BYKdb

Dataset for cluster tadcd of phylum firmicutes

[Download (right click)] [Edit] [Sequences] [Repertoires]

251 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


S3FFL2          ------------------------MGVAPKQKGAFAGLPVQQAGDT--------------
A0A0T8KPS6      ------------------------MTTMPRPIYET------KEDKD--------------
A0A0T8LA03      ------------------------MTALTRSSLEY------DADNR--------------
A0A328M4V1      --------------------------MTTRQTFS-------PRDDD--------------
A0A1G6BLB6      -------------------------------MQFEERNEEPVQLFR--------------
B5CSZ7          ---------------------------MRGGNMSQESYKSQSLDSQ--------------
A0A1C6G8M0      ----------------------MGGVCDFMENKKAVAV-ENAAEDT--------------
A0A416MP73      -----------------------------MESKEITAMGASAEEDT--------------
A0A396G6S7      ----------------------------------MEERIDNETVQQ--------------
A0A3E5A223      ----------------------------------MEERIDNETVQQ--------------
R7D5E6          ----------------------------------MEERIDNETVQQ--------------
A0A415HQH5      ----------------------------------MEERIDNETVQQ--------------
A0A414W2C6      ----------------------------------MEERIDNETVQQ--------------
A5ZNE7          ----------------------------------MEERIDNETVQQ--------------
A0A395X821      ----------------------------------MEERIDNETVQQ--------------
A0A1C5PY68      ----------------------------------MEERIDNETVQQ--------------
A0A174CJF8      ----------------------------------MEERIDNETVQQ--------------
A0A174R7V0      ----------------------------------MEERIDNETVQQ--------------
A0A173ZYY6      ------------------------------MESSNRNDMPVFMDND--------------
A0A3D0F0Y4      ------------------------------MESSNRNDMPVFMDND--------------
A0A174ASH7      ------------------------------MESNNRNDMPAFMDTD--------------
A0A173SMI2      ------------------------------MESNNRNDMPAFMDTD--------------
A0A174GP12      ------------------------------MESNNRNDMPAFMDTD--------------
A6BH65          ------------------------------MESSNRNDMPVFMDND--------------
R7G0D7          ------------------------------MESSNRNDMPVFMDND--------------
A0A373MWV2      -------------------------MRRFQMGEYDRTGNGQNGEAD--------------
A0A417CE88      -------------------------MRRFQMGEYDRTGNGQNGEAD--------------
A0A416Y441      -------------------------MRRFQMGEYDRTGNGQNGEAD--------------
A0A357GPJ7      -------------------------MRRFQMGEYDRTGNGQNGEAD--------------
A0A396PAC1      -------------------------MRRFQMGEYDRTGNGQNGEAD--------------
A0A416EYU4      -------------------------MRRFQMGEYDRTGNGQNGEAD--------------
A0A416SCQ2      -------------------------MRRFQMGEYDRTGNGQNGEAD--------------
A0A416TGN7      -------------------------MRRFQMGEYDRTGNGQNGEAD--------------
A0A417SMF6      -------------------------MRRFQMGEYDRTGNGQNGEAD--------------
A0A1Y4MW77      ------------------------------MEEKNIEQDEITIDLT--------------
R6UHV6          ------------------------MNNSQDDLKAQDDLKEQDANYS--------------
A0A3R9Q621      --------------------------------------------ME--------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------MGEYDRTGNGQNGEAD--------------
A0A174S8E9      ------------------------------MREYDRTGNGQNGEAD--------------
A0A416ZL97      ------------------------------MGEYDRTGNGQSSKTD--------------
A0A174LSK1      ------------------------------MGEYDRTGNGQSSKTD--------------
A0A373GY92      ------------------------------MGEYDRTGNGQSSKTD--------------
A0A373NZQ6      ------------------------------MGEYDRTGNGQSSKTD--------------
A0A417I9B9      ------------------------------MGEYDRTGNGQSSKTD--------------
A0A417MP97      ------------------------------MGEYDRTGNGQSSKTD--------------
A0A417WQF8      ------------------------------MGEYDRTGNGQSSKTD--------------
A0A373RZ83      ------------------------------MGEYDRTGNGQSSKTD--------------
A0A416U6I1      ------------------------------MGEYDRTGNGQSSKTD--------------
R7JQZ9          ------------------------------MGEYDRTGNGQSSKTD--------------
A0A1M5UYN6      ----------------------------------------MQKDDR--------------
A0A176JBT8      ------------------------------------------MEKT--------------
A0A1I5HIC6      --------------------------------------MPNNNDIE--------------
A0A1Y3TC51      ------------------------------------MNGERFSLAE--------------
A0A1Y3T1N0      ------------------------------------MNRELFRLDE--------------
A0A1Y3Y8U8      ------------------------------------MNRELFRLDE--------------
A6CLL4          ------------------------------------------MNQS--------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      --------------------------MVFMNSDEVMIVNEDEDEVT--------------
A0A1Q6KSQ5      ---------------------MLGGVCDFMENKKAVAV-ENAAEDT--------------
A0A3D3U8B3      ---------------------MLGGVCDFMENKKAVAV-ENAAEDT--------------
A0A3E5FRL7      ------------------------------------MNQDEINLDS--------------
A0A1Y4QK93      ------------------------------------MNQDEINLDS--------------
B1C232          ------------------------------------MNQDEINLDS--------------
A0A401USI6      ----------------------------------------MREEND--------------
A0A1V4IQ10      -----------------------------------------MDSET--------------
A0A1S8TRD2      -----------------------------------------MDSET--------------
G7M1U2          -----------------------------------------MDSET--------------
A0A2T6KJ75      ------------------------------------------MNRT--------------
A9KN92          -------------------------------------MQNNNNDIE--------------
A0A352MUJ1      -------------------------------------------MEE--------------
R5YI67          -------------------------------------------MEE--------------
A0A1Y0IQP5      --------------------------------------------ME--------------
A0A1M6E8I2      ------------------------------------------MGEE--------------
A0A1Y4N105      --------------------------------------MMEFRIND--------------
A0A1Y4QP75      --------------------------------------MMEFRIND--------------
A0A3D4QRB5      -------------------------------------------MEE--------------
A0A2X2LGT4      -----------------------------------------MGESR--------------
A0A349DEH5      ----------------------------------MRSEKKNQKGLE--------------
A0A3D4T7B4      ----------------------------------MRSEKKNQKGLE--------------
A0A350XYC7      --------------------------------MKSYSDRKSSKGLE--------------
R6DNR8          --------------------------------MKSYSERKSSKGLE--------------
A0A355KUM5      --------------------------------MKSYSDRKNSKGIE--------------
R5YGY6          --------------------------------MKSYSDRKNSKGIE--------------
A0A0K8J554      --------------------------------------------ME--------------
A0A2S4GG02      --------------------------------------MFKIILTN--------------
A0A3N1XSX6      --------------------------------------------ME--------------
A0A1C6G0U3      ------------------------------------------MKEK--------------
A0A3D4LLB3      --------------------------------------MYEEEFND--------------
A0A0A5GPA9      ------------------------------------------MGQA--------------
A0A271M6M4      ------------------------------------------MNEA--------------
A0A1V5LU59      -------------------------------MEKGIGRMENNDFVE--------------
A0A1E3BVC3      --------------------------------------MEKDDILE--------------
A3DF66          --------------------------------------MEKDDILE--------------
W4V1T8          --------------------------------------MEKDDILE--------------
A0A2V3W8U6      ------------------------------------------MDQT--------------
W1UFG0          ----------------------------------------MKDTMT--------------
A0A351SRI8      -------------------------------------------MEE--------------
A0A1I0RG99      --------------------------------------------ME--------------
A0A1I5G322      --------------------------------------------ME--------------
A0A1C6ITD7      ---------------------------------------------M--------------
A0A381IX63      ------------------------------------------MEQK--------------
A0A1G9IUT4      ------------------------------------------MEEI--------------
A0A1M6RWV2      ---------------------------------------MEAYEYE--------------
A0A3R9WAA7      ---------------------------------MNYNDAAFGEVYT--------------
R5EFZ0          --------------------------------MENTSKSNMQSARL--------------
A0A0H5SF45      --------------------------------------------ME--------------
A0A1M6JRJ5      --------------------------------------------ME--------------
A0A1M7Y1S2      --------------------------------------------ME--------------
A0A143XN92      ---------------------------------MQKYRDTNEMELK--------------
A0A3D5R4X5      -----------------------------------MTREERYLEEE--------------
A0A3E4LL92      --------------------------------MSQESYKSQSLDSQ--------------
A0A415D1L1      --------------------------------MSQEGYKSQSLDSQ--------------
A0A414P2K5      --------------------------------MIQEGYKSQSLDSQ--------------
V8C417          --------------------------------MSQESYKSQSLDSQ--------------
W6RXP9          --------------------------------MEQ----EILEKE---------------
W6S4G8          --------------------------------MEEVKVVEEFSNE---------------
R5B467          -------------------------------------MNEQRQGHT--------------
A0A143WVN6      --------------------------------MEFQIDD---------------------
A0A3B8KKL6      --------------------------------MERNNFEE--------------------
A0A2K9E6R0      --------------------------------MERNNFEE--------------------
A0A2S8RBI0      --------------------------------MERNNFEE--------------------
A0A0L6JLG6      --------------------------------MQDKDFVE--------------------
G8LSN0          --------------------------------MGKNDYIE--------------------
A0A1Q6REE0      --------------------------------MEIEKTEQQGRDTF--------------
R5ETF9          --------------------------------MEIEKTEQQGRDTF--------------
A0A0X9GDD0      ------------------------------------------------------------
U2A8X2          ------------------------------------------------------------
U2AC50          ------------------------------------------------------------
A0A1I4C3N6      --------------------------------MFKIFFAN--------------------
A0A3B9CIM7      --------------------------------MFKTILSN--------------------
A0A1G9WHW8      --------------------------------MFKIIVAN--------------------
A0A1H5VAA0      --------------------------------MFKIIVAN--------------------
A0A3R6VK11      --------------------------------MLETILNN--------------------
A0A3R6QUY7      --------------------------------MLETILNN--------------------
A0A373K3P9      --------------------------------MLETILNN--------------------
A0A3R6JRU5      --------------------------------MLETILNN--------------------
A0A1C5MS04      --------------------------------MLETILNN--------------------
A0A3C1J150      --------------------------------MLETILNN--------------------
A0A416CXD7      --------------------------------MLETILNN--------------------
R6XBL9          --------------------------------MLETILNN--------------------
A0A355W5Z7      --------------------------------MLETILNN--------------------
A0A143ZUX1      -----------------------------------MYEQNTSATPS--------------
A0A143XPI5      -------------------------------------MKEEYSREP--------------
A0A355G1X5      -------------------------------MNTNVNTTSAPKGLE--------------
A0A0M6WXE3      -------------------------------MENNRENASAQTETE--------------
A0A348SAK2      -----------------------------MKMENNRENASAQTETE--------------
A0A1W1Z4C3      ---------------------------------------MNKQSGS--------------
A0A239QN83      ---------------------------------------MNKQGGS--------------
A0A1G9H5B9      ---------------------------------------MKKKANQ--------------
A0A1G6BLF1      ------------------------------------------------------------
A0A1Y4H8L0      -------------------------------MNKDENFNEILQTSR--------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------MKKS--------------
A0A373MPB9      ------------------------------------------MKKN--------------
A0A373L519      ------------------------------------------MKKN--------------
A0A373W906      ------------------------------------------MKKN--------------
A0A373VCW2      ------------------------------------------MKKN--------------
W0U604          ------------------------------------------MKKN--------------
A0A374B6G0      ------------------------------------------MKKN--------------
A0A373VM36      ------------------------------------------MKKN--------------
A0A1C5P379      ------------------------------------------MKKN--------------
A0A373XXX0      ------------------------------------------MKKN--------------
A0A356CW82      ------------------------------------------MKKN--------------
R6T4X7          ------------------------------------------MKKN--------------
A0A374HTV1      ------------------------------------------MKKN--------------
A0A374GB66      ------------------------------------------MKKN--------------
A0A374ECC6      ------------------------------------------MKKN--------------
A0A374BM61      ------------------------------------------MKKN--------------
A0A373UGZ4      ------------------------------------------MKKN--------------
A0A373SA66      ------------------------------------------MKKN--------------
A0A1C5X6X7      ------------------------------------------MKKN--------------
A0A1C6JIH3      ------------------------------------------MKKN--------------
A0A373PSC3      ------------------------------------------MKKN--------------
A0A1K1WYK8      ------------------------------------------MKNT--------------
A0A1H6IUB1      ------------------------------------------MDNG--------------
A0A1M7L1F9      ------------------------------------------MNNS--------------
A0A1C6B4L6      ------------------------------------------MENS--------------
A0A1Q6T9P4      ------------------------------------------MKNS--------------
A0A315Y4F9      ------------------------------------------MNQS--------------
A0A354K620      ------------------------------------------MNES--------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      -------------------------------------------MQD--------------
A0A2T5IYJ6      -------------------------------MEILDKNLSPQQEDS--------------
A0A252F281      ------------------------------------MEEKRWSLAS--------------
A0A348SAK1      ----------------------------------MDEMREKSGKEQ--------------
A0A0M6WYQ8      ----------------------------------MDEMREKSGKEQ--------------
A0A173TM61      ----------------------------------MDEMREKSGKEQ--------------
A0A1Y4QKE6      MMKFVIMIMVIVIMIIKTIGMKVGDIMDEQRLKESMLEDDNIEIDL--------------
B1C231          ------MTMVIVIMIIKPIDMKVGDIMDEQRLKESMMEDDSIEIDL--------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ---------MIVIIMIMVIVIMIIKPIDMKVGDIMDEQRLKESMME--------------
A0A1Y3T163      MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENRE--------------
A0A1Y3YCA2      MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENRE--------------
A0A1Y4L6N9      --------------------------------------MSELNHAE--------------
A0A173T644      ---------------------------------------MDERLED--------------
A0A1C5TSB8      ---------------------------------------MDERLED--------------
C0CIK6          -------------------------------------MTVDERLED--------------
A0A1Y3WEF6      --------------------------MAEQDRYGGNSQNLSRKIEE--------------
A0A417T0L2      --------------------------MAERDLYSKNNQNLSRRIDE--------------
A0A1H9EPU3      ----------------------------------MSNQTDEKFFQDDIGQTPGKILENAP
A0A354IGV3      ------------------------------------MEKKQSLGSA--------------
A0A417JMV2      ----------------------------------MSSDKRNISVND--------------
A0A415VWX5      ----------------------------------MSSDKRNISVND--------------
A0A173UY96      ----------------------------------MSSDKRNISVND--------------
A0A173QTL1      ----------------------------------MSSDKRNISVND--------------
B0P408          ----------------------------------MSSDKRNISVND--------------
D4MV82          ----------------------------------MSSDKRNISVND--------------
A0A174A3T7      ----------------------------------MSSDKRNISVND--------------
A0A1Q6K0H6      ----------------------------------MSSDKRNISVND--------------
A0A174J359      ----------------------------------MSSDKRNISVND--------------
A0A417UUA3      ----------------------------------MSSDKRNISVND--------------
A0A1C6EUV9      ----------------------------------MSNEKHNISVND--------------
A0A173Y645      ----------------------------------MSNEKHNISVND--------------
A0A374AVY6      ----------------------------------MSNEKHNISVND--------------
R7BXS4          ----------------------------------MSNEKHNISVND--------------
A0A1V5S3C0      ----------------------------------MSGSDYNASVRD--------------
A0A1Y3TC98      ------------------------------------MQDQRNRIDE--------------
R6VAT5          ------------------------------------MEKKFVPENS--------------
A0A1Q6S448      -----------------------------------------MDENN--------------
A0A351MYR0      -----------------------------------------MEEKN--------------
R6HPC1          -----------------------------------------MDEKN--------------
A0A3D4G5Z5      -----------------------------------------MDEKN--------------
A0A3D5ES03      -----------------------------------------MDEKN--------------
A0A0F2P7X6      ------------------------------------MEHQGLNNGV--------------
A0A359B487      ------------------------------------MEHQGLNNGV--------------
A0A348P5V4      ------------------------------------MNYNSEPKKD--------------
A0A356PT74      ------------------------------------MAYSSSGKTH--------------
A0A3D5LL19      ------------------------------------MAYSSSGKTH--------------
R5MNF0          ------------------------------------MAYSSSGKTH--------------
A0A1Q9JSI0      -------------------------------------MSE--NKNT--------------
A0A3D5TNI1      -------------------------------------MNRIVKKDT--------------
A0A358LJD0      -------------------------------------MSKIVRKDT--------------
R6I3L7          -------------------------------------MSKIVRKDT--------------
A0A3D1HXX0      -------------------------------------MSKIVRKDT--------------
A0A3D2QJB8      -------------------------------------MSKIVRKDT--------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------MKND--------------
                                                                            

S3FFL2          ---------------------------------------PIIRQYM----RIANRWRWV-
A0A0T8KPS6      ---------------------------------------IDLAHLF----DTFINNRML-
A0A0T8LA03      ---------------------------------------IDLAGIM----RTAYDHKAL-
A0A328M4V1      ---------------------------------------VDLRALI----GTLLDNKWL-
A0A1G6BLB6      ---------------------------------------FNGYTVG----RDIIKHMKM-
B5CSZ7          ---------------------------------------IDLRYIF----RTLKKNAVF-
A0A1C6G8M0      ---------------------------------------IDLLEIF----RALYRRWVW-
A0A416MP73      ---------------------------------------IDLMEIF----RALRKRWYW-
A0A396G6S7      ---------------------------------------IDLISML----KDIGREWLT-
A0A3E5A223      ---------------------------------------IDLISML----KDIGREWLT-
