTPPAPSAA--------------------
A0NKF6      VTAASKTAPTSAPKSSWSSFSYT---STGSEKSEASSKAK--------------------
Q04DV8      ----------TAPKSSWSSFSYT---STGSEKSEASSKAK--------------------
D3LB10      SWSSFSYTSSGSEKSEIPKETEKPGPSGA-------------------------------
B8D0N2      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
F7K9V1      IQLDMDMVELVEDTELIEELK---------------------------------------
F7K8E9      IQLDIDMVELTEDTEPIEELR---------------------------------------
F7KL96      IQLDIDMVELVEDTEPIEELK---------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
                                                                        

E3CP62      LDELIATVKYGFIFALVVTFLSFFADGDFSISRRGLLYVTLITCTLLYLTNTLLRYFRSS
C2KHF1      ------------FFDLLLAFF------------------------LF-------------
G9WIQ9      -ANEETTAKVLPMVDIHAHLLPDPTRGPVTIDNSLQAARAAVADNIQ-------------
A0NKF6      -EPGPNNAQEISLVDIHAHLLPRADDGSDSMTTSLQLAKEAVREGIH-------------
Q04DV8      -EPGPSNVQEISLVDIHTHLLPRADDGSDSMTTSLQLAKEAVQEGVH-------------
D3LB10      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
                                                                        

E3CP62      IYTRRKGNKNILLISDQARLEDVLIRMKDNMDGRITAVCVLDNPYFTSPFIKSVKPENLV
C2KHF1      -----------LILLLPLLIIALIVKLTSK--GPIL------------------------
G9WIQ9      -----------TLVVTPYQSADKMANTADDIQAAIA------------------------
A0NKF6      -----------TIIATPNQMDGRYINDTDKVLSDVD------------------------
Q04DV8      -----------TIVASPNQMDGRYINDPDKVLSDVD------------------------
D3LB10      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
                                                                        

E3CP62      EYATHSVVDQVLINLPSEQYKIWDYASPFELMGIPVSINLNSLEFMSQGKKRIQQLGPFN
C2KHF1      ------------------------------------------------------------
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------------------------------
Q04DV8      ------------------------------------------------------------
D3LB10      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
                                                                        

E3CP62      VVTFSTQFYSYGDIVAKRFLDICGALFGLLLCGLVGIFLYPLIRRDGGPAIFVQDRVGEN
C2KHF1      ---------------------------------------------------FIQERYGRN
G9WIQ9      ---------------------------------------------------PLRNSIKEA
A0NKF6      ---------------------------------------------------NLNNTLKRI
Q04DV8      ---------------------------------------------------NLNNTLKRV
D3LB10      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
                                                                        

E3CP62      GRIFKFYKFRSMRVDAEEIKKNLMSQNKMSGGMFKMDNDPRITKIGHFIRKTSLDELPQF
C2KHF1      SRPFKLYKFRSMTDSAPQI------ANSKFTDIQNYITPFG-----MFIRKTSLDELPQL
G9WIQ9      GIPINILPGQVVPLTANLL------AAFDHGNLLTLADSKK-----FLLVELPEDQIPKI
A0NKF6      GIDLRILPGQEIHLSDQFL------TAFDQGRLLTLADSKK-----YMLVELPNDSVPPV
Q04DV8      GIDLRILPGQEIHLSDQFL------TAFDQGRLLTLADSKK-----YMLVELPNDSVPPV
D3LB10      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
                                                                        

E3CP62      WNVLKGDMSLVGTRP-PTLDEYESYTPEQKRRLSFRPGITGLWQVSGRS-----------
C2KHF1      WNIIKGDMSFIGPRPLAKTDERVLSLRKQNGADQVLPGISGLAQVNGRN-----------
G9WIQ9      AASVIFQLKTRGVTMIIAHPETNRAVLANPGQLNHLVEQGAILQVAAASINGQFGSEVAD
A0NKF6      IHQVISKLREHKITMIVAHPESNLVLLNDPKELNKLARRGVLFQVTSSSINGFFGKQIAD
Q04DV8      IHQVISKLREHKITMIVAHPERNLTLLNDPKELNKLARRGVLFQVTSSSINGFFGQEVAD
D3LB10      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
                                                                        