R7D5E6          ---------------------------------------IDLISML----KDIGREWLT-
A0A415HQH5      ---------------------------------------IDLISML----KDIGREWLT-
A0A414W2C6      ---------------------------------------IDLISML----KDIGREWLT-
A5ZNE7          ---------------------------------------IDLISML----KDIGREWLT-
A0A395X821      ---------------------------------------IDLISML----KDIGREWMT-
A0A1C5PY68      ---------------------------------------IDLISML----KDIGREWLT-
A0A174CJF8      ---------------------------------------IDLISML----KDIGREWLT-
A0A174R7V0      ---------------------------------------IDLISML----KDIGREWLT-
A0A173ZYY6      ---------------------------------------LDPYTLV----HDIVSNWWV-
A0A3D0F0Y4      ---------------------------------------LDPYTLV----HDIVSNWWV-
A0A174ASH7      ---------------------------------------LDPYTLV----HDIVSNWWV-
A0A173SMI2      ---------------------------------------LDPYTLV----HDIVSNWWV-
A0A174GP12      ---------------------------------------LDPYTLV----HDIVSNWWV-
A6BH65          ---------------------------------------LDPYTLV----HDIVSNWWV-
R7G0D7          ---------------------------------------LDPYTLV----HDIVSNWWV-
A0A373MWV2      ---------------------------------------WDLRSIL----CDMAKNWWI-
A0A417CE88      ---------------------------------------WDLRSIL----CDMAKNWWI-
A0A416Y441      ---------------------------------------WDLRSIL----CDMAKNWWI-
A0A357GPJ7      ---------------------------------------WDLRSIL----CDMAKNWWI-
A0A396PAC1      ---------------------------------------WDLRSIL----CDMAKNWWI-
A0A416EYU4      ---------------------------------------WDLRSIL----CDMAKNWWI-
A0A416SCQ2      ---------------------------------------WDLRSIL----CDMAKNWWI-
A0A416TGN7      ---------------------------------------WDLRSIL----CDMAKNWWI-
A0A417SMF6      ---------------------------------------WDLRSIL----CDMAKNWWI-
A0A1Y4MW77      ---------------------------------------VLFRDFI----RGCIKFWWL-
R6UHV6          ---------------------------------------FDLASTL----QDLTKRWFV-
A0A3R9Q621      ---------------------------------------FTLAQVI----KLLYKRMLW-
A0A069RC75      ---------------------------------------MNGKKYI----GIFKRRKWL-
A0A174F2W5      ---------------------------------------WDLRSIL----CDMAKNWWI-
A0A174S8E9      ---------------------------------------WDLRSIL----CDMAKNWWI-
A0A416ZL97      ---------------------------------------WDLRSIL----CDIAKNWWV-
A0A174LSK1      ---------------------------------------WDLRSIL----CDIAKNWWV-
A0A373GY92      ---------------------------------------WDLRSIL----CDIAKNWWV-
A0A373NZQ6      ---------------------------------------WDLRSIL----CDIAKNWWV-
A0A417I9B9      ---------------------------------------WDLRSIL----CDIAKNWWV-
A0A417MP97      ---------------------------------------WDLRSIL----CDIAKNWWV-
A0A417WQF8      ---------------------------------------WDLRSIL----CDIAKNWWV-
A0A373RZ83      ---------------------------------------WDLRSIL----CDIAKNWWV-
A0A416U6I1      ---------------------------------------WDLRSIL----CDIAKNWWV-
R7JQZ9          ---------------------------------------WDLRSIL----CDIAKNWWV-
A0A1M5UYN6      ---------------------------------------LDLRDYL----HIIKKKIMV-
A0A176JBT8      ---------------------------------------FEIKDLL----NILRKNKIL-
A0A1I5HIC6      ---------------------------------------IDIGDLF----FLLLHKMWF-
A0A1Y3TC51      ---------------------------------------ISVRGLC----MDLFRNAWM-
A0A1Y3T1N0      ---------------------------------------ISIRGLC----LELLQSLWM-
A0A1Y3Y8U8      ---------------------------------------ISIRGLC----LELLQSLWM-
A6CLL4          ---------------------------------------LTLKELF----QILQNHFWL-
A0A174DL89      ---------------------------------------MNKFKYF----KLIKEKLSI-
A0A176U8D6      ---------------------------------------IDFFGIF----HAIAKRWYI-
A0A1Q6KSQ5      ---------------------------------------IDLLEIF----RALYRRWVW-
A0A3D3U8B3      ---------------------------------------IDLLEIF----RALYRRWVW-
A0A3E5FRL7      ---------------------------------------INYRGII----RDLLKNWWI-
A0A1Y4QK93      ---------------------------------------INYRGII----RDLLKNWWV-
B1C232          ---------------------------------------INYRGII----RDLLKNWWI-
A0A401USI6      ---------------------------------------IEFNDYL----NIIRKKIVV-
A0A1V4IQ10      ---------------------------------------ISIEEIF----QILKKKWKL-
A0A1S8TRD2      ---------------------------------------TSIEEIF----QILKKKWKL-
G7M1U2          ---------------------------------------ISIEEIF----QILKKKWKL-
A0A2T6KJ75      ---------------------------------------MEIRDFI----RLFKKKKKV-
A9KN92          ---------------------------------------INLGEIF----ILLLHKIWI-
A0A352MUJ1      ---------------------------------------IDLKELL----KLFWKKKIL-
R5YI67          ---------------------------------------IDLRDLL----KLFWKRKAI-
A0A1Y0IQP5      ---------------------------------------MGLAEMG----RVIRQRVLL-
A0A1M6E8I2      ---------------------------------------WNLLELV----QIVLKRKWI-
A0A1Y4N105      ---------------------------------------IDLRSII----VDMVRNCWM-
A0A1Y4QP75      ---------------------------------------IDLRSII----VDVIRNCWM-
A0A3D4QRB5      ---------------------------------------LDIRDII----HIIRKHFWI-
A0A2X2LGT4      ---------------------------------------VSLRVIA----SSLRKFWWM-
A0A349DEH5      ---------------------------------------INVLAFF----KELSKKLWI-
A0A3D4T7B4      ---------------------------------------INVLAFF----KELSKKLWI-
A0A350XYC7      ---------------------------------------INIVAFF----RELSKKIWI-
R6DNR8          ---------------------------------------INILAFF----KELSKKLWI-
A0A355KUM5      ---------------------------------------INILAFF----KELSKKLWI-
R5YGY6          ---------------------------------------INILAFF----KELSKKLWI-
A0A0K8J554      ---------------------------------------LSLKEII----ELIYKRLKL-
A0A2S4GG02      ---------------------------------------FNLEKIF----WIMKSRIKY-
A0A3N1XSX6      ---------------------------------------FTVKEII----KLILKRLIW-
A0A1C6G0U3      ---------------------------------------LDFIEVL----KIINKRKII-
A0A3D4LLB3      ---------------------------------------IDLREIF----QIIRKYLAL-
A0A0A5GPA9      ---------------------------------------FGLKEVY----QVIRRRVVL-
A0A271M6M4      ---------------------------------------VGLREIF----NIIKKEYLI-
A0A1V5LU59      ---------------------------------------IDLREIF----FTILRKWYL-
A0A1E3BVC3      ---------------------------------------IDIREMV----YLLLKKWYL-
A3DF66          ---------------------------------------IDLREIV----YILLKKWYL-
W4V1T8          ---------------------------------------IDLREIV----YILLKKWYF-
A0A2V3W8U6      ---------------------------------------FQIRDFL----QIFKKRIKF-
W1UFG0          ---------------------------------------ISLRELF----TIIKRKLWI-
A0A351SRI8      ---------------------------------------FNILEFL----KYYWNKILI-
A0A1I0RG99      ---------------------------------------FSFKEIL----EILAKRFVF-
A0A1I5G322      ---------------------------------------FTLKEIF----EIFMKRIVF-
A0A1C6ITD7      ---------------------------------------KNILYYL----DIIKKHLTL-
A0A381IX63      ---------------------------------------IEIKEYL----QLIRKRMKI-
A0A1G9IUT4      ---------------------------------------INLRQCF----QIIKKNISL-
A0A1M6RWV2      ---------------------------------------IDLRELF----EIILNKLWL-
A0A3R9WAA7      ---------------------------------------IDLSGIGRNFLRGLKKLFWL-
R5EFZ0          ---------------------------------------LPFDPIV--LVQDVLKRWLV-
A0A0H5SF45      ---------------------------------------LSIKDVL----GIIYKRLIF-
A0A1M6JRJ5      ---------------------------------------FTVTDIL----HLLKKRFIL-
A0A1M7Y1S2      ---------------------------------------FTVRDIL----YLIKKRFIL-
A0A143XN92      ---------------------------------------IDIRTMI----KDVLRYSWL-
A0A3D5R4X5      ---------------------------------------IDIRQLF----HILRKRLGW-
A0A3E4LL92      ---------------------------------------IDLRYIF----RTLKKNAVF-
A0A415D1L1      ---------------------------------------IDLRYIF----RTLKKNAVF-
A0A414P2K5      ---------------------------------------IDLRYIF----RTLKKNAVF-
V8C417          ---------------------------------------IDLRYIF----RTLKKNAVF-
W6RXP9          ---------------------------------------ISISEIM----EALQKRWKM-
W6S4G8          ---------------------------------------ISFSQII----FALKKRWKI-
R5B467          ---------------------------------------IDLAELLGRFARSLRRLWWLC
A0A143WVN6      ---------------------------------------IDFRSIV----LDLIKNIWVI
A0A3B8KKL6      ---------------------------------------IDVREIF----FLLLRKWYV-
A0A2K9E6R0      ---------------------------------------IDVREIF----FLLLRKWYV-
A0A2S8RBI0      ---------------------------------------IDVREIF----FLLLRKWYV-
A0A0L6JLG6      ---------------------------------------VDIRELI----LILLRKWYI-
G8LSN0          ---------------------------------------IDIREIL----IVLLKRWYL-
A0A1Q6REE0      ---------------------------------------VLLDDFL----HQAKRMWLLG
R5ETF9          ---------------------------------------VLLDDFL----HQAKRMWLLG
A0A0X9GDD0      ---------------------------------------MTIVDFF----RLLRANLLL-
U2A8X2          ---------------------------------------MELKDYL----LLLRRRWVT-
U2AC50          ---------------------------------------MTLREYV----TAVLRHWVV-
A0A1I4C3N6      ---------------------------------------LHLEKIL----WIIKSKILY-
A0A3B9CIM7      ---------------------------------------FHLEKIF----WTLKKKALY-
A0A1G9WHW8      ---------------------------------------FHLEKIL----WIIKKNLTY-
A0A1H5VAA0      ---------------------------------------FHLEKIL----WIIKKNLTY-
A0A3R6VK11      ---------------------------------------FHLEKIL----WILQKRIAY-
A0A3R6QUY7      ---------------------------------------FHLEKIL----WILQKRIAY-
A0A373K3P9      ---------------------------------------FHLEKIL----WILQKRIAY-
A0A3R6JRU5      ---------------------------------------FHLEKIL----WILQKRIAY-
A0A1C5MS04      ---------------------------------------FHLEKIL----WILQKRIAY-
A0A3C1J150      ---------------------------------------FHLEKIL----WILQKRIAY-
A0A416CXD7      ---------------------------------------FHLEKIL----WILQKRIAY-
R6XBL9          ---------------------------------------FHLEKIL----WILQKRIAY-
A0A355W5Z7      ---------------------------------------FHLEKIL----WILQKRIAY-
A0A143ZUX1      ---------------------------------------PTTLRYF----RQLKKSWWI-
A0A143XPI5      -------------QRSEESIDIF----------------YLFNNVW----KGIRQFYWI-
A0A355G1X5      ---------------------------------------INVLFLL----KTVLKRWWI-
A0A0M6WXE3      ---------------------------------------FEPISLV----CDILKNWWV-
A0A348SAK2      ---------------------------------------FEPISLV----CDILKNWWV-
A0A1W1Z4C3      ---------------------------------------IDLARLA----VYILKRIWL-
A0A239QN83      ---------------------------------------IDLARLA----VYILKRIWL-
A0A1G9H5B9      ---------------------------------------IDLVKML----FFILKHLWL-
A0A1G6BLF1      -----MAEYSSRQGTAPSAIDLG----------------TIVDDVW----KGFWRIWWL-
A0A1Y4H8L0      ---------------------------------------LEPFTLV----RDILVNWWV-
R6HZX3          ------MQEHSYEHNTDQKVDLE----------------LIFRNFL----HVLKRTWWW-
A0A1W2CEA6      ---MKNKEKITGLTEEMTGISVRNTAPAAEGPAQEYYSGIDWVSVL----FRLLEKIHW-
R7FFK6          ---------------------------------------YTIKDLI----FLFLGHIWW-
A0A373MPB9      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A373L519      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A373W906      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A373VCW2      ---------------------------------------YTIKDLL----VLLLGKVWY-
W0U604          ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A374B6G0      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A373VM36      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A1C5P379      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A373XXX0      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A356CW82      ---------------------------------------YTIKDLL----VLLLGKVWY-
R6T4X7          ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A374HTV1      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A374GB66      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A374ECC6      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A374BM61      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A373UGZ4      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A373SA66      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A1C5X6X7      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A1C6JIH3      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A373PSC3      ---------------------------------------YTIKDLL----VLLLGKVWY-
A0A1K1WYK8      ---------------------------------------YTIKDLL----SLLWNHLML-
A0A1H6IUB1      ---------------------------------------YSIKDII----SLLLSKLWL-
A0A1M7L1F9      ---------------------------------------YSIKDII----NLLLSKLWL-
A0A1C6B4L6      ---------------------------------------YTIKELI----GLFLNKIWI-
A0A1Q6T9P4      ---------------------------------------YTIKELI----GLFLNKIWI-
A0A315Y4F9      ---------------------------------------YSIKDII----RLLLSHIWL-
A0A354K620      ---------------------------------------YSIKDIL----RLLLNHLWI-
A0A355G3J9      -------------------------------------MRLTLKDIA----MTVWRSIGL-
A0A3D2AD87      ---------------------------------------ISIMYLF----HLAWRRIWA-
A0A2T5IYJ6      ---------------------------------------IDLRHYW----NVVARFKWG-
A0A252F281      ---------------------------------------INLHTML----RDVWKNLWM-
A0A348SAK1      -------------QGEIEKIDLI----------------EFLRSFQ----YGIKKMWWL-
A0A0M6WYQ8      -------------QGEIEKIDLI----------------EFLRSFQ----YGIKKMWWL-
A0A173TM61      -------------QGEIEKIDLI----------------EFLRSFQ----YGIKKMWWL-
A0A1Y4QKE6      ---------------------------------------SELIHGF----LKILKDYWG-
B1C231          ---------------------------------------SELIHDF----LKILKDYWG-
A0A1Y3TUL5      -------------MNDEYIT-------------------IRLSDFL----HALIKNRGL-
A0A1Y4JAX2      -------------MNDEYIT-------------------IRLSDFL----HALIKNRGL-
A0A1Y4T590      -------------MNDEYIT-------------------IRLSDFL----HALIKNRGL-
A0A3C0QME1      -----------------MNDS------------------YTIKDII----SLLLSKLWL-
A0A355FYK5      -------------MQEDQRNSVNALLGNGLFGNGGSGGGLDLFKLL----RALLRRAWA-
A0A357AQU0      --------------MEQQKDEVE----------------IDLLELF----WALLRKWWM-
A0A3C1YJQ7      --------------MEQQKDEVE----------------IDLLELF----WALLRKWWM-
A0A3D0JG38      --------------MEQQKDEVE----------------IDLLELF----WALLRKWWM-
A0A3C0IHX1      ------MGTLNQKNKNKQDDETE----------------IDLGKLF----KALMQRLPI-
R5V506          ------MGTLNQKNKNKQDDETE----------------IDLGKLF----KALMQRLPI-
A0A352TIU5      ------MGTLNQKNKNKQDDETE----------------IDLGKLF----KALVRRLPI-
A0A3E5FSY5      --------------DDSIEIDLS----------------ELIHDFL----K-ILKDYWG-
A0A1Y3T163      --------------DDEMEIDLV----------------LLFGAFW----KSFTRLWWL-
A0A1Y3YCA2      --------------DDEMEIDLV----------------LLFGAFW----KSFTRLWWL-
A0A1Y4L6N9      --------------TEEMEIDIV----------------SLIQNFI----SGIFRWWWL-
A0A173T644      --------------REELEIDLG----------------ILLWNFL----QGLARFWWL-
A0A1C5TSB8      --------------REELEIDLG----------------ILLWNFL----QGLARFWWL-
C0CIK6          --------------REELEIDLG----------------ILLWNFL----QGLARFWWL-
A0A1Y3WEF6      --------------DD--AIDLR----------------TLFWNVI----QGILKFWWL-
A0A417T0L2      --------------DD--VIDLG----------------ALFWNVI----QGILRFWWL-
A0A1H9EPU3      VTPRKPAIINNNNIAKKTQDEET----------------IDLRQIF----GLLWVNKIL-
A0A354IGV3      -------------------FLSS----------------IDVSGAL----RAIVRNFWL-
A0A417JMV2      -------------------YETN----------------IDLYSIL----RDIWKYALV-
A0A415VWX5      -------------------YEMN----------------IDLYSIL----RDIWKYALV-
A0A173UY96      -------------------YEMN----------------IDLYSIL----RDIWKYALV-
A0A173QTL1      -------------------YEMN----------------IDLYSIL----RDIWKYAIV-
B0P408          -------------------YEMN----------------IDLYSIL----RDIWKYALV-
D4MV82          -------------------YEMN----------------IDLYSIL----RDIWKYALV-
A0A174A3T7      -------------------YEMN----------------IDLYSIL----RDIWKYAIV-
A0A1Q6K0H6      -------------------YEMN----------------IDLYSIL----RDIWKYAIV-
A0A174J359      -------------------YEMN----------------IDLYSIL----RDIWKYAIL-
A0A417UUA3      -------------------YEMN----------------IDLYSIL----RDIWKYAIV-
A0A1C6EUV9      -------------------YEMN----------------IDLYSIL----RDISKYIVV-
A0A173Y645      -------------------YEMN----------------IDLYSIL----RDISKYIVV-
A0A374AVY6      -------------------YEMN----------------IDLYSIL----RDISKYIVV-
R7BXS4          -------------------YEMN----------------IDLYSIL----RDISKYIVV-
A0A1V5S3C0      -------------EEYGVSFETI----------------LKLIRV-------IASKWWV-
A0A1Y3TC98      -------------REDEMEIDLG----------------LLFAGMW----KNIRRFWWL-
R6VAT5          -------------RSYTPVGEYA----------------SKILTG-------IKKHWYI-
A0A1Q6S448      -------------QGLQWSHIEP----------------LCILRA-------LARQLWM-
A0A351MYR0      -------------RGLQWSHIEP----------------YCLLRT-------LLRQLWM-
R6HPC1          -------------RGLQWSHIEP----------------YCLVRT-------LLRQLWM-
A0A3D4G5Z5      -------------RGLQWSHIEP----------------YCLVRT-------LLRQLWM-
A0A3D5ES03      -------------RGLQWSHIEP----------------YCLVRT-------LLRQLWM-
A0A0F2P7X6      -------------DRTEENEISL----------------GEIISA-------LFKWWWL-
A0A359B487      -------------NRTEENEISL----------------GEIISA-------LFKWWWL-
A0A348P5V4      -------------YEEGLSLDTA----------------LMYAKK-------LMDKWFV-
A0A356PT74      -------------AEESVNLDSV----------------VIYLKK-------ILQHWKI-
A0A3D5LL19      -------------AEESDNLDSV----------------VIYLKK-------ILQHWKI-
R5MNF0          -------------VEESDNLDSV----------------VIYLKK-------ILQHWKI-
A0A1Q9JSI0      -------------SINDYEMNID----------------LYS----------ICKDIWK-
A0A3D5TNI1      -------------DSDGVEINI-----------------MYVFGL-------LIRRLWL-
A0A358LJD0      -------------DSDGVEVNI-----------------MYVFGL-------LLRRLWL-
R6I3L7          -------------NSDGVEVNI-----------------MYAFGL-------LLRRLWL-
A0A3D1HXX0      -------------DSDGVEVNI-----------------MYAFGL-------LLRRLWL-
A0A3D2QJB8      -------------DSDGVEVNI-----------------MYAFGL-------LLRRLWL-
D4LC36          -------------MKKEYTIKD-------------------LVYL-------MLGRIWW-
R7MQJ4          -------------MESNYTIKK-------------------LIQL-------FLSKIYV-
A0A1V5GLC0      -------------MENTYSIKD-------------------LINL-------FLSKLWL-
W7V182          -------------GKDMLDLKS-------------------MVAL-------LLSKLWI-
                                                                            

S3FFL2          ILGIVAASLVAGLVITL--LMT-------PQ----YTATAQIEISREG------NQVTNF
A0A0T8KPS6      ILGITGFFAALGIAYAL--LAT-------PV----YLASAMIQIEPK-------SGLPSL
A0A0T8LA03      IIAITGLFTVLGVLYAL--IAT-------PI----YQATAMIQIEPKK------AAITGI
A0A328M4V1      IGITTAVFFALAVIYSV--LAT-------PI----YQSSAIVQVENTV------PSLPGL
A0A1G6BLB6      IIMISVAAMLLMYAYLAY-TYA-------ET----YTMTTTFTVVSAS-----TENDAYT
B5CSZ7          ILMCVCLTGMFSYVILDH-SLK-------DT----YTVSVNLCVIPRD-----NTSEKL-
A0A1C6G8M0      IVFTALVFGIALGMYGKF-VVK-------DV----FQAEASMCIIDSN-----KEVSIS-
A0A416MP73      IVLLAIIFGAALGVYGKF-IVK-------DA----YQAEASMCIIDSN-----KEVSMS-
A0A396G6S7      ILLLAIAAALFADIWICA-TYQ-------PE----YRTSTTFVVTAKG-----MNNNIYQ
A0A3E5A223      ILLLAIAAALFADIWICA-TYQ-------PE----YRTSTTFVVTAKG-----MNNNIYQ
R7D5E6          ILLLAIAAALFADIWICA-TYQ-------PE----YRTSTTFVVTAKG-----MNNNIYQ
A0A415HQH5      ILLLAIAAALFADIWICA-TYQ-------PE----YRTSTTFVVTAKG-----MNNNIYQ
A0A414W2C6      ILLLAIAAALFADIWICA-TYQ-------PE----YRTSTTFVVTAKG-----MNNNIYQ
A5ZNE7          ILLLAIAAALFADIWICA-TYQ-------PE----YRTSTTFVVTAKG-----MNNNIYQ
A0A395X821      ILLLAIAAALFADIWICA-TYQ-------PE----YRTSTTFVVTAKG-----MNNNIYQ
A0A1C5PY68      ILLLAIAAALFADIWICA-TYQ-------PE----YRTSTTFVVTAKG-----MNNNIYQ
A0A174CJF8      ILLLAIAAALFADIWICA-TYQ-------PE----YRTSTTFVVTAKG-----MNNNIYQ
A0A174R7V0      ILLLAIAAALFADIWICA-TYQ-------PE----YRTSTTFVVTAKG-----MNNNIYQ
A0A173ZYY6      IILGAIAGALLTYVVVSS-RYV-------PE----YTTQATFVVSSRG-----DANAYS-
A0A3D0F0Y4      IILGAIAGALLTYVVVSS-RYV-------PE----YTTQATFVVASRG-----DANAYS-
A0A174ASH7      IILGAIAGALLTYVVVSS-RYV-------PE----YTTQATFVVSSRG-----DANAYS-
A0A173SMI2      IILGAIAGALLTYVVVSS-RYV-------PE----YTTQATFVVASRG-----DANAYS-
A0A174GP12      IILGAIAGALLTYVVVSS-RYV-------PE----YTTQATFVVASRG-----DANAYS-
A6BH65          IILGAIAGALLTYVVVSS-RYV-------PE----YTTQATFVVSSRG-----DANAYS-
R7G0D7          IILGAIAGALLTYVVVSS-RYV-------PE----YTTQATFVVSSRG-----DANAYS-
A0A373MWV2      ILLIACSAAMITYTVLTA-VHR-------DQ----YTVKTTFAVMGRG-----ENANAAS
A0A417CE88      ILLIACSAAMITYTVLTA-VHR-------DQ----YTVKTTFAVMGRG-----ENANAAS
A0A416Y441      ILLIACSAAMITYTVLTA-VHR-------DQ----YTVKTTFAVMGRG-----ENANAAS
A0A357GPJ7      ILLIACSAAMITYTVLTA-VHR-------DQ----YTVKTTFAVMGRG-----ENANAAS
A0A396PAC1      ILLIACSAAMITYTVLTA-VHR-------DQ----YTVKTTFAVMGRG-----ENANAAS
A0A416EYU4      ILLIACSAAMITYTVLTA-VHR-------DQ----YTVKTTFAVMGRG-----ENANAAS
A0A416SCQ2      ILLIACSAAMITYTVLTA-VHR-------DQ----YTVKTTFAVMGRG-----ENANAAS
A0A416TGN7      ILLIACSAAMITYTVLTA-VHR-------DQ----YTVKTTFAVMGRG-----ENANAAS
A0A417SMF6      ILLIACSAAMITYTVLTA-VHR-------DQ----YTVKTTFAVMGRG-----ENANAAS
A0A1Y4MW77      ILALMVAGGAIMFVTNIQ-TYT-------PM----YQASATFTVTTNT-----TTDQNNQ
R6UHV6          ILLSGIIAAIGCFITATQ-LYS-------PQ----YMTSTTLLVQSKN-----NTESAYN
A0A3R9Q621      IVLITALALAATFAVNKY-LIS-------ES----YTASVQFYVNTQD-----SQTQKID
A0A069RC75      FFMVLAVSVAVSAVMTFY-VSE-------PE----YSSYTTLMVNKAR-----GDNENYI
A0A174F2W5      ILLIACSAAMITYTVLTA-VHR-------DQ----YTVKTTFAVMGRG-----ENANAAS
A0A174S8E9      ILLIACSAAMITYTVLTA-VHR-------DQ----YTVKTTFAVMGRG-----ENANAAS
A0A416ZL97      ILLIACSVAMITYTVLTT-VHK-------DR----YTVKTTFAVMGRG-----VDANAAS
A0A174LSK1      ILLIACSAAMITYTVMAT-VHK-------DR----YTVKTTFAVMGRG-----VDANAAS
A0A373GY92      ILLIACSAAMITYTVMAT-VHK-------DR----YTVKTTFAVMGRG-----VDANAAS
A0A373NZQ6      ILLIACSAAMITYTVMAT-VHK-------DR----YTVKTTFAVMGRG-----VDANAAS
A0A417I9B9      ILLIACSAAMITYTVMAT-VHK-------DR----YTVKTTFAVMGRG-----VDANAAS
A0A417MP97      ILLIACSAAMITYTVMAT-VHK-------DR----YTVKTTFAVMGRG-----VDANAAS
A0A417WQF8      ILLIACSAAMITYTVMAT-VHK-------DR----YTVKTTFAVMGRG-----VDANAAS
A0A373RZ83      ILLIACSAAMITYTVMAT-VHK-------DR----YTVKTTFAVMGRG-----VDANAAS
A0A416U6I1      ILLIACSAAMITYTVMAT-VHK-------DR----YTVKTTFAVMGRG-----VDANAAS
R7JQZ9          ILLIACSAAMITYTVMAT-VHK-------DR----YTVKTTFAVMGRG-----VDANAAS
A0A1M5UYN6      IITITFLTTLIGGIYSFY-VLK-------PT----YYSSMSVIIGKTV-----SVDGNIS
A0A176JBT8      ITSIPFVCLLIGFIYTYF-IAS-------PI----YESKTDLLVNTTP-----TANTAEP
A0A1I5HIC6      ILLWGILSAAAAIFISKV-FIT-------PV----YTSSTKLYIINRQ-----NKDTITS
A0A1Y3TC51      ILLAAAAVWLAATGWHNL-TYQ-------PE----YTSSATLVVTVKG-----SSSTYS-
A0A1Y3T1N0      ILVIGVSLWLGITGVHTL-IYE-------PA----YTSTATLVVTVKG-----ESSAYS-
A0A1Y3Y8U8      ILVIGVSLWLGITGVHTL-IYE-------PV----YTSTATLVVTVKG-----QTSAYS-
A6CLL4          ILSIIFLVTASGIILS-L-SLP-------KE----YEAKVDLLVNYSP-----ENNQGSL
A0A174DL89      IILITISSIIISTIATLF-FIE-------PT----YESKISVIIGPNQ-----STSGDYS
A0A176U8D6      VLLAAVACGVALGVYGRF-VVK-------DA----YESEASMCIIDSN-----KEVSMS-
A0A1Q6KSQ5      IVFAALVFGIALGMYGKF-VVK-------DV----FQAEASMCIIDSN-----KEVSIS-
A0A3D3U8B3      IVFAALVFGIALGMYGKF-VVK-------DV----FQAEASMCIIDSN-----KEVSIS-
A0A3E5FRL7      IVLIVISLYLAATGIGKL-VYI-------PE----YTVSTTLVVNAQG-----TSDTYT-
A0A1Y4QK93      IVLIVISLWLAATGIGKL-VYV-------PE----YTVSTTLVVSAKG-----TSDTYT-
B1C232          IVLIVISLYLAATGIGKL-VYI-------PE----YTVSTTLVVNAQG-----TSDTYT-
A0A401USI6      ILFIIICPTLIAGLLSFY-VIK-------PV----YEAKATVIVGKDS-----TDKITQS
A0A1V4IQ10      VIILPLITTAISILYSFY-IVK-------PQ----YEASTKVFVGKET-----GIEEKYN
A0A1S8TRD2      VIILPLITTAISIFYSFY-IVK-------PQ----YEACTKVFVGKET-----ADKEKYD
G7M1U2          VIILPLITTAISIFYSFY-IVK-------PQ----YEACTKVFVGKET-----ADKEKYD
A0A2T6KJ75      ILLVTFYITLIGG-FSSF-AIP-------PK----FEAKTDVLVNFTT-----ANVVSSG
A9KN92          IVLSSIVCAVAAGLISKF-VMT-------PV----YTSDTKLYIINRQ-----NKD-TIT
A0A352MUJ1      IILTTLAFLFVGYIYNAF-ITT-------PE----YKAATTLLLVKSS-----EGTSSVT
R5YI67          ILLTTMAFLFIGYVYNAF-VTT-------PQ----YKSATTLILVKAE-----N--SGTT
A0A1Y0IQP5      IVLVTLLAVGLTGAGSFL-VLE-------PE----YEATTTLLVQSKQ-----AGN-VIA
A0A1M6E8I2      VVATTIFAAILAILVTMV-AIT-------PV----YESNTTLMVNSSK-----TSSLGDI
A0A1Y4N105      IILVMLATYFAIAGVYRL-TYS-------PH----YTTTATMAVTARG-----SQSGTYS
A0A1Y4QP75      IILVMLATYFAIAGVYRL-TYS-------PQ----YTTTATMAVTARG-----SQSGTYS
A0A3D4QRB5      IVLTILLFASASGIISVF-FLD-------DV----YASSTTLIVSKQN-----QNSNVNE
A0A2X2LGT4      VVLFGVVGAAGSYVYA-S-LQT-------PL----FQATTSLYFALNQ-----GTS-ASD
A0A349DEH5      VLIVALIGAIIGAVVSEA-TKK-------ET----YTSTASFVVNTSS-----DSE-KAS
A0A3D4T7B4      VLIVALIGAIIGAVVSEA-TKK-------ET----YTSTASFVVNTSS-----DSE-KAS
A0A350XYC7      VLIIAVIGAAIGGVAGEA-TKK-------ET----YTSTVSFVVNSAT-----ENG-QAS
R6DNR8          VAIVAFIGAAIGGFVGHA-TRQ-------ET----YTSTVSFVVNSAT-----EAG-QTS
A0A355KUM5      VAIIAVIGATIGGVIGEA-TKS-------ET----YTSTVSFVVNSAT-----ENG-QVS
R5YGY6          VAIIAVIGATIGGVIGEA-TKS-------ET----YTSTVSFVVNSAT-----ENG-QVS
A0A0K8J554      IIIFVLIGAGLLFVVNRF-IRR-------PI----YTASVQLYVNPND-----TTP-AAN
A0A2S4GG02      MILAALLLAAGGGILAAW-KQN-------TT----YMAKISFYVYSSP-----DYVTDTG
A0A3N1XSX6      IILCLFAGLLISFIFSRY-IIN-------PS----YTAYVQLYVIPDD-----TEA-SLN
A0A1C6G0U3      VISILSIFIIVTAIFNFY-IIE-------PT----YVADTTIIVSKSV-----TNT-NDT
A0A3D4LLB3      IIIITIVFAAAGAVVSIY-LIQ-------PV----YESSTTLIVREDK-----DAEEKIS
A0A0A5GPA9      LSVVTLLVVIIGIAIS-L-LLP-------RT----YEGEGALLVNFTS-----VKSDEDE
A0A271M6M4      IIIITTFMVFLGAAIS-Y-FMP-------PV----YQAKTDLLVNFKA-----EGVESKD
A0A1V5LU59      IAICFILAVGLSFVVSQY-YLK-------PI----YKANATLFLGKES-----DKIASLS
A0A1E3BVC3      IVLCFVLAAGSAFVVTQF-YIK-------PI----YKAETTLFLGKEK-----DQV-SLS
A3DF66          IVLCFVLSAGTAFVVTQF-YIK-------PV----YKAETTLFLGKEK-----DQV-SLS
W4V1T8          IVLCFVLAAGSAFVVTQF-YIK-------PV----YKAETTLFLGKEK-----DQV-SLS
A0A2V3W8U6      IITVPLLFALLAVIVNSF-IIK-------PV----YEARSDLLVNNTV-----PMT-EET
W1UFG0          IVLVGIIFGLITAGVNQF-LLK-------PV----YEANTTIITNKEV-----DEE-KVQ
A0A351SRI8      VAIVTLLGLILSIVYTAK-IQV-------PV----YEAKTSLVLVNNM-----GEN-TTI
A0A1I0RG99      IAICTFVGICSFFINSKY-IIK-------PT----YVASVQMYVNPNE-----TTY-SAD
A0A1I5G322      ITVCTIGGLCVSFLYSKY-IIK-------PT----YIASVQMYVNSND-----STS-SAD
A0A1C6ITD7      IIIITLISTILTAITTIF-FIE-------PT----YQANISIIIGQNQ-----STV-DEG
A0A381IX63      IVAIVIASILIVSIKTFF-FTT-------PI----YEAQTTIIINNLL-----G-K-SSQ
A0A1G9IUT4      IIIITCITMFTSAGLSFF-VID-------PV----YEANTTLIVNKVK-----EVN-TQD
A0A1M6RWV2      IILIVLITTITTSVVSFF-FLD-------KV----YEASTKLVLVKGG-----D----SD
A0A3R9WAA7      IPLLAVSVAMLVCVYARE-KYS-------PR----YTAAVTFTVNLDL----------AS
R5EFZ0          VVLAALAVGIGTYIYTDA-TYA-------PV----YRTTTTFVVTTRG-----------S
A0A0H5SF45      IIACTFFCAIMSYVYNKF-IKD-------PV----YTASVQFCVNTND-----------N
A0A1M6JRJ5      IAACTLGGLLLSFLYTSY-FVD-------KT----YTASTQFYVSTAD-----------S
A0A1M7Y1S2      IAACTFAGLLLSFLYTRY-FVD-------KT----YTASSQFYVSTIE-----------S
A0A143XN92      IVIMAISFSLIAYMIIDS-SYK-------PK----YTSSTTFIVTGKG-----------L
A0A3D5R4X5      IISITLAFLIISALISFF-ILT-------PI----YQSSTALMVNKTF-----SES-EML
A0A3E4LL92      ILMCMCLTGMFSYVILDH-SLK-------DT----YTVSVNLCVIPRD---------NTS
A0A415D1L1      ILMCVCLTGMFSYVILDH-SLK-------DT----YTVSVNLCVIPRD---------NTS
A0A414P2K5      ILMCVCLTGMFSYVILDH-SLK-------DT----YTVSVNLCVIPRD---------NTS
V8C417          ILMCVCLTGMFSYVILDH-SLK-------DT----YTVSVNLCVIPRD---------NTS
W6RXP9          IALITLIFSVVAGVLSFF-VIK-------PT----YEAGTKLFIGKEE---------SQN
W6S4G8          IFATTIFFTALVALITFF-FID-------PV----YEVHTKVFIGKDA---------EVN
R5B467          LALIVLCAAASGGYARLS-Y-R-------PQ----YTASMTFLVNAGG---------TSQ
A0A143WVN6      ILAVLAVRMGISGYYELT-Y-E-------PQ----YTSTATLAVTARG---------SSN
A0A3B8KKL6      VAACFIFVTVSTFLITSY-YLT-------PI----YRSEATLFLGKES---------GNV
A0A2K9E6R0      VAACFIFVTVSTFLITSY-YLT-------PI----YRSEATLFLGKES---------GNV
A0A2S8RBI0      VAACFIFVTVSTFLITSY-YLT-------PI----YRSEATLFLGKES---------GNV
A0A0L6JLG6      LLICLVVATGAAYTVTAF-YLK-------PV----YRAETTLFLGKEK---------DKI
G8LSN0          IAICFILATGSSFAITKF-YLK-------PV----YRAQTTLFLGKES---------DKV
A0A1Q6REE0      LALVLICAAGLTFVQRRA-Y-R-------PV----YEASASFTVRVAN---------PLY
R5ETF9          LALILICAAGLTFVQRRA-Y-R-------PV----YEASASFTVRVAN---------PLY
A0A0X9GDD0      LLAAALVGGLLGWGYSAL-Q-P-------RI----YASESQGLLAARS---------TDQ
U2A8X2          VAVAAALGLVLAGAYSLL-S-T-------PT----YSARSQVYVSVQG---------SDS
U2AC50          VAVCAVLGAVAGFGYARS-E-P-------KV----YQSSASVMVVPEQ---------GEN
A0A1I4C3N6      IIMFALVGGAVGGAYALF-MGQ-------DL----YRSEITMTAFSNP-----DYANDSG
A0A3B9CIM7      IFLSTAVLGMVAGAYASI-TST-------SL----YMAQISFYVYSNP-----DYITDSS
A0A1G9WHW8      MVFCGLVAALLFGGYAYA-TRS-------SV----YQAKISFYAYSDP-----DYASDTS
A0A1H5VAA0      MVFCGLVAALLFGGYAYA-TRS-------SV----YQAKISFYAYSDP-----DYASDTS
A0A3R6VK11      IMILGVLGGMAGGAYAYL-TNS-------TL----YRAEVSFYVYSDP-----DYVYDSS
A0A3R6QUY7      IMILGVLGGMAGGAYAYL-TNS-------TL----YRAEVSFYVYSDP-----DYVYDSS
A0A373K3P9      IMILGVLGGMAGGAYAYL-TNS-------TL----YRAEVSFYVYSDP-----DYVYDSS
A0A3R6JRU5      IMILGVLGGMAGGAYAYL-TNS-------TL----YRAEVSFYVYSDP-----DYVYDSS
A0A1C5MS04      IMILGVLGGMAGGAYAYL-TNS-------TL----YRAEVSFYVYSDP-----DYVYDSS
A0A3C1J150      IMILGVLGGMAGGAYAYL-TNS-------TL----YRAEVSFYVYSDP-----DYVYDSS
A0A416CXD7      IMILGVLGGMAGGAYAYL-TNS-------TL----YRAEVSFYVYSDP-----DYVYDSS
R6XBL9          IMILGVLGGMAGGAYAYL-TNS-------TL----YRAEVSFYVYSDP-----DYVYDSS
A0A355W5Z7      IMILGVLGGMAGGAYAYL-TNS-------TL----YRAEVSFYVYSDP-----DYVYDSS
A0A143ZUX1      PTILLVIFAVAGFLFAQL-TYK-------PT----YSSIGSFWLQIYS-------TNEND
A0A143XPI5      FLIIISISTAAGYYYAKE-SYR-------PN----YEAYASFAVDAGV-----------S
A0A355G1X5      LLITTVLCATIGWSVSFM-TTD-------PT----YTTNLSFTTYNKA-----------A
A0A0M6WXE3      ILLGALAGAMLFYVASSM-IYV-------PN----YRTQATFVITSRE------------
A0A348SAK2      ILFGALAGAMLFYVASSM-IYV-------PN----YRTQATFVITSRE------------
A0A1W1Z4C3      VIICAAIGFGFMYWRASKAIDT-------------YTASGTMFVTNSN-------PNLVN
A0A239QN83      VILCAAIGFGVMYYRASKAPDT-------------YTASGTMFVTNSN-------PNLVN
A0A1G9H5B9      LVLCAELGFGAFYMYMTR-RMP-------ET----YTATGTMYVSSYN-------PEYID
A0A1G6BLF1      LLVIISICATLFYTHVKM-VYE-------PK----YTAEATYLVTAAS----------YY
A0A1Y4H8L0      ILLGALAAAMLAATVLSL-RWQ-------PA----YTTSATFAVSSRV------------
R6HZX3          VTLLAILVGALRYVQAQR-SFV-------PQ----YTATASFSVKSGY------VGTTDL
A0A1W2CEA6      IVLAALIGALIAWFYVTR-LVT-------PV----YQATSKIYIAGSD------------
R7FFK6          IICAAVVGAAGTFLVSSY-VIP-------QQ----FQSNISMYVKNSE----KQN--QEQ
A0A373MPB9      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A373L519      IVAAAVVCAVLALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A373W906      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A373VCW2      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSMGQDK
W0U604          IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A374B6G0      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A373VM36      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A1C5P379      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A373XXX0      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A356CW82      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
R6T4X7          IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A374HTV1      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A374GB66      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A374ECC6      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A374BM61      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A373UGZ4      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A373SA66      IVAASVVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A1C5X6X7      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A1C6JIH3      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A373PSC3      IVAASIVCAILALFVSKF-VMS-------KQ----YQSHVSMYVKSAD----NQSTGQDK
A0A1K1WYK8      IIAITIIGGIAAFSFSKF-VLP-------VK----YSSHITMYVQS--------YTGISE
A0A1H6IUB1      LIIVTIIGGAAAFCYSKF-VMP-------LK----YSSHISMYVQS--------YTGITE
A0A1M7L1F9      LILVTIIGGTAAFCYSKF-VMP-------LK----YSSHISMYVQS--------YTGISE
A0A1C6B4L6      IIIVTIAGGILSFGFSKM-FLP-------FE----YSSHVSMYVQS--------YTGISD
A0A1Q6T9P4      IIIVTIAGGILSFGFSKM-FLP-------FE----YSSHVSMYVQS--------YTGISD
A0A315Y4F9      IIVITVLGAGAAFGISKF-LLP-------LQ----YSSHITMYVQS--------YTGITE
A0A354K620      IIIIAILGGAAGFSVSRF-LLP-------LK----YSSHITMYVQS--------YTGITE
A0A355G3J9      IIVSSLLGAMLLAGATWA-LIK-------PT----YTATAKLYVYNEH----------ST
A0A3D2AD87      IVIAACLCAAMTFAYCKF-VVN-------PK----YKAQSTIYVTNGNINPGETVEEQEE
A0A2T5IYJ6      IIGLAIAITVATAFVVS--TVR-------PV----YRATATLMIEQKQ---GKTL----T
A0A252F281      IVLVAASAVMLTRVASET-IYK-------PE----YTSSVTMSVTSKS---GSNA-----
A0A348SAK1      VLVLALIFGLNSYIKARK-NYT-------PV----YTASATVAVTTID---GSPA-----
A0A0M6WYQ8      VLVLALIFGLNSYIKARK-NYT-------PV----YTASATVAVTTID---GSPA-----
A0A173TM61      VLVLALIFGLNSYIKARK-NYT-------PV----YTASATVAVTTID---GSPA-----
A0A1Y4QKE6      LFLGTIVICTIAFSTFRYLTYT-------PI----YRCEATFTVATDS---ENTG-----
B1C231          VFLGTIVICTIAFSTFRYLTYT-------PI----YRCEATFTVATDS---ENTG-----
A0A1Y3TUL5      IAATTIAGLAIGVVLSIASYMR-------GEMAKGYSITSSIAVTTQD---AGGN-FTTN
A0A1Y4JAX2      IAATTIAGLAIGVVLSIASYMR-------GEMAKGYSITSSIAVTTQD---AGGN-FTTN
A0A1Y4T590      IAATTIAGLAIGVVLSIASYMR-------GEMAKGYSITSSIAVTTQD---AGGN-FTTN
A0A3C0QME1      LILLAVLGGGGAYAYAH-FMMP-------NQ----YQSYTSMYVRNSG--------NILG
A0A355FYK5      IVMVGVVFAAAGYFFAKASYVPIYTVSATIE----FTSTKYIKVADAT--------GKEE
A0A357AQU0      LTIAAVLCAAIGFSYAK-FYLP-------ET----FTSSIRMYVKNLN--------STET
A0A3C1YJQ7      LTIAAVLCAAIGFSYAK-FYLP-------ET----FTSSIRMYVKNLN--------STET
A0A3D0JG38      LTIAAVLCAAIGFSYAK-FYLP-------ET----FTSSIRMYVKNLN--------STET
A0A3C0IHX1      ILLVTLCFSAIGFSYGK-YYLP-------LE----YTSSTYMYVKNGD--------TSEE
R5V506          ILLVTLCFSAIGFSYGK-YYLP-------LE----YTSSTYMYVKNGD--------TSEE
A0A352TIU5      ILLVTLCFSAIGFSYGK-YYLP-------LE----YTSSTYMYVKNGD--------ASEE
A0A3E5FSY5      VFLGTIVICTIAFSTFRYLTYT-------PI----YRCEATFTVATDS---ENTG-----
A0A1Y3T163      VLILILAGAGGFYAFQNL-SYE-------PL----YASSATFTVATGD---G------EN
A0A1Y3YCA2      VLILILAGAGGFYAFQNL-SYE-------PL----YASSATFTVATGD---G------EN
A0A1Y4L6N9      IVLLALIGGSIFYLRASR-FYT-------PM----YRAEAVFTVMTST---QSNS--ENS
A0A173T644      VILLAALGSAAYYVKNSQ-FYT-------PM----YQSVASFTVMTGG---NSEN-GQEE
A0A1C5TSB8      VILLAALGSAAYYVKNSQ-FYT-------PM----YQSVASFTVMTGG---NSEN-GQEE
C0CIK6          VILLAALGSAAYYVKNSQ-FYT-------PM----YQSVASFTVMTGG---NSEN-GQEE
A0A1Y3WEF6      ILLLAAVGAGAFYLRATRLFYT-------PM----YQSSATFTVLTGG---TMDT---EN
A0A417T0L2      IIFLAAVGAGAFYLRATSLFYT-------PM----YQSSATFTVLTGG---STDS---EN
A0A1H9EPU3      IILLGLCVAVIAFVYSKF-VIT-------PL----YSASTQILVMNEN---SGTGNTTTD
A0A354IGV3      VVLAALTGAMGAHVVLQT-IYK-------PQ----YTCSATYIVSSKY---STVS-----
A0A417JMV2      IMLLAASMSLLSYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS-----
A0A415VWX5      ILLLAASMSLLSYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS-----
A0A173UY96      ILLLAASMSLLSYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS-----
A0A173QTL1      ILLLAASMSLLSYVYVGR-SYH-------KQ----YESTSTFIVSSKG---SNNS-----
B0P408          ILLLAASMSLLSYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS-----
D4MV82          ILLLAASMSLLSYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS-----
A0A174A3T7      ILLLAASMSLLSYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS-----
A0A1Q6K0H6      ILLLAASMSLLSYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS-----
A0A174J359      ILLLAASMSLLSYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS-----
A0A417UUA3      ILLLAASMSLLSYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS-----
A0A1C6EUV9      ILLLAASMSLLAYVYVGR-SYH-------KQ----YESTSTFIVSSKG---SNNS-----
A0A173Y645      ILLLAASMSLLAYVYVGR-SYH-------KQ----YESTSTFIVSSKG---SNNS-----
A0A374AVY6      ILLLAASMSLLAYVYVGR-SYH-------KQ----YESTSTFIVSSKG---SNNS-----
R7BXS4          ILLLAASMSLLAYVYVGR-SYH-------KQ----YESTSTFIVSSKG---SNNS-----
A0A1V5S3C0      ILILVFIFASAGFVFSRV-TYE-------ER----FSSKILFNASNKS----SDI-AGEA
A0A1Y3TC98      ALLLTVAGAAGVTVYQRV-FHQ-------PM----YECSATFTVATGN---------SEN
R6VAT5          IAVLAGICCVGFTLYSYA-AYT-------PQ----YTAAATFTVTPKG---------DSL
A0A1Q6S448      LLLAALTCSMAAWIVLTC-FVT-------QQ----YTSSTTFSVTTRT------------
A0A351MYR0      LLMAGAACAMAAWIVLSC-FVT-------QQ----YTSSTTFAVTARA------------
R6HPC1          LLLAAAACAMAAWIVLSC-FVT-------RQ----YTSSTTFAVTARA------------
A0A3D4G5Z5      LLLAAAACAMAAWIVLSC-FVT-------RQ----YTSSTTFAVTARA------------
A0A3D5ES03      LLLAAAACAMAAWIVLSC-FVT-------RQ----YTSSTTFAVTARA------------
A0A0F2P7X6      VVLCTVLAALGAYFYTIS-TYV-------PV----YTASASMVVNSKQ------L-KIVG
A0A359B487      VILCTVLAALGAYFYTIY-TYV-------PV----YTASASMVVNSKQ------L-KIVG
A0A348P5V4      ILLSAILCAGVGFGVAVA-RYT-------EH----YSSQIMFIASNRS--------SAIT
A0A356PT74      VVISAVVLAVLGFAVAKL-TYT-------PS----YSSKITFIANNKS--------SALA
A0A3D5LL19      VVISAVVLAVLGFAVAKL-TYT-------PS----YSSKITFIANNKS--------SALA
R5MNF0          VVISAVVLAVLGFAVAKL-TYT-------PS----YSSKITFIANNKS--------SALA
A0A1Q9JSI0      YALVILLLAASMSLLAYV-KVG-------RSYHKMYESTSTFIVSGK------------G
A0A3D5TNI1      LMLVGLIVGASCAGITKL-VEE-------PT----YTSSMTFIVNNKS---EKDL-SSSG
A0A358LJD0      LILVALVVGASCAVVTKA-VEE-------PT----YTSSMTFIVNNKS---EKDL-SSSG
R6I3L7          LILVALVVGASCAVITKA-VEE-------PT----YTLSMTFIVNNKS---EKDL-SSSG
A0A3D1HXX0      LILVALVVGASCAVITKA-VEE-------PT----YTSSMTFIVNNKS---EKDL-SSSG
A0A3D2QJB8      LILVALVVGASCAVITKA-VEE-------PT----YTLSMTFIVNNKS---EKDL-SSSG
D4LC36          IIGAALICGLGAFLISDF-AIP-------RK----YQSNVSMYVRNKE----------DQ
R7MQJ4          IIILTIVGGAAAFGFSKF-FMP-------LK----YQSYTSMYVKNNN--------SVTE
A0A1V5GLC0      IILLAVIGGAAGFCYTKF-CMP-------LQ----YSSHMSMYVQCYT--------STSG
W7V182          IILAAVLGGTAAFCVSKF-LMP-------LK----YASHISMYIQSYT--------TFNE
                                                   :                        

S3FFL2          QGVERN-SNQVDQEFYQTQYGLLRSRSLSERVATQLRL--VDDPGFFEMFG---------
A0A0T8KPS6      TDVVNN-NPPVSPA--QTEIALLKSRSVVGGAVSNLNLDIIIKPHHFPIIGGFMARRFEP
A0A0T8LA03      PEISPR-PDSVSQA--VTEISLLKSRAVLGKAVEELKLYIVAKPRQFPLIGGYMARQHDP