E3CP62      ------------EITDFDEVVKLDVAYMDDWTIWRDIRILLKTIKVVVKKDGAK------
C2KHF1      -------------NLSDEDKASYDAKYTEYLSFRIDMLLTFKTFVSVLKRDGVFKEVTLK
G9WIQ9      LALDLVRRGLAATVASGADSSEMNQRYHLSDAYALLTRAVGRRSVDILKKNAI--RIIGG
A0NKF6      FSLAMLRRGFVTTIASETHGITSDQHYHLADAYSIADKLIGEGKTNIIKQNAV--RIVKG
Q04DV8      FALEMLRRGFVTTIASETHGVTSDQHYHLADAYAIANKLIGEGKTNIIKQNAV--LIVKG
D3LB10      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
                                                                        

E3CP62      -----------
C2KHF1      REEGLKKIHDL
G9WIQ9      LPVDSMAAEEF
A0NKF6      EPVDGTTIREF
Q04DV8      EPVDGTTIQEF
D3LB10      -----------
B8D0N2      -----------
F2I4B7      -----------
C2CI44      -----------
C7RGH6      -----------
C0CK73      -----------
Q1WTC8      -----------
E8JWI5      -----------
F3AHH0      -----------
F7K0U1      -----------
C4Z672      -----------
P0C0T9      -----------
Q04663      -----------
Q67AY4      -----------
Q3K0T0      -----------
C5NWJ8      -----------
F3A499      -----------
Q4JZ55      -----------
G5JTD5      -----------
G3G7C1      -----------
G3G7J9      -----------
G3G7G6      -----------
G8DUB0      -----------
G3G7I8      -----------
G3G7J4      -----------
G7SG34      -----------
G8DTZ0      -----------
G8DU07      -----------
A4VTU3      -----------
G7SNU6      -----------
G8DU31      -----------
D5AGQ5      -----------
Q9X4U7      -----------
A3CQY2      -----------
E8KLY9      -----------
F0FHA8      -----------
F0I4H5      -----------
F0IAY3      -----------
F0IJI2      -----------
F0IS53      -----------
F2C9N0      -----------
F2CH53      -----------
F3SM32      -----------
F3UDW7      -----------
F3UNJ4      -----------
F0FQQ5      -----------
D6R2T8      -----------
F3UUQ2      -----------
E6IZC2      -----------
G6A745      -----------
A8AZR3      -----------
F9HJP6      -----------
Q4JYT9      -----------
Q4JZY1      -----------
E1LQJ7      -----------
F9HC65      -----------
E1LPE7      -----------
F9MJW5      -----------
E8KDN2      -----------
E8K322      -----------
F9PEU4      -----------
F9PZP7      -----------
C1CBD1      -----------
Q7WVX0      -----------
P96475      -----------
Q9AHD2      -----------
Q4K2Q7      -----------
Q4K0T5      -----------
Q4K0E1      -----------
Q9AH95      -----------
Q4K1M4      -----------
Q4JZ18      -----------
Q54520      -----------
Q4JYH5      -----------
Q4K0V2      -----------
A5M4L1      -----------
B2ILP5      -----------
C1CCB9      -----------
Q4K1S7      -----------
P72512      -----------
Q4JZ84      -----------
Q4K0X5      -----------
Q4K0Z6      -----------
Q4K195      -----------
Q4K0A0      -----------
Q4K0K2      -----------
Q4K1F9      -----------
Q4K045      -----------
G6C7Z1      -----------
D2ERX8      -----------
F9LZC4      -----------
F9P1W8      -----------
I0J9C9      -----------
A6YIA8      -----------
Q4K005      -----------
Q4JZL7      -----------
E5F5C5      -----------
Q4JZG7      -----------
Q4JZK1      -----------
A5LJS0      -----------
Q9AHB7      -----------
Q4K1B7      -----------
Q4JYK8      -----------
Q4K0M3      -----------
Q9AHA4      -----------
Q9X9A1      -----------
Q9ZII6      -----------
Q8KWQ0      -----------
Q4JZW7      -----------
Q4JYX9      -----------
Q4K0R7      -----------
Q4K1K6      -----------
Q4JZS3      -----------
Q4K0I2      -----------
Q4K254      -----------
Q4K237      -----------
B1I967      -----------
G6J8A4      -----------
G6LKG5      -----------
Q9ZFT8      -----------
D6ZQI8      -----------
Q4K2A8      -----------
Q8VU31      -----------
Q4K2E1      -----------
Q4K2F7      -----------
A5YTV7      -----------
F9Q345      -----------
Q6L5R0      -----------
A5YTT9      -----------
E6KKS0      -----------
F2QF90      -----------
E0Q2S8      -----------
A1ILY1      -----------
Q6L5T0      -----------
E9FEC5      -----------
E0PPH9      -----------
F5VSG9      -----------
E3CBS0      -----------
F9M366      -----------