A0A328M4V1      EDLAQTLGTSTSQA--VTEIALLTSRTVVGGAIDNLKLEIESEPERFPVIGNFMARRYTP
A0A1G6BLB6      -------NIQSASTTATSFQTILSNSVVQEAVAKAAGM------DS--------------
B5CSZ7          -------AETNIENALERSVNVLNSDTMRDQIMKASGS------SR--------------
A0A1C6G8M0      -------DLQIGSALTNDYEGIIKSRVVLTKVISNLNL--DIAYKS--------------
A0A416MP73      -------DVQLGSALTGDYEGIIKSRVVLNKVIENLKL--DLTYKQ--------------
A0A396G6S7      -------NLNSTKELAGQFTEILGSNVLKKKVAQDLGV------NS--------------
A0A3E5A223      -------NLNSTKELAGQFTEILGSNVLKKKVAQDLGV------NS--------------
R7D5E6          -------NLNSTKELAGQFTEILGSNVLKKKVAQDLGV------NS--------------
A0A415HQH5      -------NLNSTKELAGQFTEILGSNVLKKKVAQDLGV------NS--------------
A0A414W2C6      -------NLNSTKELAGQFTEILGSNVLKKKVAQDLGV------NS--------------
A5ZNE7          -------NLNSTKELAGQFTEILGSNVLKKKVAQDLGV------NS--------------
A0A395X821      -------NLNSTKELASQFTEILGSNVLKKKVAQDLGM------NN--------------
A0A1C5PY68      -------NLNSTKELASQFTEILGSNVLKKKVAQDLGM------NN--------------
A0A174CJF8      -------NLNSTKELASQFTEILGSNVLKKKVAQDLGM------NN--------------
A0A174R7V0      -------NLNSTKELASQFTEILGSNVLKKKVAQDLGM------NN--------------
A0A173ZYY6      -------NLSSANTMAKTFEKILKSNIMEKKICEKLKV------EE--------------
A0A3D0F0Y4      -------NLSSANTMAKTFEKILKSNIMEKKICEKLKV------EE--------------
A0A174ASH7      -------NLSSANTMAKTFEKILKSNIMEKKICEKLKV------EE--------------
A0A173SMI2      -------NLSSANTMAKTFEKILKSNIMEKKICEKLKV------EE--------------
A0A174GP12      -------NLSSANTMAKTFEKILKSNIMEKKICEKLKV------EE--------------
A6BH65          -------NLSSANTMAKTFEKILKSNIMEKKICEKLKV------EE--------------
R7G0D7          -------NLSSANTMAKTFEKILKSNIMEKKICEKLKV------EE--------------
A0A373MWV2      -------SLSSTYEMTQKFQAILENNILKKKVMEELGC------SS--------------
A0A417CE88      -------SLSSTYEMTQKFQAILENNILKKKVMEELGC------SS--------------
A0A416Y441      -------SLSSTYEMTQKFQAILENNILKKKVMEELGC------SS--------------
A0A357GPJ7      -------SLSSTYEMTQKFQAILENNILKKKVMEELGC------SS--------------
A0A396PAC1      -------SLSSTYEMTQKFQAILENNILKKKVMEELGC------SS--------------
A0A416EYU4      -------SLSSTYEMTQKFQAILENNILKKKVMEELGC------SS--------------
A0A416SCQ2      -------SLSSTYEMTQKFQAILENNILKKKVMEELGC------SS--------------
A0A416TGN7      -------SLSSTYEMTQKFQAILENNILKKKVMEELGC------SS--------------
A0A417SMF6      -------SLSSTYEMTQKFQAILENNILKKKVMEELGC------SS--------------
A0A1Y4MW77      SDYNYYYDSSTAEQLSLTFPYILSSQILNDAIEADLGV------EA--------------
R6UHV6          -------NLTATNKMAGVFKNILDSSQLQNSAARQLGY------TS--------------
A0A3R9Q621      LN-----ELNYAQKVVNTYINFLKTKVFYNMLIEETRL--PYTVDM--------------
A0A069RC75      DYE----SYIISQKLVDTYAVVAKSETVMERTIKNLNL--RVSPQK--------------
A0A174F2W5      -------SLSSTYEMTQKFQAILENNILKKKVMEELGC------SS--------------
A0A174S8E9      -------SLSATYEMTQKFQAILENNILKKKVMEELGC------SS--------------
A0A416ZL97      -------SLSATYEMAQKFEAILENTILKKKVMEELSL------SS--------------
A0A174LSK1      -------SLSATYEMAQKFEAILENTILKKKVMEELSL------SS--------------
A0A373GY92      -------SLSATYEMAQKFEAILENTILKKKVMEELSL------SS--------------
A0A373NZQ6      -------SLSATYEMAQKFEAILENTILKKKVMEELSL------SS--------------
A0A417I9B9      -------SLSATYEMAQKFEAILENTILKKKVMEELSL------SS--------------
A0A417MP97      -------SLSATYEMAQKFEAILENTILKKKVMEELSL------SS--------------
A0A417WQF8      -------SLSATYEMAQKFEAILENTILKKKVMEELSL------SS--------------
A0A373RZ83      -------SLSATYEMAQKFEAILENTILKKKVMEELSL------SS--------------
A0A416U6I1      -------SLSATYEMAQKFEAILENTILKKKVMEELSL------SS--------------
R7JQZ9          -------SLSATYEMAQKFEAILENTILKKKVMEELSL------SS--------------
A0A1M5UYN6      MDIN---DVTMYVKALETYIQIAKSEDVAEGARGILGD--RYSSGQ--------------
A0A176JBT8      VSPL---EIDASLKLIETYQYILKSQRMADLVIKDLDG--LLTEDE--------------
A0A1I5HIC6      S------DLQTGSQLTQDYKILVLSRPVTEQVLSKLNL--DMTHEE--------------
A0A1Y3TC51      -------SLSLTTQMADVFGQVFQSDALAEKIAEETGE-------E--------------
A0A1Y3T1N0      -------SLSVTSQMADVFGEVFQSSALRSRIIEDVGE-------E--------------
A0A1Y3Y8U8      -------SLSVTSQMADVFGEVFQSSALRSRIIEDVGE-------E--------------
A6CLL4          SVG----EVETNLRLISTYKYILKSPRVLEIVAERTEE--NDNVQC--------------
A0A174DL89      SSQSSY-DVVMYQKMVKTYSELLTSKIVLQDVIENTGL--DLNLES--------------
A0A176U8D6      -------DLQVGSALTNDYEGIIKSRVVLTKAIANLKL--DIEYKD--------------
A0A1Q6KSQ5      -------DLQIGSALTNDYEGIIKSRVVLTKVISNLNL--NIAYKS--------------
A0A3D3U8B3      -------DLQIGSALTNDYEGIIKSRVVLTKVISNLNL--NIAYKS--------------
A0A3E5FRL7      -------SLAMANEMADIIKEVFQSDVLLELVENEIGK-------T--------------
A0A1Y4QK93      -------SLAMASEMADIIKEVFQSDVLLELVENEIGK-------T--------------
B1C232          -------SLAMANEMADIIKEVFQSDVLLELVENEIGK-------T--------------
A0A401USI6      -------EVMMYQDLIKTYSEIGKSRVVAENAIKNLKS--GIVVKE--------------
A0A1V4IQ10      NN-----DVEMYQKLLKTYSELIKTNTLVSRALNRYDL--DSQSSA--------------
A0A1S8TRD2      NN-----DVEMYQKLLKTYSELAKTNTLVSKALKEHNI--DLQSSA--------------
G7M1U2          NN-----DVEMYQKLLKTYSELAKTNTLVSKALKEHNI--DLQSSA--------------
A0A2T6KJ75      -------EIDANLRLIETYKYLMKSNRILTKVNGSLDE--TYKKGE--------------
A9KN92          SS-----DLQTGSQLTQDFKVMVLSRPVTEQVISKLNL--NMTHDE--------------
A0A352MUJ1      QA-----DVTLNQKLVYTYTELVKSDTVLNEVANRIQL--NRSVGQ--------------
R5YI67          TN-----DVTLNQKLVYTYSELVKSDSVLNEVISRVQL--DKTTAQ--------------
A0A1Y0IQP5      YN-----DLLTDQKLVTTYGEIFQSRMIAEAVIDRLSL--NSTEQE--------------
A0A1M6E8I2      ASGFDIGSINLSQKLVVTYSEIVKSRIVLEAVIDKIEL--DMTYNE--------------
A0A1Y4N105      -------SLTTAMNMAEVFSEVFQSDTLKEKIEADLEV------DN--------------
A0A1Y4QP75      -------SLTTAMNMAEVFSEVFQSDTLKEKIKADLEV------DN--------------
A0A3D4QRB5      IQLS---DVNLSRNLVDTYSVIIKSNRVLENVVSDLGL--NISVNE--------------
A0A2X2LGT4      LNQ----GSVYTQSQMLSFAQLATSSRVLDPVIEELGL--DTTPRA--------------
A0A349DEH5      SN-----DIYVQINMAGTFRYILSSRVMKNAIVEKCTP--KVDFGT--------------
A0A3D4T7B4      SN-----DIYVQINMAGTFRYILSSRVMKNAIVEKCTP--KVDFGT--------------
A0A350XYC7      SG-----EINAQINMAGTFNYILSSPRMKEAIVEKCSE--KVTYGL--------------
R6DNR8          SG-----EINAQINMAGTFSYILSSRALKEAIVEKCPE--KLNYST--------------
A0A355KUM5      SG-----EINAQINMAGTFSYILSSRALKEAIVEKCPE--KVNFGT--------------
R5YGY6          SG-----EINAQINMAGTFSYILSSRALKEAIVEKCPE--KVNFGT--------------
A0A0K8J554      LN-----ELNYAQKVVATYVNLLRTQKFYKKVLEETGL--NYSESQ--------------
A0A2S4GG02      VNISSN-EMTQAKGLLDSYMQIIGSNRFLKAVMEETGL-KEYSIGR--------------
A0A3N1XSX6      LN-----ELNYAQKVVTTYINFLNTNVFYHDIQEESNL--NYSINE--------------
A0A1C6G0U3      ISSE---ELSVTKNLAITYANIIKSRAVLEKVINSMNL--ENSYEE--------------
A0A3D4LLB3      IS-----DVNLSKSLVYTYAEMVKSHTVLDNTAKTLKI--DKLDDK--------------
A0A0A5GPA9      ISSS---EIETNLRLIETYKSILISPRIMDKVKAQYGS--DLEMEE--------------
A0A271M6M4      ISTV---EIETNLRLIETYKYILNSTRIMEKVAEKTGS--KEKPEQ--------------
A0A1V5LU59      FA-----DIQLNNQLVSDYRELLKSDLVAESVKEKLGV--DIK--K--------------
A0A1E3BVC3      FA-----DIQVNNQLVVDYREILQSRRVAEIINQKFGV--GIS--E--------------
A3DF66          FS-----DIQVNNQLVVDYREILQSRRVAEIINQKFGV--GIQ--E--------------
W4V1T8          FA-----DIQVNNQLVVDYREILQSRRVAETINQKFGV--GIR--E--------------
A0A2V3W8U6      LTAL---DIETNLRLIETYHFIIQSDRIIDLVVEELDE--PFTNNE--------------
W1UFG0          MSTSD--DFTFSQRMAITYSKIITSDTVLNQVIDNLNL--KMKAKK--------------
A0A351SRI8      TTT----DITINKNLVSTYREIIQSKLILNKTIENLNL--DISYEE--------------
A0A1I0RG99      LN-----ELNYAQKVVTTYINFLQTKVFYKQVIDESKL--NYTPMQ--------------
A0A1I5G322      LN-----ELNYAQKVVTTYISFLQTKKFYEQVIEESNL--RLSREQ--------------
A0A1C6ITD7      TSYPGSYDVVMYQKMVKTYSEMITSRVVLEDVIENTGL--DLNLAD--------------
A0A381IX63      LTKE---DISYSQLLGETYKPIVKSRKVAEEIKKNLNL--EEDYHA--------------
A0A1G9IUT4      ITND---DVLANQKLALTYGEIIKSRTVLDKVIKNLNI--DTDVKK--------------
A0A1M6RWV2      IQYN---DVLLNQRLVKTYSEIASSRTIAEEVINNLKL--NMSYGE--------------
A0A3R9WAA7      DGSIYE-DSMRASQLSATFPYIVTSSILKNIIAEELGI------NE--------------
R5EFZ0          STSVYS-NLSSTSNLAGLFTELLNSSIMRKTILQETDI------SS--------------
A0A0H5SF45      SSGNIN-ELNYAQKVVSTYVNLLRTNTFYRQVLEATGL--NYSVQQ--------------
A0A1M6JRJ5      TAANLS-ELDYAQKIAETYINFLNTRQFYAQVLELSRL--PYSMPD--------------
A0A1M7Y1S2      TSANLS-ELDYAQKIAETYINFLNTRQFYSQVLELSGL--PYSVTD--------------
A0A143XN92      NNSIYD-NLLTAQDMTNRFKNIIDSNILKEKIAEVLSM------DS--------------
A0A3D5R4X5      NQIQLS-DINVNIRLAETYSEIIKSRRVASRVIDEMNL--DISYEG--------------
A0A3E4LL92      EKLAET-NI---ENALERSVNVLNSDTMRDQIVKASGG------SR--------------
A0A415D1L1      EKLAET-NI---ENALERSVNVLNSDTMRDQIMKASGS------SR--------------
A0A414P2K5      EKLAET-NI---ENALERSVNVLNSDTMRDQIMKASGS------SR--------------
V8C417          EKLAET-NI---ENALERSVNVLNSDTMRDQIMKASGS------SR--------------
W6RXP9          STYDNN-DIQMYQKLLKTYAEMIKNDELIEKAIREVNT--TMTAEE--------------
W6S4G8          --YDNN-DVQMYQKLLLTYAQILKTEDLIGTALNNVDS--DMTMEE--------------
R5B467          SG-SAA-STATAAQMAKTFPYILTSGLLDSAVRADTGL--ATLPAI--------------
A0A143WVN6      G--SYS-SLTTAMNMADVFSEVFQSDALKKMIEADIG------ESN--------------
A0A3B8KKL6      GGLSIG-DIQLNNQLIADYRELLKSRTVAERVGEKLNV--S--PSK--------------
A0A2K9E6R0      GGLSIG-DIQLNNQLIADYRELLKSRTVAERVGEKLNV--S--PSK--------------
A0A2S8RBI0      GGLSIG-DIQLNNQLIADYRELLKSRTVAERVGEKLNV--S--PSK--------------
A0A0L6JLG6      GALSLL-DLQINSQLVVDYREILKSRLVAEKIQSQLGV--E--AKA--------------
G8LSN0          ASLSIA-DIQVNNQLVSDYRELLKSNLVAESIEKKLGV--S--AAK--------------
A0A1Q6REE0      ASVSSY-NEKTAQVMADTFPSILTSGLLQRRVMEELGI--DEVPAM--------------
R5ETF9          ASVSSY-NEKTAQVMADTFPSILTSGLLQRRVMDELGI--DEVPDM--------------
A0A0X9GDD0      S--LIA-GNGPAESRAQAYVALINSQAVRERVAQDTGQ--DDDDSL--------------
U2A8X2          TTDLLQ-GSNFTVRQVKSYIELVTSPRVLDPVVDELGL--ADDAAS--------------
U2AC50          AAELVQ-GSNYVQNLVASYAVLAQSPYVLEPVIEDLGL--DTTPAR--------------
A0A1I4C3N6      ININVS-DVQSAQQLITSYSSVLTSSIFLNDVLEASGLQDQYSVLA--------------
A0A3B9CIM7      VNIGSS-DITQAKNLITSYMQILKSRTFLEKVKEETGL--GYSTDY--------------
A0A1G9WHW8      VNITYS-EVNQAKNLISSYTQILKSNTFLEALKEETGL--NYSTST--------------
A0A1H5VAA0      VNITYS-EVNQAKNLISSYTQILKSNTFLEALKEETGL--NYSTST--------------
A0A3R6VK11      VNISNS-EFTQAKNLVQSYILILKSNTILQKVLEEAGL--DYGTEA--------------
A0A3R6QUY7      VNISNS-EFTQAKNLVQSYILILKSNTILQKVLEEAGL--DYGTEA--------------
A0A373K3P9      VNISNS-EFTQAKNLVQSYILILKSNTILQKVLEEAGL--DYGTEA--------------
A0A3R6JRU5      VNISNS-EFTQAKNLVQSYILILKSNTILQKVLEEAGL--DYGTEA--------------
A0A1C5MS04      VNISNS-EFTQAKNLVQSYILILKSNTILQKVLEEAGL--DYGTEA--------------
A0A3C1J150      VNISNS-EFTQAKNLVQSYILILKSNTILQKVLEEAGL--DYGTEA--------------
A0A416CXD7      VNISNS-EFTQAKNLVQSYILILKSNTILQKVLEEAGL--DYGTEA--------------
R6XBL9          VNISNS-EFTQAKNLVQSYILILKSNTILQKVLEEAGL--DYGTEA--------------
A0A355W5Z7      VNISNS-EFTQAKNLVQSYILILKSNTILQKVLEEAGL--DYGTEA--------------
A0A143ZUX1      QTKLVMSDIQAATGLAQTYQYFLTGADTIDYVLEESGLDLNPSQ----------------
A0A143XPI5      SYSSSYYNSTTIKQLSATFPYILTSGALRQIVMNDLGLEE--------------------
A0A355G1X5      ADVVSSSDINSSIMMTNTFKYILEGRPMRETVAKSCSFNISADQ----------------
A0A0M6WXE3      -NANAYNNLSSANSMAETFQKILESTIMKKTICEKLDMDK--------------------
A0A348SAK2      -NANAYNNLSSANSMAETFQKILESTIMKKTICEKLDMDK--------------------
A0A1W1Z4C3      YGYTSTSDISSAVQLVNIYSEVVKSETVMQKVLEYAIEPAGENGNENDLLL---------
A0A239QN83      YGYTSTSDISSAVQLVNIYSEVVKSETVMQRVLEYAIEPAGENGNEEDILL---------
A0A1G9H5B9      DEYTRPGDLSSASQLIKTLLVVVKRDSVMSKVADRVSETHPGIDAGM-------------
A0A1G6BLF1      GYTESYYNETTASGLATSLEYVLNSTVMQKTVAEALDMES--------------------
A0A1Y4H8L0      -GASSYADLNSASEMAGTFQKILQSSALNKILCEELEVDS--------------------
R6HZX3          VDSTQYYDNQAAEQVVSSFPYIICSEAMQERICLALNTSW--------------------
A0A1W2CEA6      -TTISLSDLQLGSTLATDYQEVFKIWHVHEMVDERLDLDYSYSQ----------------
R7FFK6          Q-GINNNDLTVSKSLVSTYIVILNNDVVMDEVGNQLAKEYTEEELSRYFTL---------
A0A373MPB9      T-NVDLQDIDASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A373L519      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A373W906      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A373VCW2      T-NVDLQDIDASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
W0U604          T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A374B6G0      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A373VM36      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A1C5P379      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A373XXX0      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A356CW82      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
R6T4X7          T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A374HTV1      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A374GB66      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A374ECC6      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A374BM61      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A373UGZ4      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A373SA66      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A1C5X6X7      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A1C6JIH3      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A373PSC3      T-NVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTV---------
A0A1K1WYK8      NAANDVNNISNSKQLVNTYMEVLKDDEVMNAVSAKLLEQYDEQDLRRVFSF---------
A0A1H6IUB1      N-ANQQNNISNSKQLVNTYMEVLKDDAVMNAVGDKLLTQFDADTLSKNFGM---------
A0A1M7L1F9      N-ANQQNNISNSKQLVNTYMEVLKDDAVMNSVGELLKKQFDEDTLIKNFGM---------
A0A1C6B4L6      Q-MADQNNISNSKQLVNTYMEVLKDDAVMAAIGELLLEQFDEVILSENFTF---------
A0A1Q6T9P4      Q-MADQNNISNSKQLVNTYMEVLKDDAVMAAIGELLLEQFDEVILSENFTF---------
A0A315Y4F9      N-ANSANNISNSKQLVNTYMEVLKDDAVMNAVAEKLSKQFEENVLSQNFTI---------
A0A354K620      N-ANNVNNISNSKQLVNTYMEVLKDDAVMNAVAEKLAKQFEKNVLSQNFSL---------
A0A355G3J9      DTYITSSDLAVSKSLVDTYLIIIKSDPVLDKVQKDLAAKYPSLTAKQ-------------
A0A3D2AD87      TDGVKGTDVSASVSLSFTVVDILKQPDIYREMVNTIEKYNDKNYRL--------------
A0A2T5IYJ6      SLDDVYGTDGGKEYYLQTQFEILKSRELATRVVTELNIANHPDYLPRSEAE---------
A0A252F281      -----VADLNTTRQMASAFQGVLESDLLHETVAAAMGETS--------------------
A0A348SAK1      -----YQNNASAQQMADVFPYILTSGVLKDVVAKDMK-----------------------
A0A0M6WYQ8      -----YQNNASAQQMADVFPYILTSGVLKDVVAKDMK-----------------------
A0A173TM61      -----YQNNASAQQMADVFPYILTSGVLKDVVAKDMK-----------------------
A0A1Y4QKE6      -SYSYYYSQNTADQLSKTFPYILDSSYFRSILLEELG-----------------------
B1C231          -SYSYYYSQNTADQLSKTFPYILDSSYFRSILLDELG-----------------------
A0A1Y3TUL5      TSNPDSSDIQLAEDMVDAVIYVLKSDRTLKAAIQNIKLVGIVETD---------------
A0A1Y4JAX2      TSNPDSSDIQLAEDMVDAVIYVLKSDRTLKAAIQNIKLVGIAETD---------------
A0A1Y4T590      TSNPDSSDIQLAEDMVDAVIYVLKSDRTLKAAIQNIELVGIAETD---------------
A0A3C0QME1      DLDINISALNASRSLLDTYTVVLKSNYVMGEVAERLEMEYTTDELAGVFA----------
A0A355FYK5      LVTVV---VPYENNDINRYSTLMKSDAMIYALADKLNNDYNVV-----------------
A0A357AQU0      VSSVTTSDLNASKSLVMTYIVILKDPVVVGEVAETLAENHERDYLNRYFA----------
A0A3C1YJQ7      VSSVTTSDLNASKSLVMTYIVILKDPVVVGEVAETLAENHERDYLNRYFA----------
A0A3D0JG38      VSSVTTSDLNASKSLVMTYIVILKDPVVVGEVAETLAENHERDYLNRYFA----------
A0A3C0IHX1      KTAINQQDLMASKSLVETYIVILKNDTVVKQVGMSLVSKFGVSEISKCFT----------
R5V506          KTAINQQDLMASKSLVETYIVILKNDTVVKQVGMSLVSKFGVSEISKCFT----------
A0A352TIU5      KTAINQQDLMASKSLVETYIVILKNDTVVKQVGMSLVSKFGVSEISKCFT----------
A0A3E5FSY5      -SYSYYYSQNTADQLSKTFPYILDSSYFRSILLDELG-----------------------
A0A1Y3T163      GTYNFYYNRNTADQMSRTFPYILDSSFFRSALLERLG-----------------------
A0A1Y3YCA2      GTYNFYYNSNTADQMSRTFPYILDSSFFRSALLERLG-----------------------
A0A1Y4L6N9      GSYNFYYDSTTAGQLAKTFPYILSSNLLNEAIKEDLG-----------------------
A0A173T644      GSYNFYYDTTTAGQLAKTFPYILGSSLLTDAIKEDLG-----------------------
A0A1C5TSB8      GSYNFYYDTTTAGQLAKTFPYILGSSLLTDAIKEDLG-----------------------
C0CIK6          GSYNFYYDTTTAGQLAKTFPYILGSSLLTDAIKEDLG-----------------------
A0A1Y3WEF6      STYNFYYDTNTVGQLAKTFPYILSSSLLTEAIEEDLG-----------------------
A0A417T0L2      STYNFYYDTTTAGQLAKTFPYILSSTLLTEAIEEDLG-----------------------
A0A1H9EPU3      GKSVSVSDLQSSTFLVKDYTYMITSKPVMKSVIDEYG-----------------------
A0A354IGV3      -----YSNISATSDTASLFSKLLDSQVLRKHAAEAIG-----------------------
A0A417JMV2      ----IYSDLSATSEMATKFSEILNSSILQKKVAKEMD-----------------------
A0A415VWX5      ----VYSDLSATSEMATKFSEILNSSILQKKVAKEMD-----------------------
A0A173UY96      ----VYSDLSATSEMATKFSEILNSSILQKKVAKEMD-----------------------
A0A173QTL1      ----VYSDLSATSEMATKFSEILNSSILQKKVAKEMD-----------------------
B0P408          ----VYSDLSATSEMATKFSEILNSSILQKKVAKEMD-----------------------
D4MV82          ----VYSDLSATSEMATKFSEILNSSILQKKVAKEMD-----------------------
A0A174A3T7      ----VYSDLSATSEMATKFSEILNSSILQKKVAKEMD-----------------------
A0A1Q6K0H6      ----VYSDLSATSEMATKFSEILNSSILQKKVAKEMD-----------------------
A0A174J359      ----VYSDLSATSEMATKFSEILNSSILQKKVAKEMD-----------------------
A0A417UUA3      ----VYSDLSATSEMATKFSEILNSSILQKKVAKEMD-----------------------
A0A1C6EUV9      ----VYSDLGTTTEMATKFSEILNSSILQKKVAKEMN-----------------------
A0A173Y645      ----VYSDLSTTTEMATKFSEILNSSILQKKVAKEMN-----------------------
A0A374AVY6      ----VYSDLSTTTEMATKFSEILNSSILQKKVAKEMN-----------------------
R7BXS4          ----VYSDLSTTTEMATKFSEILNSSILQKKVAKEMN-----------------------
A0A1V5S3C0      AKYTTASDVQASVTFATSFKFILTETDYIYSLVKQAVKAQSGQE----------------
A0A1Y3TC98      GSYSFYYNSSTADQMSLTFPYILESNFFQSALMEELG-----------------------
R6VAT5          SAYTSISSNASTQQLEKTFPYIITSAPLTRVVAEDLG-----------------------
A0A1Q6S448      -SNLYYTNITAAADVAASYSQLLQSRVLRQTMEQNLG-----------------------
A0A351MYR0      -STLYYTNITAAADMASSYTQLLQSRVLRQTMEQDLG-----------------------
R6HPC1          -STLYYTNITAAADMAASYSQLLQSRVLRQTMEQNLG-----------------------
A0A3D4G5Z5      -STLYYTNITAAADMAASYSQLLQSRVLRQTMEQNLG-----------------------
A0A3D5ES03      -STLYYTNITAAADMAASYSQLLQSRVLRQTMEQNLG-----------------------
A0A0F2P7X6      QEAVLTNDVNLSAKLVNTYTAVLTSNRVMELVAGELD-----------------------
A0A359B487      QEAVLTNDVNLSAKLVNTYTAVLTSNRVMELVAGELD-----------------------
A0A348P5V4      VAGQSSSDINASVSLAESFKYVFTTTELATKVANSCGYANPDGSP---------------
A0A356PT74      VSGQTQSDLNASATLAESFKYVFTTTELSKRVADNSGFKD--------------------
A0A3D5LL19      VSGQTQSDLNASATLAESFKYVFTTTELSKRVADNSGFKD--------------------
R5MNF0          VSGQTQSDLNASATLAESFKYVFTTTELSKRVADNSGFKD--------------------
A0A1Q9JSI0      SNNNVYSNLNTTAQMATKFSEILNSSILQKKVAKEMN-----------------------
A0A3D5TNI1      DNSVSYNDMSASAYMANTFVHLMTGRTMCNAIAAECKTYP--------------------
A0A358LJD0      DNSVSYNDMSASAYMANTFVHLMTGRTMCNAIASECKSYP--------------------
R6I3L7          ENSVSYNDMSASAYMANTFVHLMTGRTMCNAIAAECKSYP--------------------
A0A3D1HXX0      DNSVSYNDMSASAYMANTFVHLMTGRTMCNAIAAECKSYP--------------------
A0A3D2QJB8      ENSVSYNDMSASAYMANTFVHLMTGRTMCNAIAAECKSYP--------------------
D4LC36          KQDINNSDLSVSKSLVSTYIVILNNDAVMEQVGEQLLKQHTPEELSGNFT----------
R7MQJ4          TDGVNLNDLNASKSLVSTYIAVMQDDAVMEKVGSELLAEFDKDKLSKCFS----------
A0A1V5GLC0      PTD--YNDISKSKQLINTYIEVLKDDAVMNAVGGKLMNEFDEAVLAETFG----------
W7V182          NPDQNFNNINNSKQLINTYMEVMKDDAVMNAVAEELRGSFENDVLEQNFS----------
                                     .                                      

S3FFL2          ----------------------------------------VGREDQGPFAL---------
A0A0T8KPS6      TEEGELGWYPTGLGAYAWGGEVLKVTQMEVPDKVHGKELTLEAAENKGFILRDEDGEVVV
A0A0T8LA03      ATDGALAKPLFGLTAFAWGGEKLDVFQLDVPEAYLGMDLTLVAGTAGNYSLYDDEEQLIL
A0A328M4V1      PVPGAVAPPFAGLSSYDWGGSSLDIYQLDVPRSLLDQQLYLDAGQNGTYTLSDDDDGVLL
A0A1G6BLB6      ------------------------------------------------------------
B5CSZ7          ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A3D0F0Y4      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174GP12      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A2X2LGT4      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A2S4GG02      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
A0A0X9GDD0      ------------------------------------------------------------
U2A8X2          ------------------------------------------------------------
U2AC50          ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A173TM61      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A1Q6K0H6      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

S3FFL2          ---VNNRYTAAG-------------------RSERLRIAGDILRSHIEISPARLSRLVDL
A0A0T8KPS6      QGVTGEPVENEGYRVTVAELNARPGTTFTVIKNRTYNTTESYQQRLSAAERGKQSGIVNV
A0A0T8LA03      RGQVNQAVETQGFKVQIAELEARPGTEFRLVRNRPQTTALDYQDRLKVGEAGKDSGIIYM
A0A328M4V1      TGRVGDKVTAKGITIQVKSMLANPGTRFDVTRHGRLALITSLQQALVATEQGKDSGIIEL
A0A1G6BLB6      ------------------------------------------IPGTVTTSLVENTNLMTL
B5CSZ7          ------------------------------------------VKGNLSASVVADTNIIRM
A0A1C6G8M0      ------------------------------------------LYNAVSVDNPEATRIIRI
A0A416MP73      ------------------------------------------LYNIVSVENPDSTRILKI
A0A396G6S7      ------------------------------------------LEVETSVDLVPETNLITL
A0A3E5A223      ------------------------------------------LEVETSVDLVPETNLITL
R7D5E6          ------------------------------------------LEVETSVDLVPETNLITL
A0A415HQH5      ------------------------------------------LEVETSVDLVSETNLITL
A0A414W2C6      ------------------------------------------LEVETSVDLVPETNLITF
A5ZNE7          ------------------------------------------LEVETSVDLVPETNLITL
A0A395X821      ------------------------------------------LNVETSVDLVPETNLITL
A0A1C5PY68      ------------------------------------------LNVKTSVDLVPETNLITL
A0A174CJF8      ------------------------------------------LNVKTSVDLVPETNLITF
A0A174R7V0      ------------------------------------------LNVKTSVDLVPETNLITF
A0A173ZYY6      ------------------------------------------LDADIHAKVLEGTNMLVL
A0A3D0F0Y4      ------------------------------------------LDADIHAKVLEGTNMLVL
A0A174ASH7      ------------------------------------------LDADIHAKVLEGTNMLVL
A0A173SMI2      ------------------------------------------LDADIHAKVLEGTNMLVL
A0A174GP12      ------------------------------------------LDADIHAKVLEGTNMLVL
A6BH65          ------------------------------------------LDADIHAKVLEGTNMLVL
R7G0D7          ------------------------------------------LDADIHAKVLEGTNMLVL
A0A373MWV2      ------------------------------------------FPADMSASIVPESNLMEL
A0A417CE88      ------------------------------------------FPADMSASIVPESNLMEL
A0A416Y441      ------------------------------------------FPADMSASIVPESNLMEL
A0A357GPJ7      ------------------------------------------FPADMSASIVPESNLMEL
A0A396PAC1      ------------------------------------------FPADMSASIVPESNLMEL
A0A416EYU4      ------------------------------------------FPADMSASIVPESNLMEL
A0A416SCQ2      ------------------------------------------FPADMSASIVPESNLMEL
A0A416TGN7      ------------------------------------------FPADMSASIVPESNLMEL
A0A417SMF6      ------------------------------------------FPADMSASIVPESNLMEL
A0A1Y4MW77      ------------------------------------------INGSISASIIPNSNMITM
R6UHV6          ------------------------------------------FPGNLSCSVIEETNILSF
A0A3R9Q621      ------------------------------------------LKDCIRITVVSNTEIFQV
A0A069RC75      ------------------------------------------LLKKVKIDQVDETEVLKI
A0A174F2W5      ------------------------------------------FPADMSASIVPESNLMEL
A0A174S8E9      ------------------------------------------FPADMSASIVPESNLMEL
A0A416ZL97      ------------------------------------------FPAKMNASIVPESNLMEL
A0A174LSK1      ------------------------------------------FPAKMNASIVPESNLMEL
A0A373GY92      ------------------------------------------FPAKMNASIVPESNLMEL
A0A373NZQ6      ------------------------------------------FPAKMNASIVPESNLMEL
A0A417I9B9      ------------------------------------------FPAKMNASIVPESNLMEL
A0A417MP97      ------------------------------------------FPAKMNASIVPESNLMEL
A0A417WQF8      ------------------------------------------FPAKMNASIVPESNLMEL
A0A373RZ83      ------------------------------------------FPAKMNDSIVPESNLMEL
A0A416U6I1      ------------------------------------------FPAKMNDSIVPESNLMEL
R7JQZ9          ------------------------------------------FPAKMNDSIVPESNLMEL
A0A1M5UYN6      ------------------------------------------LMGMLSVGAQSNTQIMNI
A0A176JBT8      ------------------------------------------FLDNVKAESNGNSQIISI
A0A1I5HIC6      ------------------------------------------LVSNITVKVPENTRILEI
A0A1Y3TC51      ------------------------------------------IAGKISCTPIQETNLLVL
A0A1Y3T1N0      ------------------------------------------ITGDITCTPITDTNLLTL
A0A1Y3Y8U8      ------------------------------------------IAGDITCTPITDTNLLTL
A6CLL4          ------------------------------------------LNEQISVTSSSDSQIISI
A0A174DL89      ------------------------------------------LESMIKIKTTTESEFINI
A0A176U8D6      ------------------------------------------LYNAVSIENPDGTRIIKI
A0A1Q6KSQ5      ------------------------------------------LYNAVSVDNPEATRIIRI
A0A3D3U8B3      ------------------------------------------LYNAVSVDNPEATRIIRI
A0A3E5FRL7      ------------------------------------------NQGTITCNQIQETNLLVL
A0A1Y4QK93      ------------------------------------------NQGTITCNQIQETNLLVL
B1C232          ------------------------------------------NQGTITCNQIQETNLLVL
A0A401USI6      ------------------------------------------FMLDLSITPKIGTQIIEI
A0A1V4IQ10      ------------------------------------------VLSSLTTVPMANTQILEI
A0A1S8TRD2      ------------------------------------------VLNTLTTIPTANTQILEI
G7M1U2          ------------------------------------------VLNALTTIPTANTQILEI
A0A2T6KJ75      ------------------------------------------ISQKVEIQSSINSQILTI
A9KN92          ------------------------------------------LVSNINVKVPENTRILEI
A0A352MUJ1      ------------------------------------------LRKNVTIESVKNTEILKI
R5YI67          ------------------------------------------LRKNVTIESVKNTEIIKI
A0A1Y0IQP5      ------------------------------------------LLEKIRVTTSGESLLTSV
A0A1M6E8I2      ------------------------------------------LLEDITSSPVGSTEILKI
A0A1Y4N105      ------------------------------------------LDYQISASVISETNLMTL
A0A1Y4QP75      ------------------------------------------LDYQISASVISETNLMTL
A0A3D4QRB5      ------------------------------------------LKSKINVSAEGNTEILRI
A0A2X2LGT4      ------------------------------------------LARDIEVTIPQSTVTLRI
A0A349DEH5      ------------------------------------------VDRSISVSVVSSTNIIVM
A0A3D4T7B4      ------------------------------------------VDRSISVSVVSSTNIIVM
A0A350XYC7      ------------------------------------------VDRSISVRVVTSTNVIVM
R6DNR8          ------------------------------------------VDKSISVSVVSSTNVIVM
A0A355KUM5      ------------------------------------------VDKSISVNVVSSTNVIVM
R5YGY6          ------------------------------------------VDKSISVNVVSSTNVIVM
A0A0K8J554      ------------------------------------------LKNMTNIQSVGDTEIFKI
A0A2S4GG02      ------------------------------------------LRGEIGATAVENTAVFHV
A0A3N1XSX6      ------------------------------------------LKHMTTIKTINNTEIFQI
A0A1C6G0U3      ------------------------------------------VYSSINVQSIEDTQIIKI
A0A3D4LLB3      ---------------------------------------------SITVSPVKDTQIIKV
A0A0A5GPA9      ------------------------------------------LVQRFTIGTNAESQIITV
A0A271M6M4      ------------------------------------------LAKKIEVISNSDSQVITL
A0A1V5LU59      ------------------------------------------FKSNVNVQTVKDTRIFSI
A0A1E3BVC3      ------------------------------------------FQNNVNVKTVKDSRLFSI
A3DF66          ------------------------------------------FQKNVNVKTVKDSRLFSI
W4V1T8          ------------------------------------------FQNNVTVKTVKDSRLFSI
A0A2V3W8U6      ------------------------------------------LQKKLRVETNDNSQIISL
W1UFG0          ------------------------------------------LAKYIDVENIQDTQIIKI
A0A351SRI8      ------------------------------------------LKKNVKVGNVEDTEIILI
A0A1I0RG99      ------------------------------------------LKAMTHIKAINNTEIFEI
A0A1I5G322      ------------------------------------------LKNMTNIESINNTEIFEI
A0A1C6ITD7      ------------------------------------------LESMIKIRTTTESEFISI
A0A381IX63      ------------------------------------------ISNSIDINSV-NGPVMNI
A0A1G9IUT4      ------------------------------------------LSNDIRVTTLTDTQIINV
A0A1M6RWV2      ------------------------------------------FSNKVRVNSVRDTEVIEI
A0A3R9WAA7      ------------------------------------------LSEQITADNVKDTNLFTI
R5EFZ0          ------------------------------------------FDGTIDTAVVPNTNLITM
A0A0H5SF45      ------------------------------------------LKAMTQISSVNDTEIFQI
A0A1M6JRJ5      ------------------------------------------LKKMTEIKTVQNTEIFSI
A0A1M7Y1S2      ------------------------------------------LRNMTEIKAIQNTEIFSI
A0A143XN92      ------------------------------------------FDAEAEAEIVPETNLMVL
A0A3D5R4X5      ------------------------------------------LRNITEVSLVRDTEFINI
A0A3E4LL92      ------------------------------------------VQGNLSASVVTDTNIIRM
A0A415D1L1      ------------------------------------------VKGNLSASVVADTNIIKM
A0A414P2K5      ------------------------------------------VKGNLSASVVADTNIIRM
V8C417          ------------------------------------------VKGNLSASVVADTNIIRM
W6RXP9          ------------------------------------------ILDSLTVNPLTDTQILEI
W6S4G8          ------------------------------------------VMKDITVEPITDTQILQI
R5B467          ------------------------------------------SATSEE-----GTNLCTL
A0A143WVN6      ------------------------------------------IQGTINSSIISQTNLITL
A0A3B8KKL6      ------------------------------------------LLSNVDVRTVKDSRIFKI
A0A2K9E6R0      ------------------------------------------LLSNVDVRTVKDSRIFKI
A0A2S8RBI0      ------------------------------------------LLSNVDVRTVKDSRIFKI
A0A0L6JLG6      ------------------------------------------FQNNVDVMTIKDSRIFKI
G8LSN0          ------------------------------------------FKRSVNVQTVKDSRIFSI
A0A1Q6REE0      ------------------------------------------SVSATA-----HSSILTL
R5ETF9          ------------------------------------------SVSATA-----HSSILTL
A0A0X9GDD0      ------------------------------------------SAALVP-----GSSMIKV
U2A8X2          ------------------------------------------LAQRVQADSPLDTALVNV
U2AC50          ------------------------------------------LARSVSVNTPLNTVVIEI
A0A1I4C3N6      ------------------------------------------LQRRISARQITNTSMFVI
A0A3B9CIM7      ------------------------------------------LKSQISASAIENTAAFVV
A0A1G9WHW8      ------------------------------------------FKNIISTSAVEDTAVFYV
A0A1H5VAA0      ------------------------------------------FKNIISTSAVEDTAVFYV
A0A3R6VK11      ------------------------------------------LSGRIGTSVVENTAVFYV
A0A3R6QUY7      ------------------------------------------LSGRIGTSVVENTAVFYV
A0A373K3P9      ------------------------------------------LSGRIGTSVVENTAVFYV
A0A3R6JRU5      ------------------------------------------LSGRIGTSVVENTAVFYV
A0A1C5MS04      ------------------------------------------LSGRIGTSVVENTAVFYV
A0A3C1J150      ------------------------------------------LSGRIGTSVVENTAVFYV
A0A416CXD7      ------------------------------------------LSGRIGTSVVENTAVFYV
R6XBL9          ------------------------------------------LSGRIGTSVVENTAVFYV
A0A355W5Z7      ------------------------------------------LSGRIGTSVVENTAVFYV
A0A143ZUX1      ------------------------------------------VKKMVSISQATGS-VLEL
A0A143XPI5      ------------------------------------------MNVNITASAVEETNLFRI
A0A355G1X5      ------------------------------------------LRHYVSVNTQADTNIIIV
A0A0M6WXE3      ------------------------------------------LDADISANVVKGTNMLTL
A0A348SAK2      ------------------------------------------LDADISANVVKGTNMLTL
A0A1W1Z4C3      ---SQKYPGLSTDF----------------------------IRNVISMNSVHETPMVRV
A0A239QN83      ---SQKYPGLTTDD----------------------------IRKVISMNSIHETPMVQV
A0A1G9H5B9      ------------------------------------------VSSSLSMESVSETGVVAV
A0A1G6BLF1      ------------------------------------------VPGTIAVAVVEETNMITI
A0A1Y4H8L0      ------------------------------------------IDAAITSNVIPNTNLLEL
R6HZX3          ------------------------------------------INGTVTASSIGETNIFTL
A0A1W2CEA6      ------------------------------------------LEKMVSVSNPSGSHLLYI
R7FFK6          ---KN-GKVTDTS-----------------------------LKACFSMTAVDETEVLKI
A0A373MPB9      ---TS-GRVSNDD-----------------------------LRNAYSMIAVNQTEVLQI
A0A373L519      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A373W906      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A373VCW2      ---TS-GRVSNDD-----------------------------LRNAYSMIAVNQTEVLQI
W0U604          ---TS-GRVSNDD-----------------------------LRNAYSMIAVNQTEVLQI
A0A374B6G0      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A373VM36      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A1C5P379      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A373XXX0      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A356CW82      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
R6T4X7          ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A374HTV1      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A374GB66      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A374ECC6      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A374BM61      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A373UGZ4      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A373SA66      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A1C5X6X7      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A1C6JIH3      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A373PSC3      ---TS-GRVSNDG-----------------------------LRNAYSMTAVNQTEVLQI
A0A1K1WYK8      ---DEDNKIDPAS-----------------------------IRSCLTISSVTDTSAVTI
A0A1H6IUB1      ---SD-GKIAPAS-----------------------------IRNCLSISSVTDTSAVKI
A0A1M7L1F9      ---SE-GRISPSA-----------------------------IRDCYSISSVTDTSAVKI
A0A1C6B4L6      ---NMSGEIETES-----------------------------LRKCIELSTVTDTSAVKV
A0A1Q6T9P4      ---NMSGEIETES-----------------------------LRKCIELSTVTDTSAVKV
A0A315Y4F9      ---NDSGKITPAS-----------------------------IRSCLAISSVTDTSAVKV
A0A354K620      ---SESGKIAPAS-----------------------------IRSCLAISSVTDTSAVKV
A0A355G3J9      ------------------------------------------ILAMLSGSAINETEAFYI
A0A3D2AD87      ------------------------------------------LKNKISVSRSEEERSMLI
A0A2T5IYJ6      ---KSWWQQIDWRQLLPRGHQSNPIPSDEEKLTLLVDR----FMANLSIEPIRQTQLVKI
A0A252F281      ------------------------------------------LPAQLESSIIEGTNLLTI
A0A348SAK1      -----------------------------------LDS----VPGSISVKAEEGTNMLTI
A0A0M6WYQ8      -----------------------------------LDS----VPGSISVKAEEGTNMLTI
A0A173TM61      -----------------------------------LDS----VPGSISVKAEEGTNMLTI
A0A1Y4QKE6      -----------------------------------VNS----LNGTLSASTVSESNIVTM
B1C231          -----------------------------------VNS----LNGTLSASTVSESNIVTM
A0A1Y3TUL5      ------------------------------------------IYKNLYLTRYKETQIIEM
A0A1Y4JAX2      ------------------------------------------IYKNLYLTRYKETQIIEM
A0A1Y4T590      ------------------------------------------IYKNLLLTRYKETQIIEM
A0A3C0QME1      ------------------------M-NDGKISLSS-------LRNKITMSSVDETEVMKI
A0A355FYK5      ----------------------------------E-------LRNAVVLGETGVSGIFSL
A0A357AQU0      ------------------------LDENGCPTTGS-------ILNYVSMGSVDNTEVLKV
A0A3C1YJQ7      ------------------------LDENGCPTTGS-------ILNYVSMGSVDNTEVLKV
A0A3D0JG38      ------------------------LDENGCPTTGS-------ILNYVSMGAVDNTEVLKV
A0A3C0IHX1      ------------------------V-KNGVISTSE-------LKDAISMSADGDTEVLKI
R5V506          ------------------------V-KNGVISTSE-------LKDAISMSADGDTEVLKI
A0A352TIU5      ------------------------V-KNGVISTSE-------LKDAISMSADGDTEVLKI
A0A3E5FSY5      -----------------------------------VNS----LNGTLSASTVSESNIVTM
A0A1Y3T163      -----------------------------------TDT----LNGTITSETVENSNMVTM
A0A1Y3YCA2      -----------------------------------TDT----LNGTITSETVENSNMVTM
A0A1Y4L6N9      -----------------------------------ISS----INGSITASVVPDSNLITM
A0A173T644      -----------------------------------VDS----INGSISAQAVSDSNLITM
A0A1C5TSB8      -----------------------------------VDS----INGSISAQAVSDSNLITM
C0CIK6          -----------------------------------VDS----INGSISAQAVSDSNLITM
A0A1Y3WEF6      -----------------------------------VDA----VNGRISAQAVSDSNMITM
A0A417T0L2      -----------------------------------VDA----VNGSISAQAVSNSNMITM
A0A1H9EPU3      -----------------------------------LDLTYSGLASKVSVTSPTDTRILTI
A0A354IGV3      -----------------------------------VEN----LPAQIKTEVAKDTNVLTL
A0A417JMV2      -----------------------------------MDY----FPGSASAEVVNETNLLVL
A0A415VWX5      -----------------------------------MDY----FPGSASAEVVNETNLLVL
A0A173UY96      -----------------------------------MDY----FPGSASAEVVNETNLLVL
A0A173QTL1      -----------------------------------MDY----FPGSASAEVVNETNLLVL
B0P408          -----------------------------------MDY----FPGSASAEVVNETNLLVL
D4MV82          -----------------------------------MDY----FPGSASAEVVNETNLLVL
A0A174A3T7      -----------------------------------MDY----FPGSASAEVVNETNLLVL
A0A1Q6K0H6      -----------------------------------MDY----FPGSASAEVVNETNLLVL
A0A174J359      -----------------------------------MDY----FPGSASAEVVNETNLLVL
A0A417UUA3      -----------------------------------MDY----FPGSASAEVVNETNLLVL
A0A1C6EUV9      -----------------------------------MDY----FPGTASAEVVNETNLLVL
A0A173Y645      -----------------------------------MDY----FPGTASAEVVNETNLLVL
A0A374AVY6      -----------------------------------MDY----FPGTASAEVVNETNLLVL
R7BXS4          -----------------------------------MDY----FPGTASAEVVNETNLLVL
A0A1V5S3C0      ---------------------------------YSISQ----LKSCVSANVVTDTTMISV
A0A1Y3TC98      -----------------------------------TDT----LNGEISSETITDSNVVTM
R6VAT5          -----------------------------------LSD----VPGTLTATAVEDTNLFTI
A0A1Q6S448      ------------------------------------MP----LNGTVSAQQLGETNLIRV
A0A351MYR0      ------------------------------------MP----LDGTVTAQQLGETNLIRV
R6HPC1          ------------------------------------MS----LDGTVSAQQLGETNLIRV
A0A3D4G5Z5      ------------------------------------MS----LDGTVSAQQLGETNLIRV
A0A3D5ES03      ------------------------------------MS----LDGTVSAQQLGETNLIRV
A0A0F2P7X6      ---------------------------------LPASA----ISPYVSVAPVRDTEVLRI
A0A359B487      ---------------------------------LPAAA----ISPYVSVAPVRDTEVLRI
A0A348P5V4      ---------------------------------ITASQ----IKRYVSVQSIEETQIIYL
A0A356PT74      ---------------------------------ISVAD----IKSWVSVEAVEDTAIINL
A0A3D5LL19      ---------------------------------ISVSD----IKSWVSVEAVEDTAIINL
R5MNF0          ---------------------------------ISVLD----IKNWVSVEAVEDTAIINL
A0A1Q9JSI0      -----------------------------------MDY----FPGTASSEVINETNLLVL
A0A3D5TNI1      ---------------------------------KTADE----VEEMIAASRKTDSSIIDM
A0A358LJD0      ---------------------------------KTADQ----VSKMIAASRKTDSSIIDM
R6I3L7          ---------------------------------KTADQ----VAKMIAVSRKTDSSIIDM
A0A3D1HXX0      ---------------------------------KTADQ----VAKMIAASRKTDSSIIDM
A0A3D2QJB8      ---------------------------------KTADQ----VAKMIAASRKTDSSIIDM
D4LC36          ------------------------IKNGK----ITNES----LKSAFTMAAVNNTEVLKI
R7MQJ4          ------------------------IKDENGEESISAAS----IRNCLTMAAVGDTEVMKI
A0A1V5GLC0      ------------------------SYQNR----ISPSS----IRNCMRITSVTDTSVLTV
W7V182          ------------------------VVNGR----ITPAS----LRSCISISSVTDTSALKL
                                                                           .