E8K786      -----------
F8DFF4      -----------
I1ZPH7      -----------
E7S8W3      -----------
D0RXH2      -----------
Q83YR5      -----------
Q8GP54      -----------
F8HDC3      -----------
F8LJ75      -----------
E9DM17      -----------
I0QIK6      -----------
E8KUY8      -----------
Q7X553      -----------
Q8GP92      -----------
Q7X561      -----------
Q7X549      -----------
G6ERT1      -----------
O87931      -----------
Q8GPF6      -----------
Q7X555      -----------
Q7X557      -----------
Q7X563      -----------
Q8GMA5      -----------
Q8GPA8      -----------
Q55205      -----------
C2LSE6      -----------
Q7X559      -----------
F8LXJ4      -----------
Q1WCR1      -----------
Q8GPC3      -----------
E8JMT9      -----------
F5X0J9      -----------
H2A602      -----------
E0PD83      -----------
F5X652      -----------
G5KD11      -----------
B9DUJ4      -----------
G5KAJ2      -----------
F1Z124      -----------
Q2KM74      -----------
C6LDI8      -----------
D4J4T6      -----------
D4LTH2      -----------
D4LG06      -----------
A7VF42      -----------
A8SQS8      -----------
D5HFS4      -----------
C9LAS1      -----------
F3AH92      -----------
I5ASF8      -----------
E7GL81      -----------
G5F9E2      -----------
E7GL57      -----------
G5F9A9      -----------
E7GL40      -----------
G5F9H2      -----------
A8RK85      -----------
G5HTB2      -----------
G5HNC5      -----------
C0CZV9      -----------
A8RSK9      -----------
C5EN03      -----------
G5HG45      -----------
D9ST44      -----------
G2Z8Q3      -----------
C8W5K2      -----------
F5LM71      -----------
D7VBW4      -----------
F9UQ54      -----------
H6LKR8      -----------
E0I7B5      -----------
D7UYE4      -----------
Q4A120      -----------
D9SVC7      -----------
D9S1J9      -----------
C0GGR5      -----------
C6CSC8      -----------
A3ICA3      -----------
B1HR41      -----------
D6Y034      -----------
Q8EME8      -----------
F3Y922      -----------
G4L594      -----------
C9B454      -----------
Q3XYS6      -----------
C9ALZ9      -----------
C9BUG7      -----------
D4RJF4      -----------
C8ZXT9      -----------
G5IRQ6      -----------
C9A6V5      -----------
C9CHY8      -----------
Q814Z0      -----------
B9IRQ6      -----------
B7HXB4      -----------
Q72XH8      -----------
A0RL70      -----------
Q6HB09      -----------
F0PU64      -----------
B7HFH1      -----------
B7IQS8      -----------
B3ZRD6      -----------
B5UQ73      -----------
G9QCG3      -----------
Q3EV64      -----------
Q5WBB4      -----------
B1YMM5      -----------
D7WMM8      -----------
A7Z921      -----------
I2CAF2      -----------
A7Z9K0      -----------
I2CB16      -----------
I2HW53      -----------
G9QKR4      -----------
D5DBK3      -----------
D5DY81      -----------
Q2BFS5      -----------
A4ITF3      -----------
C5D961      -----------
G8MZ93      -----------
C6CW37      -----------
G9RSY9      -----------
F7K9V1      -----------
F7K8E9      -----------
F7KL96      -----------
B9Y884      -----------
A5Z5P9      -----------
F2I6Z7      -----------
D4YHG7      -----------
C1J9I3      -----------
B1MZT1      -----------
H1WR06      -----------
H1X4N2      -----------
Q03W95      -----------
F0SX22      -----------
B6W7H4      -----------
F0GT81      -----------
B1R3X6      -----------
Q8XN76      -----------
B1BNK1      -----------
B1V0N7      -----------
Q0SVR8      -----------
B1BNH3      -----------
Q8XN46      -----------
B1V1Z4      -----------
G5GFW0      -----------
C2EFR6      -----------
F3ATF5      -----------
D4M2S0      -----------
F4BS19      -----------
D4CG08      -----------
D4MP30      -----------
C6LCS5      -----------
B0P2G2      -----------
D4MW29      -----------
E5VMX8      -----------
D4JMC2      -----------
D6E0V4      -----------
D6E330      -----------
C4Z8M5      -----------
D4JI67      -----------
D3AC80      -----------
G5IFS3      -----------
D4RX67      -----------
A6BIG7      -----------
C0C0F8      -----------