S3FFL2          YFTSPDASFSARVVNAWADAYIQTNLERKSQATSYGRNLLQRQLAQAKERLDESQRQLVN
A0A0T8KPS6      TLEDPDPQHAIRVLEEVANRYVDQNVARNAAEATQSLEFLNEQVPAVRRNLEAAQTALNK
A0A0T8LA03      SLEDPDPQLASRVLDEISRLYVSQNIQRSSAEAAQRLDFLRSQLPQVRKELEKAEAALHD
A0A328M4V1      DYRNADPVLATQLVDQISALYVRQNVDRNSAEAANSLAFVKQQLPKVRLELEQATQAMNA
A0A1G6BLB6      SVTESSPKMTYAVMNAILDNYSS-------------------------------------
B5CSZ7          SASGTNAESAYKLLKGALQQYPE-------------------------------------
A0A1C6G8M0      RVVSGNKEEAVDIANEILSVSIE-------------------------------------
A0A416MP73      YVTAGTVREAVNIANEILSVSVD-------------------------------------
A0A396G6S7      SVKAGTAAESYRILQSVMENYNT-------------------------------------
A0A3E5A223      SVKAGTAAESYRILQSVMENYNT-------------------------------------
R7D5E6          SVKAGTAAESYRILQSVMENYNT-------------------------------------
A0A415HQH5      SVKAGTAAESYRILQSVMENYNT-------------------------------------
A0A414W2C6      SVKAGTAAESYRILQSVMENYNT-------------------------------------
A5ZNE7          SVKAGTAAESYRILQSVMENYNT-------------------------------------
A0A395X821      SVKAGTAAESYRVLQSVMENYNT-------------------------------------
A0A1C5PY68      SVKAGTAAESYRVLQSVMENYNT-------------------------------------
A0A174CJF8      SVKAGTAAESYRVLQSVMENYNT-------------------------------------
A0A174R7V0      SVKAETAAESYRVLQSVMENYNT-------------------------------------
A0A173ZYY6      SVTADTPKDSIDIIRTVMDNYSS-------------------------------------
A0A3D0F0Y4      SVTADTPKDSIDIIRTVMDNYSS-------------------------------------
A0A174ASH7      SVTADTPKESIDIIRTVMDNYSS-------------------------------------
A0A173SMI2      SVTADTPKDSIDIIRTVMDNYSS-------------------------------------
A0A174GP12      SVTADTPKDSIDIIRTVMDNYSS-------------------------------------
A6BH65          SVTADTPKESIDIIRTVMDNYSS-------------------------------------
R7G0D7          SVTADTPKESIDIIRTVMDNYSS-------------------------------------
A0A373MWV2      SVTADSPETAFRVLRSVLKNYTT-------------------------------------
A0A417CE88      SVTADSPETAFRVLRSVLKNYTT-------------------------------------
A0A416Y441      SVTADSPETAFRVLRSVLKNYTT-------------------------------------
A0A357GPJ7      SVTADSPETAFRVLRSVLKNYTT-------------------------------------
A0A396PAC1      SVTADSPETAFRVLRSVLKNYTT-------------------------------------
A0A416EYU4      SVTADSPETAFRVLRSVLKNYTT-------------------------------------
A0A416SCQ2      SVTADSPETAFRVLRSVLKNYTT-------------------------------------
A0A416TGN7      SVTADSPETAFRVLRSVLKNYTT-------------------------------------
A0A417SMF6      SVTADSPETAFRVLRSVLKNYTT-------------------------------------
A0A1Y4MW77      TVISSDPDDAKEILESTIRVYPS-------------------------------------
R6UHV6          TVTSDSPIKSYRLLKAVLECYPQ-------------------------------------
A0A3R9Q621      SVTTNSASDSFELAKAIQNIAPD-------------------------------------
A0A069RC75      SASSTDPALAAAIANEIAQVFKE-------------------------------------
A0A174F2W5      SVTADSPETAFRVLRSVLKNYTT-------------------------------------
A0A174S8E9      SVTADSPETAFRVLRSVLKNYTT-------------------------------------
A0A416ZL97      SVTADSPEMAFRILKSVLNNYTS-------------------------------------
A0A174LSK1      SVTADSPEMAFRILKSVLNNYTS-------------------------------------
A0A373GY92      SVTADSPEMAFRILKSVLNNYTS-------------------------------------
A0A373NZQ6      SVTADSPEMAFRILKSVLNNYTS-------------------------------------
A0A417I9B9      SVTADSPEMAFRILKSVLNNYTS-------------------------------------
A0A417MP97      SVTADSPEMAFRILKSVLNNYTS-------------------------------------
A0A417WQF8      SVTADSPEMAFRILKSVLNNYTS-------------------------------------
A0A373RZ83      SVTADSPEMAFRILKSVLNNYTS-------------------------------------
A0A416U6I1      SVTADSPEMAFRILKSVLNNYTS-------------------------------------
R7JQZ9          SVTADSPEMAFRILKSVLNNYTS-------------------------------------
A0A1M5UYN6      TVQAGNEEEAKEIVLAITQSFKE-------------------------------------
A0A176JBT8      IVENKNPDDAALIANKTAVIFQS-------------------------------------
A0A1I5HIC6      SVQNPNPETAKQLADSIAEESAE-------------------------------------
A0A1Y3TC51      SVTCRHPRDAYLFINAALEHYGE-------------------------------------
A0A1Y3T1N0      SVSSPDPRQAYLFINSALENYEQ-------------------------------------
A0A1Y3Y8U8      SVSSPDPRQAYLFINSALENYEQ-------------------------------------
A6CLL4          TATALNPNQAVDIVNNTAETFKE-------------------------------------
A0A174DL89      TVEGKVPEVTTLVANQLTLSLKN-------------------------------------
A0A176U8D6      NVVSQDQKEAVDIANEILQISIE-------------------------------------
A0A1Q6KSQ5      RVVSGNKEEAVDIANEILSVSIE-------------------------------------
A0A3D3U8B3      RVVSGNKEEAVDIANEILSVSIE-------------------------------------
A0A3E5FRL7      NVTSKDPQNAYQFMNSALKHYDE-------------------------------------
A0A1Y4QK93      NVTSKDPQNAYQFMNSALKHYNE-------------------------------------
B1C232          NVTSKDPQNAYQFMNSALKHYDE-------------------------------------
A0A401USI6      SYKSKNPEIAAEGANALSQAFIE-------------------------------------
A0A1V4IQ10      KYKNLNKSLAKDTVSAITNEFIK-------------------------------------
A0A1S8TRD2      RYINLNKSLAKDTVSAITDEFIK-------------------------------------
G7M1U2          RYINLNKSLAKDTVSAITDEFIK-------------------------------------
A0A2T6KJ75      LAEEKTPEKAAALANTLATTFQE-------------------------------------
A9KN92          TVQNQDPLLAKQLADSIAEVASE-------------------------------------
A0A352MUJ1      SVLDSNKDDAATIANSIAEVFSE-------------------------------------
R5YI67          SVQDSNKDEAPIIANSIAEVFSE-------------------------------------
A0A1Y0IQP5      TVTDHDPKQAVAIANAMAAVFME-------------------------------------
A0A1M6E8I2      SVKNTDPAMASEIANTIADVFIK-------------------------------------
A0A1Y4N105      TVTSNTPKMTYQIMQSALDNYTS-------------------------------------
A0A1Y4QP75      TVTSNTPKMTYQIMQSALDNYTS-------------------------------------
A0A3D4QRB5      TVEDLIPEQARDIADSTAEVFIS-------------------------------------
A0A2X2LGT4      TGITDDAKAAAELADAVAEQLII-------------------------------------
A0A349DEH5      SVTTGNPQTSYAIAQTACEVYGD-------------------------------------
A0A3D4T7B4      SVTTGNPQTSYAIAQTACEVYGD-------------------------------------
A0A350XYC7      SVTTDNPKTSYAIANTVVDVYGD-------------------------------------
R6DNR8          SVTTGDPKIAYAIASTVVDVYGD-------------------------------------
A0A355KUM5      SVTTGDPKISYAIASTVVDVYGD-------------------------------------
R5YGY6          SVTTGDPKISYAIASTVVDVYGD-------------------------------------
A0A0K8J554      SVNSHSASDSYELVKAMEYIAPQ-------------------------------------
A0A2S4GG02      SVYDSSPENAMNIANTIGKLAPD-------------------------------------
A0A3N1XSX6      SVTSSSARDSYTLVETMQRIAPQ-------------------------------------
A0A1C6G0U3      SVQNKSPEIARDIANSIPEIFKE-------------------------------------
A0A3D4LLB3      AVQNTDPVLARDIADALVEEFTL-------------------------------------
A0A0A5GPA9      QAVGPSKEAASELVNVTLDTFQQ-------------------------------------
A0A271M6M4      KVEASSQKQAVKLANSTAEIFKT-------------------------------------
A0A1V5LU59      SYEDTDPELAANVVNELSVVIKQ-------------------------------------
A0A1E3BVC3      SYEDTDPKRAADVVNELASVIQK-------------------------------------
A3DF66          SYEDTDPKRAADIVNELATVIQK-------------------------------------
W4V1T8          SYEDTDPKRAADVVNELASVIQK-------------------------------------
A0A2V3W8U6      YVKENDLDTAVEIANLFATKSKE-------------------------------------
W1UFG0          SVRNGNPKTAAKICNEIPIVFEK-------------------------------------
A0A351SRI8      YVYNEDARLSRKIANEIASVFES-------------------------------------
A0A1I0RG99      SVTTTNPNDAYKLVDAMKKIAPV-------------------------------------
A0A1I5G322      SVSSMNPNHSFLLVKSMEKIAPE-------------------------------------
A0A1C6ITD7      SIEGKIAKDTATIANQLVLSLKN-------------------------------------
A0A381IX63      TVKNADPKVAREIANEVPVVFGG-------------------------------------
A0A1G9IUT4      SVREDNPKLANNIANEIASVFTS-------------------------------------
A0A1M6RWV2      KVQDTNPQLAARIANELSEVFID-------------------------------------
A0A3R9WAA7      RVSSDNPTRAYEVLQSVIKNYPK-------------------------------------
R5EFZ0          TVTDSDPRMAFLAAQAIIEHHES-------------------------------------
A0A0H5SF45      TLSSNSADDAYTLVEAMQKIAPQ-------------------------------------
A0A1M6JRJ5      TLTSKNPDDSYRLVKSMETIAPK-------------------------------------
A0A1M7Y1S2      TLTSNNPNDSYRLVKSMEMIVPK-------------------------------------
A0A143XN92      RVTADTSKKAFQILRAIMENYTV-------------------------------------
A0A3D5R4X5      KVQNPNPEQARDIANKLAEVFQE-------------------------------------
A0A3E4LL92      SASGTNAESAYKLLKGALKQYPE-------------------------------------
A0A415D1L1      SASGTNAESAYKLLKGALQQYPE-------------------------------------
A0A414P2K5      SASGTNAESAYKLLKGALQQYPE-------------------------------------
V8C417          SASGTNAESAYKLLKGALQQYPE-------------------------------------
W6RXP9          KLQGKKPKEIAEILNGINNEFIF-------------------------------------
W6S4G8          KLTGKNKDDLAVVLESITEEFIK-------------------------------------
R5B467          SVTGSDAQQCYDVLQSVIVHYPD-------------------------------------
A0A143WVN6      TVTSDTPAHAYQMIQSALDNYSS-------------------------------------
A0A3B8KKL6      SYEDSNPTLARDVVNELSNEIQE-------------------------------------
A0A2K9E6R0      SYEDSNPTLARDVVNELSNEIQE-------------------------------------
A0A2S8RBI0      SYEDSNPTLARDVVNELSNEIQE-------------------------------------
A0A0L6JLG6      SYEDYDPKLAAKVVNELGTIIMQ-------------------------------------
G8LSN0          SYEDTDPKLAADVVNELALVIKQ-------------------------------------
A0A1Q6REE0      KVRDTDPQRAYDVMSAVIACYPE-------------------------------------
R5ETF9          KVRDTDPQRAYDVMSAVIACYPE-------------------------------------
A0A0X9GDD0      TATSTDPETAAQLANSALQATAD-------------------------------------
U2A8X2          TATDESPQLAAEIANATARSLAS-------------------------------------
U2AC50          AVSDTSPDRAREIADGISDQLAL-------------------------------------
A0A1I4C3N6      YVVDPNPMNAQLIANTIGEIAPT-------------------------------------
A0A3B9CIM7      RVVDQNPVNAMNIANAIGELAPN-------------------------------------
A0A1G9WHW8      YVVDSNPLNAQKIANAIGELAPD-------------------------------------
A0A1H5VAA0      YVVDSNPLNAQKIANAIGELAPD-------------------------------------
A0A3R6VK11      YTYDSDPYRAMELANAIGRVAPK-------------------------------------
A0A3R6QUY7      YTYDSDPYRAMELANAIGRVAPK-------------------------------------
A0A373K3P9      YTYDSDPYRALELANAIGRVAPK-------------------------------------
A0A3R6JRU5      YTYDSDPYRALELANAIGRVAPK-------------------------------------
A0A1C5MS04      YTYDSDPYRAMELANAIGRVAPK-------------------------------------
A0A3C1J150      YTYDSDPYRAMELANAIGRVAPK-------------------------------------
A0A416CXD7      YTYDSDPYRAMELANAIGRVAPK-------------------------------------
R6XBL9          YTYDSDPYRAMELANAIGRVAPK-------------------------------------
A0A355W5Z7      YTYDSDPYRAMELANAIGRVAPK-------------------------------------
A0A143ZUX1      KVTASDPETAYRLAVAYMGAIDI-------------------------------------
A0A143XPI5      ETSGRDPELVYEVLESVIKNYPE-------------------------------------
A0A355G1X5      SVTTESPDKSYEIASGIASHYQD-------------------------------------
A0A0M6WXE3      SVTAHSPKDSIDIIKTVMDNYTS-------------------------------------
A0A348SAK2      SVTAHSPKDSIDIIKTVMDNYTS-------------------------------------
A0A1W1Z4C3      SCTTPYPELSADICNSVLQVAPT-------------------------------------
A0A239QN83      SCTTTDPKLSADICNSVLQVAPT-------------------------------------
A0A1G9H5B9      KSTTLEAQLSADIANAVMEIAPE-------------------------------------
A0A1G6BLF1      KATADSAQMAYNILQAVIESYPI-------------------------------------
A0A1Y4H8L0      SVSSSSPREAFDTIHAVMDNYAQ-------------------------------------
R6HZX3          TVTSTNPQDAYDILNAVIQNYPQ-------------------------------------
A0A1W2CEA6      YVKSSVPEEAKLLADTYAEVVQD-------------------------------------
R7FFK6          TTTTQNAELSASLCNIMADVAPQ-------------------------------------
A0A373MPB9      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A373L519      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A373W906      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A373VCW2      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
W0U604          TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A374B6G0      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A373VM36      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A1C5P379      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A373XXX0      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A356CW82      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
R6T4X7          TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A374HTV1      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A374GB66      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A374ECC6      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A374BM61      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A373UGZ4      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A373SA66      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A1C5X6X7      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A1C6JIH3      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A373PSC3      TATTTNAKLSSDLCNIMADVAPS-------------------------------------
A0A1K1WYK8      TATTVNPNLAADICNDITQVAPK-------------------------------------
A0A1H6IUB1      VSTTKNAEVAAALCNDLTEVAPS-------------------------------------
A0A1M7L1F9      VATTKNAEVAAALCNDLTEVAPD-------------------------------------
A0A1C6B4L6      IATAKNPEIAASICNNLTSIAPE-------------------------------------
A0A1Q6T9P4      IATAKNPEIAASICNNLTSIAPE-------------------------------------
A0A315Y4F9      NATAKNAEVAAAICNDLTQVAPQ-------------------------------------
A0A354K620      TATAENAEVAAAICNDLTQVAPK-------------------------------------
A0A355G3J9      SAEHTNRQLATDVLTDIVKVAPQ-------------------------------------
A0A3D2AD87      YISATSTDKNEAI--DLANDFAA-------------------------------------
A0A2T5IYJ6      SFESHDRSLTAAVANAMAKTYIN-------------------------------------
A0A252F281      SATADNARTAFLTVKAVMENYNT-------------------------------------
A0A348SAK1      SVSGTNAELSYKTLKSVIKNYPE-------------------------------------
A0A0M6WYQ8      SVSGTNAELSYKTLKSVIKNYPE-------------------------------------
A0A173TM61      SVTGTNAELSYKTLKSVIKNYPE-------------------------------------
A0A1Y4QKE6      SVESNSPQDAMSILTSAIEVYPD-------------------------------------
B1C231          GVESNSPQDAMSILTSAIEIYPD-------------------------------------
A0A1Y3TUL5      DLTWRSAEEGVEILNAINEVAPE-------------------------------------
A0A1Y4JAX2      DLTWRSAEEGVEILNAINEVAPE-------------------------------------
A0A1Y4T590      DLTWRSAEEGVEILNAINEVAPE-------------------------------------
A0A3C0QME1      TANTTNPEISAAICNQIAESAEE-------------------------------------
A0A355FYK5      TVTNIYPEFCSRTMDAVLDVFPD-------------------------------------
A0A357AQU0      SATTPDAKLSAEISNIFAEVAPD-------------------------------------
A0A3C1YJQ7      SATTPDAKLSAEISNIFAEVAPD-------------------------------------
A0A3D0JG38      SATTPNAKLSAEISNIFAEVAPD-------------------------------------
A0A3C0IHX1      SAQTKDPHVSAEICDIYAEVAPT-------------------------------------
R5V506          SAQTKDPHVSAEICDIYAEVAPT-------------------------------------
A0A352TIU5      SAQTKDPHVSAEICDIYAEVAPT-------------------------------------
A0A3E5FSY5      GVESNSPQDAMSILTSAIEIYPD-------------------------------------
A0A1Y3T163      RVESPDPEDAREILDTALEIYPE-------------------------------------
A0A1Y3YCA2      RVESPDPEDARKILDTALEIYPE-------------------------------------
A0A1Y4L6N9      SVVSMNASEAKTILESAIRVYPN-------------------------------------
A0A173T644      TVTSSDPQDAKAILESAIKVYPE-------------------------------------
A0A1C5TSB8      TVTSSDPQDAKAILESAIKVYPE-------------------------------------
C0CIK6          TVTSSDPQDAKAILESAIKVYPE-------------------------------------
A0A1Y3WEF6      TVTSNSPEDARAILESTIKVYPD-------------------------------------
A0A417T0L2      TVTSNSAEDAKAILESAIKVYPD-------------------------------------
A0A1H9EPU3      TVTDPDPVMSKNLADSIRDAAIK-------------------------------------
A0A354IGV3      TSTADTAYDAFICLKAVTENYNL-------------------------------------
A0A417JMV2      KVQADSPEMAFRLNKAIMNNYSV-------------------------------------
A0A415VWX5      KVQADSPEMAFRLNKAIMNNYSV-------------------------------------
A0A173UY96      KVQADSPEMAFRLNKAIMNNYSV-------------------------------------
A0A173QTL1      KVQADSPEMAFRLNKAIMNNYSV-------------------------------------
B0P408          KVQADSPEMAFRLNKAIMNNYSV-------------------------------------
D4MV82          KVQADSPEMAFRLNKAIMNNYSV-------------------------------------
A0A174A3T7      KVQADSPEMAFRLNKAIMNNYSV-------------------------------------
A0A1Q6K0H6      KVQADSPEMAFRLNKAIMNNYSV-------------------------------------
A0A174J359      KVQADSPEMAFRLNKAIMNNYSV-------------------------------------
A0A417UUA3      KVQADSPEMAFRLNKAIMNNYSV-------------------------------------
A0A1C6EUV9      KVQADSPEMAFRLNKAIMNNYSV-------------------------------------
A0A173Y645      KVQADSPEMAFSLNKAIMNNYSV-------------------------------------
A0A374AVY6      KVQADSPEMAFSLNKAIMNNYSV-------------------------------------
R7BXS4          KVQADSPEMAFSLNKAIMNNYSV-------------------------------------
A0A1V5S3C0      SVSTHDPDMSYQIAKALTSVYSQ-------------------------------------
A0A1Y3TC98      RVESPDPEDARAILEAALAIYPE-------------------------------------
R6VAT5          TVTSSNYETAYNVLKSVINNYPS-------------------------------------
A0A1Q6S448      TVTADTPRQALVLLQAVSDNYGS-------------------------------------
A0A351MYR0      TVTADTPRQALVLLKAVSDNYGS-------------------------------------
R6HPC1          TVTADTPRQALVLLKAVSDNYGT-------------------------------------
A0A3D4G5Z5      TVTADTPRQALVLLKAVSDNYGT-------------------------------------
A0A3D5ES03      TVTADTPRQALVLLKAVSDNYGT-------------------------------------
A0A0F2P7X6      FVSNPDPLLAAKICNSIMHVAPT-------------------------------------
A0A359B487      FVSNPDPLLAAKICNSIMHVAPT-------------------------------------
A0A348P5V4      TVTTTNPDVSYGIAQAYVDNYNE-------------------------------------
A0A356PT74      TVTTPNADVSYGIANAYVNNYES-------------------------------------
A0A3D5LL19      TVTTPNADVSYGIANAYVNNYES-------------------------------------
R5MNF0          TVTTPNADVSYGIANAYVNNYES-------------------------------------
A0A1Q9JSI0      KVQADSPELAFRLNKAIMNNYSV-------------------------------------
A0A3D5TNI1      TVTAGSPEEAYELAQAVKDTYKD-------------------------------------
A0A358LJD0      TVTASSPEEAYELAQAVKDTYKD-------------------------------------
R6I3L7          TVTASSPEEAYELAQAVKDTYKD-------------------------------------
A0A3D1HXX0      TVTASSPEEAYELAQAVKDTYKD-------------------------------------
A0A3D2QJB8      TVTASSPEEAYELAQAVKDTYKD-------------------------------------
D4LC36          TATTKNAALSAELCNIMADVAPE-------------------------------------
R7MQJ4          TAETADPEVSAALCNIISNVTPD-------------------------------------
A0A1V5GLC0      SATTRSPEVAAAICNDVAEVAPK-------------------------------------
W7V182          SAVTKNPEVSAAICNDIAKVAPD-------------------------------------
                                                                            

S3FFL2          YASQQQIINLPAPSSGASGTTTSERSIVADNLATLNAALTQATADRIQAEARYQQAGRAG
A0A0T8KPS6      YQTGSRSVDITAETQS-----------VLDRIVDLEKQISEQNLKRTEMERR--------
A0A0T8LA03      YQTSSKSVDISIETKG-----------VLDQIVQLETQLSELTLKRVDYDRL--------
A0A328M4V1      FQTRAHSVDISMQTKA-----------LLDQIVAIDASLQQLRMQMSDMQRH--------
A0A1G6BLB6      ---------------------------VSDKV----------------------------
B5CSZ7          ---------------------------LSDYF----------------------------
A0A1C6G8M0      ---------------------------EIPHV----------------------------
A0A416MP73      ---------------------------EIPHV----------------------------
A0A396G6S7      ---------------------------VSDYA----------------------------
A0A3E5A223      ---------------------------VSDYA----------------------------
R7D5E6          ---------------------------VSDYA----------------------------
A0A415HQH5      ---------------------------VSDYA----------------------------
A0A414W2C6      ---------------------------VSDYA----------------------------
A5ZNE7          ---------------------------VSDYA----------------------------
A0A395X821      ---------------------------VSDYA----------------------------
A0A1C5PY68      ---------------------------VSDYA----------------------------
A0A174CJF8      ---------------------------VSDYA----------------------------
A0A174R7V0      ---------------------------VSDYA----------------------------
A0A173ZYY6      ---------------------------VSLYT----------------------------
A0A3D0F0Y4      ---------------------------VSLYT----------------------------
A0A174ASH7      ---------------------------VSLYT----------------------------
A0A173SMI2      ---------------------------VSLYT----------------------------
A0A174GP12      ---------------------------VSLYT----------------------------
A6BH65          ---------------------------VSLYT----------------------------
R7G0D7          ---------------------------VSLYT----------------------------
A0A373MWV2      ---------------------------ISDYI----------------------------
A0A417CE88      ---------------------------ISDYI----------------------------
A0A416Y441      ---------------------------ISDYI----------------------------
A0A357GPJ7      ---------------------------ISDYI----------------------------
A0A396PAC1      ---------------------------ISDYI----------------------------
A0A416EYU4      ---------------------------ISDYI----------------------------
A0A416SCQ2      ---------------------------ISDYI----------------------------
A0A416TGN7      ---------------------------ISDYI----------------------------
A0A417SMF6      ---------------------------ISDYI----------------------------
A0A1Y4MW77      ---------------------------VARFV----------------------------
R6UHV6          ---------------------------FTKNV----------------------------
A0A3R9Q621      ---------------------------FIKSI----------------------------
A0A069RC75      ---------------------------EIFRI----------------------------
A0A174F2W5      ---------------------------ISDYI----------------------------
A0A174S8E9      ---------------------------ISDYI----------------------------
A0A416ZL97      ---------------------------ISDYI----------------------------
A0A174LSK1      ---------------------------ISDYI----------------------------
A0A373GY92      ---------------------------ISDYI----------------------------
A0A373NZQ6      ---------------------------ISDYI----------------------------
A0A417I9B9      ---------------------------ISDYI----------------------------
A0A417MP97      ---------------------------ISDYI----------------------------
A0A417WQF8      ---------------------------ISDYI----------------------------
A0A373RZ83      ---------------------------ISDYI----------------------------
A0A416U6I1      ---------------------------ISDYI----------------------------
R7JQZ9          ---------------------------ISDYI----------------------------
A0A1M5UYN6      ---------------------------NAEKL----------------------------
A0A176JBT8      ---------------------------EIKKL----------------------------
A0A1I5HIC6      ---------------------------RMVSI----------------------------
A0A1Y3TC51      ---------------------------VAGDV----------------------------
A0A1Y3T1N0      ---------------------------VAQDV----------------------------
A0A1Y3Y8U8      ---------------------------VAQDV----------------------------
A6CLL4          ---------------------------ETYNL----------------------------
A0A174DL89      ---------------------------ISSEI----------------------------
A0A176U8D6      ---------------------------EIPNV----------------------------
A0A1Q6KSQ5      ---------------------------EIPHV----------------------------
A0A3D3U8B3      ---------------------------EIPHV----------------------------
A0A3E5FRL7      ---------------------------VSDYV----------------------------
A0A1Y4QK93      ---------------------------VSDYV----------------------------
B1C232          ---------------------------VSDYV----------------------------
A0A401USI6      ---------------------------ESQNL----------------------------
A0A1V4IQ10      ---------------------------ETQEL----------------------------
A0A1S8TRD2      ---------------------------ETQEL----------------------------
G7M1U2          ---------------------------ETQEL----------------------------
A0A2T6KJ75      ---------------------------EIKTL----------------------------
A9KN92          ---------------------------RMVSV----------------------------
A0A352MUJ1      ---------------------------QVKEY----------------------------
R5YI67          ---------------------------QIKEI----------------------------
A0A1Y0IQP5      ---------------------------NLSRI----------------------------
A0A1M6E8I2      ---------------------------EVMRI----------------------------
A0A1Y4N105      ---------------------------VSDYL----------------------------
A0A1Y4QP75      ---------------------------VSDYL----------------------------
A0A3D4QRB5      ---------------------------EVNKL----------------------------
A0A2X2LGT4      ---------------------------VVKDV----------------------------
A0A349DEH5      ---------------------------IVAEK----------------------------
A0A3D4T7B4      ---------------------------IVAEK----------------------------
A0A350XYC7      ---------------------------IVSEI----------------------------
R6DNR8          ---------------------------IVSER----------------------------
A0A355KUM5      ---------------------------IVTER----------------------------
R5YGY6          ---------------------------IVTER----------------------------
A0A0K8J554      ---------------------------IISEV----------------------------
A0A2S4GG02      ---------------------------EIISV----------------------------
A0A3N1XSX6      ---------------------------LIKSI----------------------------
A0A1C6G0U3      ---------------------------EVKRL----------------------------
A0A3D4LLB3      ---------------------------EIQRI----------------------------
A0A0A5GPA9      ---------------------------EVESL----------------------------
A0A271M6M4      ---------------------------EIKSL----------------------------
A0A1V5LU59      ---------------------------MATDI----------------------------
A0A1E3BVC3      ---------------------------MADEI----------------------------
A3DF66          ---------------------------MADEI----------------------------
W4V1T8          ---------------------------MADEI----------------------------
A0A2V3W8U6      ---------------------------EISQL----------------------------
W1UFG0          ---------------------------EVKRI----------------------------
A0A351SRI8      ---------------------------EIVGI----------------------------
A0A1I0RG99      ---------------------------LIKSI----------------------------
A0A1I5G322      ---------------------------LIKSI----------------------------
A0A1C6ITD7      ---------------------------ISSEL----------------------------
A0A381IX63      ---------------------------ELENI----------------------------
A0A1G9IUT4      ---------------------------ELSRI----------------------------
A0A1M6RWV2      ---------------------------RIHEF----------------------------
A0A3R9WAA7      ---------------------------VAETV----------------------------
R5EFZ0          ---------------------------LTYQV----------------------------
A0A0H5SF45      ---------------------------LIANI----------------------------
A0A1M6JRJ5      ---------------------------LIEKI----------------------------
A0A1M7Y1S2      ---------------------------LIEKI----------------------------
A0A143XN92      ---------------------------VSDYV----------------------------
A0A3D5R4X5      ---------------------------EVVEI----------------------------
A0A3E4LL92      ---------------------------LSDYF----------------------------
A0A415D1L1      ---------------------------LSDYF----------------------------
A0A414P2K5      ---------------------------LSDYF----------------------------
V8C417          ---------------------------LSDYY----------------------------
W6RXP9          ---------------------------QANEL----------------------------
W6S4G8          ---------------------------ESKEI----------------------------
R5B467          ---------------------------VAELV----------------------------
A0A143WVN6      ---------------------------VSDYL----------------------------
A0A3B8KKL6      ---------------------------LAADI----------------------------
A0A2K9E6R0      ---------------------------LAADI----------------------------
A0A2S8RBI0      ---------------------------LAADI----------------------------
A0A0L6JLG6      ---------------------------LASDI----------------------------
G8LSN0          ---------------------------LASDV----------------------------
A0A1Q6REE0      ---------------------------VAEFV----------------------------
R5ETF9          ---------------------------VAEFV----------------------------
A0A0X9GDD0      ---------------------------VAAEV----------------------------
U2A8X2          ---------------------------VVAEL----------------------------
U2AC50          ---------------------------AVPEL----------------------------
A0A1I4C3N6      ---------------------------RLVGL----------------------------
A0A3B9CIM7      ---------------------------EIIRI----------------------------
A0A1G9WHW8      ---------------------------MIVTL----------------------------
A0A1H5VAA0      ---------------------------MIVTL----------------------------
A0A3R6VK11      ---------------------------EIGRI----------------------------
A0A3R6QUY7      ---------------------------EIGRI----------------------------
A0A373K3P9      ---------------------------EIGRI----------------------------
A0A3R6JRU5      ---------------------------EIGRI----------------------------
A0A1C5MS04      ---------------------------EIGRI----------------------------
A0A3C1J150      ---------------------------EISRI----------------------------
A0A416CXD7      ---------------------------EIGRI----------------------------
R6XBL9          ---------------------------EIGRI----------------------------
A0A355W5Z7      ---------------------------EIGRI----------------------------
A0A143ZUX1      ---------------------------VVNPK----------------------------
A0A143XPI5      ---------------------------VAEYI----------------------------
A0A355G1X5      ---------------------------IVDYA----------------------------
A0A0M6WXE3      ---------------------------ISYYT----------------------------
A0A348SAK2      ---------------------------ISYYT----------------------------
A0A1W1Z4C3      ---------------------------AIKDV----------------------------
A0A239QN83      ---------------------------AIKDV----------------------------
A0A1G9H5B9      ---------------------------EIVRV----------------------------
A0A1G6BLF1      ---------------------------VAESV----------------------------
A0A1Y4H8L0      ---------------------------VSYFS----------------------------
R6HZX3          ---------------------------VASFV----------------------------
A0A1W2CEA6      ---------------------------YIANK----------------------------
R7FFK6          ---------------------------FLIRV----------------------------
A0A373MPB9      ---------------------------FLIRV----------------------------
A0A373L519      ---------------------------FLIRV----------------------------
A0A373W906      ---------------------------FLIRV----------------------------
A0A373VCW2      ---------------------------FLIRV----------------------------
W0U604          ---------------------------FLIRV----------------------------
A0A374B6G0      ---------------------------FLIRV----------------------------
A0A373VM36      ---------------------------FLIRV----------------------------
A0A1C5P379      ---------------------------FLIRV----------------------------
A0A373XXX0      ---------------------------FLIRV----------------------------
A0A356CW82      ---------------------------FLIRV----------------------------
R6T4X7          ---------------------------FLIRV----------------------------
A0A374HTV1      ---------------------------FLIRV----------------------------
A0A374GB66      ---------------------------FLIRV----------------------------
A0A374ECC6      ---------------------------FLIRV----------------------------
A0A374BM61      ---------------------------FLIRV----------------------------
A0A373UGZ4      ---------------------------FLIRV----------------------------
A0A373SA66      ---------------------------FLIRV----------------------------
A0A1C5X6X7      ---------------------------FLIRV----------------------------
A0A1C6JIH3      ---------------------------FLIRV----------------------------
A0A373PSC3      ---------------------------FLIRV----------------------------
A0A1K1WYK8      ---------------------------YVEEA----------------------------
A0A1H6IUB1      ---------------------------YVEEA----------------------------
A0A1M7L1F9      ---------------------------YVEEA----------------------------
A0A1C6B4L6      ---------------------------YVAKA----------------------------
A0A1Q6T9P4      ---------------------------YVAKA----------------------------
A0A315Y4F9      ---------------------------YVEEA----------------------------
A0A354K620      ---------------------------YVEEA----------------------------
A0A355G3J9      ---------------------------EIIRV----------------------------
A0A3D2AD87      ---------------------------LCQTF----------------------------
A0A2T5IYJ6      ---------------------------SQMEARITLTQQAAEWLSSRLGVLKSNVEVSEK
A0A252F281      ---------------------------VSDQV----------------------------
A0A348SAK1      ---------------------------VAQFV----------------------------
A0A0M6WYQ8      ---------------------------VAQFV----------------------------
A0A173TM61      ---------------------------VAQFV----------------------------
A0A1Y4QKE6      ---------------------------AARFV----------------------------
B1C231          ---------------------------VARFV----------------------------
A0A1Y3TUL5      ---------------------------ILIET----------------------------
A0A1Y4JAX2      ---------------------------ILIET----------------------------
A0A1Y4T590      ---------------------------ILIET----------------------------
A0A3C0QME1      ---------------------------CLTRI----------------------------
A0A355FYK5      ---------------------------YMRTS----------------------------
A0A357AQU0      ---------------------------YLIRI----------------------------
A0A3C1YJQ7      ---------------------------YLIRI----------------------------
A0A3D0JG38      ---------------------------YLIRI----------------------------
A0A3C0IHX1      ---------------------------FLIRI----------------------------
R5V506          ---------------------------FLIRI----------------------------
A0A352TIU5      ---------------------------FLIRI----------------------------
A0A3E5FSY5      ---------------------------VARFV----------------------------
A0A1Y3T163      ---------------------------TARFV----------------------------
A0A1Y3YCA2      ---------------------------TARFV----------------------------
A0A1Y4L6N9      ---------------------------ISRFV----------------------------
A0A173T644      ---------------------------VSRFV----------------------------
A0A1C5TSB8      ---------------------------VSRFV----------------------------
C0CIK6          ---------------------------VSRFV----------------------------
A0A1Y3WEF6      ---------------------------VVRFV----------------------------
A0A417T0L2      ---------------------------VARFV----------------------------
A0A1H9EPU3      ---------------------------HIQGI----------------------------
A0A354IGV3      ---------------------------ISDNV----------------------------
A0A417JMV2      ---------------------------VTDQL----------------------------
A0A415VWX5      ---------------------------VTDQL----------------------------
A0A173UY96      ---------------------------VTDQL----------------------------
A0A173QTL1      ---------------------------VTDQL----------------------------
B0P408          ---------------------------VTDQL----------------------------
D4MV82          ---------------------------VTDQL----------------------------
A0A174A3T7      ---------------------------VTDQL----------------------------
A0A1Q6K0H6      ---------------------------VTDQL----------------------------
A0A174J359      ---------------------------VTDQL----------------------------
A0A417UUA3      ---------------------------VTDQL----------------------------
A0A1C6EUV9      ---------------------------VTNQL----------------------------
A0A173Y645      ---------------------------VTNRL----------------------------
A0A374AVY6      ---------------------------VTNQL----------------------------
R7BXS4          ---------------------------VTNQL----------------------------
A0A1V5S3C0      ---------------------------VMEGS----------------------------
A0A1Y3TC98      ---------------------------TARFV----------------------------
R6VAT5          ---------------------------VAEYV----------------------------
A0A1Q6S448      ---------------------------LSAHV----------------------------
A0A351MYR0      ---------------------------LSAHV----------------------------
R6HPC1          ---------------------------LSAHV----------------------------
A0A3D4G5Z5      ---------------------------LSAHV----------------------------
A0A3D5ES03      ---------------------------LSAHV----------------------------
A0A0F2P7X6      ---------------------------AISST----------------------------
A0A359B487      ---------------------------AISST----------------------------
A0A348P5V4      ---------------------------AIATA----------------------------
A0A356PT74      ---------------------------AINAA----------------------------
A0A3D5LL19      ---------------------------AINAA----------------------------
R5MNF0          ---------------------------AINAA----------------------------
A0A1Q9JSI0      ---------------------------VSDEL----------------------------
A0A3D5TNI1      ---------------------------VVQVY----------------------------
A0A358LJD0      ---------------------------VVQVY----------------------------
R6I3L7          ---------------------------VVRVY----------------------------
A0A3D1HXX0      ---------------------------VVQVY----------------------------
A0A3D2QJB8      ---------------------------VVQVY----------------------------
D4LC36          ---------------------------VLIRV----------------------------
R7MQJ4          ---------------------------FLIRV----------------------------
A0A1V5GLC0      ---------------------------FLDDA----------------------------
W7V182          ---------------------------YLHDA----------------------------
                                                                            

S3FFL2          ASTEALRNSAISALRQQRAELAANYQKLMVQFEPEYPAARALSAQIAQLDRSIAREESRV
A0A0T8KPS6      -------------------------------FTRQHPNFQALMNQINQL-----------
A0A0T8LA03      -------------------------------YTREHPTYRTLITQMNEL-----------
A0A328M4V1      -------------------------------FTPAHPSYKALQSQIGQM-----------
A0A1G6BLB6      ------------------------------------------------------------
B5CSZ7          ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A3D0F0Y4      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174GP12      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A2X2LGT4      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A2S4GG02      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
A0A0X9GDD0      ------------------------------------------------------------
U2A8X2          ------------------------------------------------------------
U2AC50          ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      KLQAYREENNLVDSGNNFGVLGLSAGQLQQTNQRLIEAQFKVAEISKRYGSKHPTLIQAE
A0A252F281      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A173TM61      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A1Q6K0H6      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

S3FFL2          SGSQLADYREAQERERALKAQVDALKSSYLDLRRRSIQYNIYQQEVDTNRALYDGLLQRF
A0A0T8KPS6      -----------QMQKDQLEKQIDTLPSTQQELLR-------LTRDVEVSSETYSMLLNKT
A0A0T8LA03      -----------QAQKAQLLKKVDALPMTQQELLR-------LQRDMEVTTQTYTLLMNQA
A0A328M4V1      -----------EGQKAALQKQVGQLPDIQQQMLR-------LARDVQVSNTTYTSLLNQA
A0A1G6BLB6      --------------------------------------------------------LGSV
B5CSZ7          --------------------------------------------------------ESGY
A0A1C6G8M0      --------------------------------------------------------LGSN
A0A416MP73      --------------------------------------------------------LGSS
A0A396G6S7      --------------------------------------------------------IKNV
A0A3E5A223      --------------------------------------------------------IKNV
R7D5E6          --------------------------------------------------------IKNV
A0A415HQH5      --------------------------------------------------------IKNV
A0A414W2C6      --------------------------------------------------------IKNV
A5ZNE7          --------------------------------------------------------IKNV
A0A395X821      --------------------------------------------------------IKNV
A0A1C5PY68      --------------------------------------------------------IKNV
A0A174CJF8      --------------------------------------------------------IKNV
A0A174R7V0      --------------------------------------------------------IKNV
A0A173ZYY6      --------------------------------------------------------VGSA
A0A3D0F0Y4      --------------------------------------------------------VGSA
A0A174ASH7      --------------------------------------------------------VGSA
A0A173SMI2      --------------------------------------------------------VGSA
A0A174GP12      --------------------------------------------------------VGSA
A6BH65          --------------------------------------------------------VGSA
R7G0D7          --------------------------------------------------------VGSA
A0A373MWV2      --------------------------------------------------------IPNV
A0A417CE88      --------------------------------------------------------IPNV
A0A416Y441      --------------------------------------------------------IPNV
A0A357GPJ7      --------------------------------------------------------IPNV
A0A396PAC1      --------------------------------------------------------IPNV
A0A416EYU4      --------------------------------------------------------IPNV
A0A416SCQ2      --------------------------------------------------------IPNV
A0A416TGN7      --------------------------------------------------------IPNV
A0A417SMF6      --------------------------------------------------------IPNV
A0A1Y4MW77      --------------------------------------------------------IGMT
R6UHV6          --------------------------------------------------------VSSI
A0A3R9Q621      --------------------------------------------------------KNTT
A0A069RC75      --------------------------------------------------------MNDE
A0A174F2W5      --------------------------------------------------------IPNV
A0A174S8E9      --------------------------------------------------------IPNV
A0A416ZL97      --------------------------------------------------------IPNV
A0A174LSK1      --------------------------------------------------------IPNV
A0A373GY92      --------------------------------------------------------IPNV
A0A373NZQ6      --------------------------------------------------------IPNV
A0A417I9B9      --------------------------------------------------------IPNV
A0A417MP97      --------------------------------------------------------IPNV
A0A417WQF8      --------------------------------------------------------IPNV
A0A373RZ83      --------------------------------------------------------IPNV
A0A416U6I1      --------------------------------------------------------IPNV
R7JQZ9          --------------------------------------------------------IPNV
A0A1M5UYN6      --------------------------------------------------------IPNG
A0A176JBT8      --------------------------------------------------------MKIE
A0A1I5HIC6      --------------------------------------------------------LEME
A0A1Y3TC51      --------------------------------------------------------FSNA
A0A1Y3T1N0      --------------------------------------------------------FSNA
A0A1Y3Y8U8      --------------------------------------------------------FSNA
A6CLL4          --------------------------------------------------------MQID
A0A174DL89      --------------------------------------------------------RGVD
A0A176U8D6      --------------------------------------------------------LGSS
A0A1Q6KSQ5      --------------------------------------------------------LGSN
A0A3D3U8B3      --------------------------------------------------------LGSN
A0A3E5FRL7      --------------------------------------------------------FTNA
A0A1Y4QK93      --------------------------------------------------------FTNA
B1C232          --------------------------------------------------------FTNA
A0A401USI6      --------------------------------------------------------LPSG
A0A1V4IQ10      --------------------------------------------------------IPNG
A0A1S8TRD2      --------------------------------------------------------IPDS
G7M1U2          --------------------------------------------------------IPDS
A0A2T6KJ75      --------------------------------------------------------MNLE
A9KN92          --------------------------------------------------------LEME
A0A352MUJ1      --------------------------------------------------------YHME
R5YI67          --------------------------------------------------------YNME
A0A1Y0IQP5      --------------------------------------------------------MQVD
A0A1M6E8I2      --------------------------------------------------------LKVD
A0A1Y4N105      --------------------------------------------------------FSNA
A0A1Y4QP75      --------------------------------------------------------FSNA
A0A3D4QRB5      --------------------------------------------------------LNME
A0A2X2LGT4      --------------------------------------------------------APKD
A0A349DEH5      --------------------------------------------------------YPYA
A0A3D4T7B4      --------------------------------------------------------YPYA
A0A350XYC7      --------------------------------------------------------YSNA
R6DNR8          --------------------------------------------------------YPNA
A0A355KUM5      --------------------------------------------------------YPNA
R5YGY6          --------------------------------------------------------YPNA
A0A0K8J554      --------------------------------------------------------KNNA
A0A2S4GG02      --------------------------------------------------------VKSG
A0A3N1XSX6      --------------------------------------------------------KPSA
A0A1C6G0U3      --------------------------------------------------------TNTN
A0A3D4LLB3      --------------------------------------------------------TKTN
A0A0A5GPA9      --------------------------------------------------------MNLN
A0A271M6M4      --------------------------------------------------------MKID
A0A1V5LU59      --------------------------------------------------------IQVK
A0A1E3BVC3      --------------------------------------------------------IQVK
A3DF66          --------------------------------------------------------IQVK
W4V1T8          --------------------------------------------------------IQVK
A0A2V3W8U6      --------------------------------------------------------MNLE
W1UFG0          --------------------------------------------------------TKAS
A0A351SRI8      --------------------------------------------------------FNIE
A0A1I0RG99      --------------------------------------------------------KETS
A0A1I5G322      --------------------------------------------------------KDTA
A0A1C6ITD7      --------------------------------------------------------RGVD
A0A381IX63      --------------------------------------------------------SKVD
A0A1G9IUT4      --------------------------------------------------------MKTN
A0A1M6RWV2      --------------------------------------------------------IKME
A0A3R9WAA7      --------------------------------------------------------VGTT
R5EFZ0          --------------------------------------------------------IDDI
A0A0H5SF45      --------------------------------------------------------KENS
A0A1M6JRJ5      --------------------------------------------------------KSDA
A0A1M7Y1S2      --------------------------------------------------------KTNS
A0A143XN92      --------------------------------------------------------VSNV
A0A3D5R4X5      --------------------------------------------------------MNVD
A0A3E4LL92      --------------------------------------------------------ESGY
A0A415D1L1      --------------------------------------------------------ESGY
A0A414P2K5      --------------------------------------------------------ESGY
V8C417          --------------------------------------------------------ESGY
W6RXP9          --------------------------------------------------------VPNG
W6S4G8          --------------------------------------------------------VPNG
R5B467          --------------------------------------------------------VGPT