Q97EP8      -----------
Q97ER5      -----------
D2RIR2      -----------
G0VNK6      -----------
I0GRR2      -----------
A0PZ02      -----------
B1B736      -----------
F6BI62      -----------
Q8RBS5      -----------
G2MWC2      -----------
B0K4N1      -----------
B0KAR5      -----------
E8UV29      -----------
C7ISF7      -----------
C9AAE5      -----------
H7F6C8      -----------
H7F5T6      -----------
B1R3V1      -----------
D4YF13      -----------
E6U7N4      -----------
C8VYQ6      -----------
D3AE78      -----------
A4J8V0      -----------
A8U9F4      -----------
F4BSD9      -----------
F7V792      -----------
F6IR93      -----------
G0M0F9      -----------
F6ITB4      -----------
G0M1X9      -----------
G0LYN9      -----------
D7VC13      -----------
F9UMZ6      -----------
I5AV01      -----------
B0GAL3      -----------
G1WUK2      -----------
E0RZL3      -----------
D8FLF8      -----------
F0K0J7      -----------
Q1G8E4      -----------
C4VP08      -----------
D6S4X4      -----------
D0DJH0      -----------
C7XKF3      -----------
E3R264      -----------
D5GZJ8      -----------
C2EPK5      -----------
A4ZGZ8      -----------
A8YX89      -----------
F0NWJ7      -----------
E4SMV5      -----------
F0TGY2      -----------
Q5FIC7      -----------
F2M2M6      -----------
G7M0Q3      -----------
G7M1R9      -----------
A6M2L9      -----------
G7M566      -----------
G2KUP1      -----------
G8PE06      -----------
Q03GL8      -----------
E0NHP4      -----------
F4FXQ7      -----------
C0WV35      -----------
H1LCW3      -----------
C2JZS1      -----------
Q58Z10      -----------
E9SAU1      -----------
Q38VG5      -----------
F0HVF1      -----------
G6F8G9      -----------
C2EWM3      -----------
F8DRU2      -----------
B3XL23      -----------
F8KGP1      -----------
H4GK03      -----------
B2GF33      -----------
C0WW26      -----------
D0DSJ4      -----------
C0ZHV8      -----------
H1BJT1      -----------
F8FCE2      -----------
H6NE43      -----------
I0BSG4      -----------
Q83VF9      -----------
G8P3D7      -----------
O06030      -----------
G9M880      -----------
G6FD42      -----------
F9VC44      -----------
A9QSJ4      -----------
Q3ZK50      -----------
E3GPC6      -----------
G0V447      -----------
H7F1R7      -----------
E6UHY4      -----------
D9QTC6      -----------
D9SR41      -----------
P95696      -----------
Q2G1K7      -----------
A8YPQ5      -----------
Q2FUV2      -----------
P39851      -----------
C5QNG4      -----------
Q4L9H7      -----------
E4Q5T5      -----------
E4SDX4      -----------
E4S7Y6      -----------
C6CS80      -----------
E6LD64      -----------
F0EKB9      -----------
H7F571      -----------
F5LE48      -----------
E7RDR3      -----------
E7RG08      -----------
F6CNF5      -----------
G2FWX4      -----------
G2FM59      -----------
G7WJV1      -----------
H5XZD4      -----------
H5XZG7      -----------
G7W773      -----------
G2FWT8      -----------
I4DBG8      -----------
C0EBA6      -----------
Q9K6R0      -----------
I2HVL2      -----------
D4G1R2      -----------
G4EQZ7      -----------
P71051      -----------
E0U2Z3      -----------
G4P114      -----------
A9VRC3      -----------
C2QJY5      -----------
C2RG49      -----------
C2T8T6      -----------
C2MTG3      -----------
C2SSX8      -----------
C2YZB2      -----------
C3GBJ8      -----------
C2SBU4      -----------
C2NQN6      -----------
C3GRR0      -----------
C2PN22      -----------
C2Y452      -----------
C2WVG6      -----------
C3EBC0      -----------
C2XJH9      -----------
C2P8H3      -----------
C2ULR6      -----------
C2V4M2      -----------
C3H979      -----------
G2TR25      -----------
P96716      -----------
G4EQF3      -----------
D4G2E1      -----------
I0F9R6      -----------
E0TTZ6      -----------
G4P1M7      -----------
A8FHL9      -----------
Q5KUM5      -----------
D3FZP4      -----------
I0JRK4      -----------
I3EBB3      -----------
                       

© 1998-2019