A0A143WVN6      --------------------------------------------------------FSNA
A0A3B8KKL6      --------------------------------------------------------IEVK
A0A2K9E6R0      --------------------------------------------------------IEVK
A0A2S8RBI0      --------------------------------------------------------IEVK
A0A0L6JLG6      --------------------------------------------------------IEVK
G8LSN0          --------------------------------------------------------IQVK
A0A1Q6REE0      --------------------------------------------------------VGST
R5ETF9          --------------------------------------------------------VGST
A0A0X9GDD0      ------------------------------------------------------DKNSPL
U2A8X2          -------------------------------------------------ETPVGGGDSPV
U2AC50          -------------------------------------------------SPQLADRSSAV
A0A1I4C3N6      --------------------------------------------------------VKSG
A0A3B9CIM7      --------------------------------------------------------VKSG
A0A1G9WHW8      --------------------------------------------------------VKAG
A0A1H5VAA0      --------------------------------------------------------VKAG
A0A3R6VK11      --------------------------------------------------------VKSG
A0A3R6QUY7      --------------------------------------------------------VKSG
A0A373K3P9      --------------------------------------------------------VKSG
A0A3R6JRU5      --------------------------------------------------------VKSG
A0A1C5MS04      --------------------------------------------------------VKSG
A0A3C1J150      --------------------------------------------------------VKSG
A0A416CXD7      --------------------------------------------------------VKSG
R6XBL9          --------------------------------------------------------VKSG
A0A355W5Z7      --------------------------------------------------------VKSG
A0A143ZUX1      ---------------------------------------------------DDSSGSGTA
A0A143XPI5      --------------------------------------------------------IGST
A0A355G1X5      --------------------------------------------------------YPNA
A0A0M6WXE3      --------------------------------------------------------VGTT
A0A348SAK2      --------------------------------------------------------VGTT
A0A1W1Z4C3      --------------------------------------------------------VAAG
A0A239QN83      --------------------------------------------------------VTAG
A0A1G9H5B9      --------------------------------------------------------VGVG
A0A1G6BLF1      --------------------------------------------------------IGST
A0A1Y4H8L0      --------------------------------------------------------LGNA
R6HZX3          --------------------------------------------------------IGGT
A0A1W2CEA6      --------------------------------------------------------MELR
R7FFK6          --------------------------------------------------------VGAG
A0A373MPB9      --------------------------------------------------------IGAG
A0A373L519      --------------------------------------------------------IGAG
A0A373W906      --------------------------------------------------------IGAG
A0A373VCW2      --------------------------------------------------------IGAG
W0U604          --------------------------------------------------------IGAG
A0A374B6G0      --------------------------------------------------------IGAG
A0A373VM36      --------------------------------------------------------IGAG
A0A1C5P379      --------------------------------------------------------IGAG
A0A373XXX0      --------------------------------------------------------IGAG
A0A356CW82      --------------------------------------------------------IGAG
R6T4X7          --------------------------------------------------------IGAG
A0A374HTV1      --------------------------------------------------------IGAG
A0A374GB66      --------------------------------------------------------IGAG
A0A374ECC6      --------------------------------------------------------IGAG
A0A374BM61      --------------------------------------------------------IGAG
A0A373UGZ4      --------------------------------------------------------IGAG
A0A373SA66      --------------------------------------------------------IGAG
A0A1C5X6X7      --------------------------------------------------------IGAG
A0A1C6JIH3      --------------------------------------------------------IGAG
A0A373PSC3      --------------------------------------------------------IGAG
A0A1K1WYK8      --------------------------------------------------------VGVG
A0A1H6IUB1      --------------------------------------------------------VGVG
A0A1M7L1F9      --------------------------------------------------------VGVG
A0A1C6B4L6      --------------------------------------------------------VGVG
A0A1Q6T9P4      --------------------------------------------------------VGVG
A0A315Y4F9      --------------------------------------------------------VGVG
A0A354K620      --------------------------------------------------------VGVG
A0A355G3J9      --------------------------------------------------------VKAA
A0A3D2AD87      --------------------------------------------------------IPNN
A0A2T5IYJ6      LELNEAKKALEIAKADSLELSKKEFKFKELQREVETNRNLYDTFFARIKQANDSLELDTA
A0A252F281      --------------------------------------------------------LSGA
A0A348SAK1      --------------------------------------------------------LGNT
A0A0M6WYQ8      --------------------------------------------------------LGNT
A0A173TM61      --------------------------------------------------------LGNT
A0A1Y4QKE6      --------------------------------------------------------LGQI
B1C231          --------------------------------------------------------LGQI
A0A1Y3TUL5      --------------------------------------------------------LKIG
A0A1Y4JAX2      --------------------------------------------------------LKIG
A0A1Y4T590      --------------------------------------------------------LKIG
A0A3C0QME1      --------------------------------------------------------VGAG
A0A355FYK5      --------------------------------------------------------ASTI
A0A357AQU0      --------------------------------------------------------VGAG
A0A3C1YJQ7      --------------------------------------------------------VGAG
A0A3D0JG38      --------------------------------------------------------VGAG
A0A3C0IHX1      --------------------------------------------------------IGAG
R5V506          --------------------------------------------------------IGAG
A0A352TIU5      --------------------------------------------------------IGAG
A0A3E5FSY5      --------------------------------------------------------LGQI
A0A1Y3T163      --------------------------------------------------------LGDI
A0A1Y3YCA2      --------------------------------------------------------LGDI
A0A1Y4L6N9      --------------------------------------------------------IGNT
A0A173T644      --------------------------------------------------------IGET
A0A1C5TSB8      --------------------------------------------------------IGET
C0CIK6          --------------------------------------------------------IGET
A0A1Y3WEF6      --------------------------------------------------------IGDT
A0A417T0L2      --------------------------------------------------------IGDT
A0A1H9EPU3      --------------------------------------------------------IGVD
A0A354IGV3      --------------------------------------------------------FSSI
A0A417JMV2      --------------------------------------------------------IGNV
A0A415VWX5      --------------------------------------------------------IGNV
A0A173UY96      --------------------------------------------------------IGNV
A0A173QTL1      --------------------------------------------------------IGNV
B0P408          --------------------------------------------------------IGNV
D4MV82          --------------------------------------------------------IGNV
A0A174A3T7      --------------------------------------------------------IGNV
A0A1Q6K0H6      --------------------------------------------------------IGNV
A0A174J359      --------------------------------------------------------IGNV
A0A417UUA3      --------------------------------------------------------IGNV
A0A1C6EUV9      --------------------------------------------------------IGTV
A0A173Y645      --------------------------------------------------------IGTV
A0A374AVY6      --------------------------------------------------------IGTV
R7BXS4          --------------------------------------------------------IGTV
A0A1V5S3C0      --------------------------------------------------------FPNA
A0A1Y3TC98      --------------------------------------------------------LGDI
R6VAT5          --------------------------------------------------------VGAT
A0A1Q6S448      --------------------------------------------------------SSSA
A0A351MYR0      --------------------------------------------------------SSTA
R6HPC1          --------------------------------------------------------SSTA
A0A3D4G5Z5      --------------------------------------------------------SSTA
A0A3D5ES03      --------------------------------------------------------SSTA
A0A0F2P7X6      --------------------------------------------------------VEVG
A0A359B487      --------------------------------------------------------VEVG
A0A348P5V4      --------------------------------------------------------FPNT
A0A356PT74      --------------------------------------------------------FPST
A0A3D5LL19      --------------------------------------------------------FPST
R5MNF0          --------------------------------------------------------FPST
A0A1Q9JSI0      --------------------------------------------------------MGNV
A0A3D5TNI1      --------------------------------------------------------SGGS
A0A358LJD0      --------------------------------------------------------SGGS
R6I3L7          --------------------------------------------------------SGGS
A0A3D1HXX0      --------------------------------------------------------SGGS
A0A3D2QJB8      --------------------------------------------------------SGGS
D4LC36          --------------------------------------------------------VGAG
R7MQJ4          --------------------------------------------------------VGAG
A0A1V5GLC0      --------------------------------------------------------IGVG
W7V182          --------------------------------------------------------VGVG
                                                                            

S3FFL2          KEIGVAGGVGINN--IAVVD-A--ADVPQKPSRPRLLLNLAIALFVGLGLGVLVAFALEQ
A0A0T8KPS6      QELDIIRAGTVGN--VRIIDHA--AADLENPVKPNKPLVVIVATLLGALLATAFVYVREA
A0A0T8LA03      QEQDILRAGTIGN--VRIIDNA--YSMIEKPSKPVKPLVVAIAIFVGLLVSAAVILLRQA
A0A328M4V1      QQLNIARAGTVGN--VRVIDRA--ATDTAKPVWPRKLLLVFGATVFGGLLAVGFVFLRQL
A0A1G6BLB6      -------IMTILD--QSDIPTQ--PD---AAFAPANAMVKMF--IIVFCLMLVIVAFGST
B5CSZ7          -------VLQPLS--SISANNV--QK---TEKATLRYSLLLI--LLVLAGGIGATVCLCI
A0A1C6G8M0      -------TPTVLD--KADEFFA--EN---TRRSVVSYILIGL--MAGIVVSCGVIAISVI
A0A416MP73      -------KPTILD--KADDLFA--EN---TRRSVLSYALIGI--LAGIVIACGIVAVSVI
A0A396G6S7      -------IIETIQ--QPSVAMA--PI---NPLDEKRTVMKVF--AVAAGCLIALLAGISY
A0A3E5A223      -------IIETIQ--QPSVAMA--PI---NPLDEKRTVMKVF--AVAAGCLIALLAGISY
R7D5E6          -------IIETIQ--QPSVAMA--PI---NPLDEKRTVMKVF--AVAAGCLIALLAGISY
A0A415HQH5      -------IIETIQ--QPSVAMA--PI---NPLDEKRTVMKVF--AVAAGCLIALLAGISY
A0A414W2C6      -------IIETIQ--QPSVAMA--PI---NPLDEKRTVMKVF--VVAAGCLIALLAGISY
A5ZNE7          -------IIETIQ--QPSVAMA--PI---NPLDEKRTVMKVF--AVAAGCLIALLAGISY
A0A395X821      -------IIETIQ--QPSVAMA--PI---NPLDEKRTVMKVF--AVAAGCLIALLAGISY
A0A1C5PY68      -------IIETIQ--QPSVAMA--PI---NPLDEKRTVMKVF--VVTAGCLIVLLAGISY
A0A174CJF8      -------IIETIQ--QPSVAMA--PI---NPLDEKRTVMKVF--VVAAGCLIALLAGISY
A0A174R7V0      -------IIETIQ--QPSVAMA--PI---NPLDEKRTVMKVF--VVAAGCLIALLAGISY
A0A173ZYY6      -------VMDVLE--EPKVPYT--PD---NPLDAGGQAKKGG--LVAGALVIILLGLFSY
A0A3D0F0Y4      -------VMDVLE--EPKVPYT--PD---NPLDAGGQAKKGG--LVAGALVLILLGLFSY
A0A174ASH7      -------VMDVLE--EPKIPYT--PD---NPLDAGGQAKKGG--LVAGALVLILLGLFSY
A0A173SMI2      -------VMDVLE--EPKVPYT--PD---NPLDAGGQAKKGG--LVAGALVLILLGLFSY
A0A174GP12      -------VMDVLE--EPKVPYT--PD---NPLDAGGQAKKGG--LVAGALVLILLGLFSY
A6BH65          -------VMDVLE--EPKIPYT--PD---NPLDAGRQAKKGG--LVAGALVLILLGMFSY
R7G0D7          -------VMDVLE--EPKIPYT--PD---NPLDAGRQAKKGG--LVAGALVLILLGMFSY
A0A373MWV2      -------VLETLQ--QPQVSDN--PS---NRIPTEKYAAMAF--LAAALGTAALVGFFSF
A0A417CE88      -------VLETLQ--QPQVSGN--PS---NRIPTEKYAAMAF--LAAALGTAALVGFFSF
A0A416Y441      -------VLETLQ--QPQVSGN--PS---NRIPTEKYAAMAF--LAAALGTAALVGFFSF
A0A357GPJ7      -------VLETLQ--QPQVSDN--PS---NRIPTEKYAAMAF--LAAALGTAALVGFFSF
A0A396PAC1      -------VLETLQ--QPQVSDN--PS---NRIPTEKYAAMAF--LAAALGTAALVGFFSF
A0A416EYU4      -------VLETLQ--QPQVSDN--PS---NRIPTEKYAAMAF--LAAALGTAALVGFFSF
A0A416SCQ2      -------VLETLQ--QPQVSDN--PS---NRIPTEKYAAMAF--LAAALGTAALVGFFSF
A0A416TGN7      -------VLETLQ--QPQVSGN--PS---NRIPTEKYAAMAF--LAAALGTAALVGFFSF
A0A417SMF6      -------VLETLQ--QPQVSGN--PS---NRIPTEKYAAMAF--LAAALGTAALVGFFSF
A0A1Y4MW77      -------KFNMIE--NPSVSNV--PY---NQLNYFNTVAKGA--LIGLAVGLVIIAIYAF
R6UHV6          -------VLQTLE--EPVVPTE--PT---NPSNALKLAVIGF--FAGAAAVVLIISVLSF
A0A3R9Q621      -------EISVVD--PVVMPRQ--P----SGPHVLLNTAIGG--LMGFVLSVLLVFIWEL
A0A069RC75      -------NVRVID--YAKIPAV--P----SKPDKILNMAAGV--FFGIMGGLLVVYVLEY
A0A174F2W5      -------VLETLQ--QPQVSGN--PS---NRIPTEKYAAMAF--LAAALGTAALVGFFSF
A0A174S8E9      -------VLETLQ--QPQVSGN--PS---NRIPTEKYAAMAF--LAAALGTAALVGFFSF
A0A416ZL97      -------VLETLQ--QPQVSGV--PS---NQIPTKKYAATAF--LAAALAMAALIGLFSF
A0A174LSK1      -------VLETLQ--QPQVSGV--PS---NQIPTKKYAATAF--LAAALAMAALIGLFSF
A0A373GY92      -------VLETLQ--QPQVSGV--PS---NQIPTKKYAATAF--LAAALAMAALIGLFSF
A0A373NZQ6      -------VLETLQ--QPQVSGV--PS---NQIPTKKYAATAF--LAAALAMAALIGLFSF
A0A417I9B9      -------VLETLQ--QPQVSGV--PS---NQIPTKKYAATAF--LAAALAMAALIGLFSF
A0A417MP97      -------VLETLQ--QPQVSGV--PS---NQIPTKKYAATAF--LAAALAMAALIGLFSF
A0A417WQF8      -------VLETLQ--QPQVSGV--PS---NQIPTKKYAATAF--LAAALAMAALIGLFSF
A0A373RZ83      -------VLETLQ--QPQVSGV--PS---NQIPTKKYAATAF--LAAALAMAALIGLFSF
A0A416U6I1      -------VLETLQ--QPQVSGV--PS---NQIPTKKYAATAF--LAAALAMAALIGLFSF
R7JQZ9          -------VLETLQ--QPQVSGV--PS---NQIPTKKYAATAF--LAAALAMAALIGLFSF
A0A1M5UYN6      -------NIKIFQ--NPRSFQD--------SVNKIKIILYSF--ILGLLISITLVFLLDF
A0A176JBT8      -------NVNILT--IATPYSS--T----SKPILLFNLLLSF--AAGLILATIFVLIKEL
A0A1I5HIC6      -------KVNIVE--EGDIPSF--P----TSPSIIKNAILGS--LAGAFISTFIIILIHI
A0A1Y3TC51      -------SLRTVQ--EPEVPSA--PS---NTSAAMRYRYPLM--AAGAAGMAALICLLYV
A0A1Y3T1N0      -------SLQILQ--EPQVPSS--PS---NTSWIMARRNLLT--AAGMLAMAAVICLFYL
A0A1Y3Y8U8      -------SLQILQ--EPQVPSS--PS---NTSWIMARRNLLA--AAGMLAMAAVICLFYL
A6CLL4          -------NIQILS--YAQEQDSTTP----VKPSLILSAGISF--TIGIFLAILIVFIREA
A0A174DL89      -------NVILVD--SASIPEK--P----TKPNIIINISLSF--ILGLIFSISLVVLINY
A0A176U8D6      -------VPTVLD--KAELSFT--EN---TRHSILFYSVIGV--VVGLFLACGIIALMVI
A0A1Q6KSQ5      -------TPTVLD--KADEFFA--EN---TRRSVVSYILIGL--MAGIVVSCGVIAISVI
A0A3D3U8B3      -------TPTVLD--KADEFFA--EN---TRRSVVSYILIGL--MAGIVVSCGVIAISVI
A0A3E5FRL7      -------TLQVLQ--EPSIPIT--PS---NSSKLINYRNYIA--LLGGVAVTGIIICLYL
A0A1Y4QK93      -------TLQVLQ--EPSIPTT--PS---NSSRLINYRNYIA--LLGGIAVTGIIACLYL
B1C232          -------TLQVLQ--EPSIPTT--PS---NSSRLINYRNYIA--LLGGVAVAGIIVCLYL
A0A401USI6      -------IAKIMD--KALIPEL--P----ITPKKKFNISIGF--IIGLILSLGLVLLINY
A0A1V4IQ10      -------IVKVIE--DVVISET--L----TSSKKKMYVAIGF--MLGLMISIGIIFLIEL
A0A1S8TRD2      -------TVKVIE--DVVISET--L----TSSKKRMYVAIGF--IIGLMLSLGIIFLIEF
G7M1U2          -------TVKVIE--DVVISET--L----TSSKKRMYVAIGF--IIGLMLSFGIIFLIEF
A0A2T6KJ75      -------NVHILS--QATVNEDTKS----VKPITALFFIISA--IIGFLASYSFILIQEM
A9KN92          -------KVNIVE--EGNIPTI--P----TSPHIMKNTILSG--IIGALISAFVIIFIHI
A0A352MUJ1      -------NIRVVD--KAVAPSS--P----SNINPVKYAGIFA--VVGFVISVGVILVLNL
R5YI67          -------NIRVVD--KAVAPSA--P----SNINPVKYAGVFA--VVGFALSIGVILILNL
A0A1Y0IQP5      -------NISILD--TAKLTSDVQQP---VRPKPFLNMAAAL--VLGAMAGAGLAFLLEF
A0A1M6E8I2      -------NVEIID--EAIPIDH--P----VNINLKFNGAIGF--IVGIMTGLSIILMLEM
A0A1Y4N105      -------SLQMVQ--DASVPMS--AS---NPLNYSRIQKLGT--LASGVVMIGIIALLSI
A0A1Y4QP75      -------SLQMVQ--DASVPMS--AS---NPLNYSRIQKLGT--LASGVVMIGIIALLSI
A0A3D4QRB5      -------NVQVID--TARVSQI--P----IRPTTVRNCIIAA--FLGLMVGLGIIFLIEY
A0A2X2LGT4      PQGESTITAQVID--DAVVPVF--Q----FTPSKPRDALLGG--FLGAVLGLAIAALIGV
A0A349DEH5      -------QLNLLD--TPVLSTY--PN---STKSAVSLAAIVG--FIGAVATCIIMFIIFL
A0A3D4T7B4      -------QLNLLD--TPVLSTY--PN---STKSAVSLAAIVG--FIGAVAPCIIMFIIFL
A0A350XYC7      -------KLTLCD--RPVLSTA--PN---SNRSVFSLALMVG--FVAAVATCVVFFIMFL
R6DNR8          -------KLTLCD--KPVLSTA--PN---SNRSVVSLALMVG--FISAIACCVVFFIMFL
A0A355KUM5      -------KLTLCD--TPVLPTY--PN---SNRSVVSLALMVG--FIAAVASCVVFFIMFL
R5YGY6          -------KLTLCD--TPVLPTY--PN---SNRSVVSLALMIG--FIAAVASCVVFFIMFL
A0A0K8J554      -------KITVID--PVVFPTG--P----SGPNILLNTMIGA--LAGFFLAFTFAFLWEL
A0A2S4GG02      -------GIEVLD--EAELPTV--PY---ASTSVVKYALLGG--AAGFFLAAVCFLIKGM
A0A3N1XSX6      -------QISVVD--PVSVPTK--P----SSPNILKNTLIGG--MLGLVLSIIFSFLWEI
A0A1C6G0U3      -------KVEIID--KAIVNEK--P----IKPRKLINIAIAS--IIGILISIAFAFILDY
A0A3D4LLB3      -------NVAVVD--YARLPLA--P----VKPDIIMNTAIAG--ILGAMVILLILFLKEY
A0A0A5GPA9      -------NVQILT--RSNPDAHETP----IKPNLLMNTILSL--LLGLFLALLLVFLKEV
A0A271M6M4      -------NVDILT--GAKIVNKGRP----VKPDPVIYMVIFL--CIGVFLSFIIIFLKET
A0A1V5LU59      -------NVKVID--IAKVPET--P----ISPNKKKNVALAG--IIGLALGAGLIYLLEM
A0A1E3BVC3      -------NIKVID--TAKIPEN--P----IKPNKKMNVGAAG--LFGLVLGVGLIFLLEL
A3DF66          -------NIKVID--TAKIPEN--P----IKPNKKMNICVAG--LFGLVLGIGLIFLLEL
W4V1T8          -------NIKVID--TAKIPEN--P----IKPNKKMNVGAAG--LLGLVLGVGLIFLLEL
A0A2V3W8U6      -------NVNILT--EAKVEKHKTP----ISPKLFFNTVISF--IIGFLFACTYAFLSAY
W1UFG0          -------GVEVID--KATVPTK--H----IRPRKTVNTIIAT--LIGIILAITVILLREI
A0A351SRI8      -------NISIID--EATVGEE--P----YNVHVLKQIVLGT--GLGFVLSSIIIAICFY
A0A1I0RG99      -------QITVVD--PPTLPTS--P----SSPNILKNTLVGG--MFGFVLSIAVSLLLVL
A0A1I5G322      -------QISIVD--PPALPTS--P----SSPNIFKNTLIGG--MITFIITILISLLGEV
A0A1C6ITD7      -------NVIMVD--TASIPEK--P----SKPNIILNIGLSF--LLGLMLSICLVILIDY
A0A381IX63      -------GGQVID--EALLPTQ--P----ISPNKFRNLALGG--IIGVVIAIFVVLLLDY
A0A1G9IUT4      -------NVEIID--KSTIPDK--P----VKPNKIMNTMIGA--IIGLILGLIVTFVREY
A0A1M6RWV2      -------NVRILD--YAVVPSN--P----IKPRPMLNIAIAL--VLGLMIGIGLVFLLEY
A0A3R9WAA7      -------HLNMIE--ESGIPAF--PS---NPVDYRRLIGSGA--AIGAAIALFFIVVYAF
R5EFZ0          -------GLEVLQ--YPAVPTS--PT---NQNFAFHQMKKAA--VIAALAATALLAILSY
A0A0H5SF45      -------KISVVD--PVVYPAG--PS---GP-NIYLNTILGA--VAGLVLAIAISFFWEL
A0A1M6JRJ5      -------VINVVD--PVVYQPS--PS---GP-NTILNTLLGG--IICGFMAFFLSMVKEV
A0A1M7Y1S2      -------MIYVVD--PVVCPTS--PS---GP-NILLNTLLGG--IVCGFLAFFLFVLKEI
A0A143XN92      -------ILEVLE--EPQIPMA--AS---NANQAEDIAKKAF--WMSGTAVLALILFFSM
A0A3D5R4X5      -------NVKILD--KAVTPTS--PI---KP-NKMMNIAIAG--VLGLMLSVGLVFLIEF
A0A3E4LL92      -------VLQPLS--SISANNV--QR---TEKATVKYSALLI--LLVLAGGVGATVCLCI
A0A415D1L1      -------VLQPLS--SISANNV--QK---TEKATLRYSLLLI--LLVLAGGIGATVYLCI
A0A414P2K5      -------VLQPLS--SISANNV--QK---TEKATLRYSLLLI--LLVLAGGIGATVCLCI
V8C417          -------VLQPLS--SISANNV--QK---TEKATLRYSLLLI--FLVLAGGIGATVCLCI
W6RXP9          -------NVKVIR--EVRVPKD--PV---AP-NKVMNIAIAF--LLGLMVGVGLTFLLEY
W6S4G8          -------NVKIIR--HVKEAEA--PI---SP-NKKMNIILGF--LIGLVSGMAIVFLIEY
R5B467          -------ELVMMD--QTGVPTQ--PS---NPFSWRHSLVRGA--LIGAVLSLLVLYLSGR
A0A143WVN6      -------SLQMVR--EPNVPYG--PS---NYVNYLRIQRMAT--LAAGGLTAAVIVLVSI
A0A3B8KKL6      -------NVMVVD--EANMPNS--PV---KP-NKKMNVAVAG--LLGIVLGVGLILVLEF
A0A2K9E6R0      -------NVMVVD--EANMPNS--PV---KP-NKKMNVAVAG--LLGIVLGVGLILVLEF
A0A2S8RBI0      -------NVMVVD--EANMPNS--PV---KP-NKKMNVAVAG--LLGIVLGVGLILVLEF
A0A0L6JLG6      -------NVKVID--TAKDPKD--PV---KP-NKKMNVGLAG--FLGILLGVSLIYLLEF
G8LSN0          -------NVSIID--VAKVPER--PV---GP-SAKKNVGIAG--ILGLALAAGLIYLLEI
A0A1Q6REE0      -------VLVLLD--ESGMPTA--PV---AEFNYRYYITCGA--VVGAAVWCVILAFLVL
R5ETF9          -------VLVLLD--ESGMPTA--PV---AEFNYRYYITCGA--VVGAAVWCVILAFLVL
A0A0X9GDD0      -------EVVPLS--DARVPSA--PV---SP-DTRRNVLVGV--VAGLGAGLAIAVLRRL
U2A8X2          -------QISTVR--AASVPTA--PA---SP-NLRLNLVLGL--VIGLAVGVAVAVVREL
U2AC50          -------RITTIA--PARQPVN--PI---AP-NTRMLMMVGL--AAGLAVGVTYAVLREL
A0A1I4C3N6      -------GLQVLD--EAKLPTE--PY---ESTSTILFALIGA--VGFGVMSAVGFLFFGL
A0A3B9CIM7      -------GIEVLD--EAELPTV--PY---QSTSVLKYAVLGA--AAGFLLAAAWFLLRSM
A0A1G9WHW8      -------GVQVLD--SAELPTS--PY---QQTNVPFTAILGF--FFGAILAFIFFILKGL
A0A1H5VAA0      -------GVQVLD--SAELPTS--PY---QQTNVPFTAILGF--FFGAILAFIFFILKGL
A0A3R6VK11      -------GIEVID--YATLPEA--PY---SSTSLVKYALVGF--AGCFGASFVLFLLAGL
A0A3R6QUY7      -------GIEVID--YATLPEA--PY---SSTSLVKYALVGF--VGCFGASFVLFLLAGL
A0A373K3P9      -------GIEVID--YATLPEA--PY---SSTSLVKYALVGF--AGCFGASFVLFLLAGL
A0A3R6JRU5      -------GIEVID--YATLPEA--PY---SSTSLVKYALVGF--AGCFGASFVLFLLAGL
A0A1C5MS04      -------GIEVID--YATLPEA--PY---SSTSLVKYALVGF--AGCFGASFVLFLLAGL
A0A3C1J150      -------GIEVID--YATLPEA--PY---SSTSLVKYALVGF--AGCFGASFVLFLLAGL
A0A416CXD7      -------GIEVID--YATLPEA--PY---SSTSLVKYALVGF--AGCFGASFVLFLLAGL
R6XBL9          -------GIEVID--YATLPEA--PY---SSTSLVKYALVGF--AGCFGASFVLFLLAGL
A0A355W5Z7      -------GIEVID--YATLPEA--PY---SSTSLVKYALVGF--AGCFGASFVLFLLAGL
A0A143ZUX1      -------FVNSVQKIQPRMPQG--PN---TDYKKILYPAAGA--LLGLAVGLFLVWVLTR
A0A143XPI5      -------KLVIVD--DSGVPKE--PS---NQPNLKRMALNGC--LAGIVLSGILLAVYAL
A0A355G1X5      -------TLQIYE--KPFKPTA--HD---PQLSLMRFAAIGG--AIGFALAFIVILIVNA
A0A0M6WXE3      -------VLDVLE--DPKIPYA--PV---NPPQNGEMAKKGF--FLGMAVCILLFAIWSY
A0A348SAK2      -------VLDVLE--DPKIPYA--PV---NPPQNGEMAKKGF--FLGMAVCILLFAIWSY
A0A1W1Z4C3      -------EAKAQD--YATIPMF--AN----GRNDMKKGIIGA--LIGAVIACALLTLLFL
A0A239QN83      -------EAKAQD--YAVVPLL--AN----GRADMKKGFIGG--LAGAILACAFLTLLFM
A0A1G9H5B9      -------NVDIMD--YAVVPVL--PN---EKKAVFSSLKYGA--AAGAAFAVVLLALLYI
A0A1G6BLF1      -------TLEVMS--ESGVPTA--PS---NEDWSHGAAKTGI--LIGFVIDILVLFVYSM
A0A1Y4H8L0      -------VLEPLD--EPEIPLY--PS---NPLNTSRAMKLAF--LAAAAALAALFGLLSF
R6HZX3          -------QLSMIE--EPQVPTV--PV---NTFRGSRSAAKGV--AAGLLLGLALTLLMAI
A0A1W2CEA6      -------KPQILE--KARTPIK--PI----YPNVNATIAKGA--VLGGLGIMLIFLFIIL
R7FFK6          -------SVEKIG--DAKIYDT--PV----SPNVTKNTAIGF--AAGAMLAILVILVIDF
A0A373MPB9      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A373L519      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A373W906      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A373VCW2      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
W0U604          -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A374B6G0      -------SVEKIG--DAEVYNS--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A373VM36      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A1C5P379      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A373XXX0      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A356CW82      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
R6T4X7          -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A374HTV1      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A374GB66      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A374ECC6      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A374BM61      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A373UGZ4      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A373SA66      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A1C5X6X7      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A1C6JIH3      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A373PSC3      -------SVEKIG--DAEVYNT--PV----SPNTTKNVALGF--VGGLMVAVLVILVIDF
A0A1K1WYK8      -------SINTIG--KAKVYKK--PV----APNNTKNGILGM--AAAFLIVVMVILIIDY
A0A1H6IUB1      -------SINTID--RAKVYNS--PV----APNMKKNAVLGA--MAALMLTCMIIFLIDF
A0A1M7L1F9      -------SINTID--VAKVYNN--PV----APNMKKNAVLGA--MAALMLTCMIIFLVDF
A0A1C6B4L6      -------SINTID--KAKVYET--PV----APNVIKNTLLGM--AAALLIVVTIILITDY
A0A1Q6T9P4      -------SINTID--KAKVYET--PV----APNVIKNTLLGM--AAALLIVVTIILITDY
A0A315Y4F9      -------SINTID--TAKVYNT--PV----APNIMKNTMIGA--VAGFMLIVLIIFLIDF
A0A354K620      -------SINTID--TAKVYKH--PV----APNTMKNTALGA--AAGFMLIVLIIFLIDF
A0A355G3J9      -------SVEIIE--EPKLPTE--DE---SEWPIVGNIAIGF--ALGLVLSVAYVLLSNA
A0A3D2AD87      -------VDKNIR--VSTTNAD--ST---SVVYPRTVMSTAIAFLVGAVLAFAISFIIDI
A0A2T5IYJ6      -------NARVID--KAVVPNA--PT------KPRKTLIIGISLVLSLLFGAALAFLLDY
A0A252F281      -------VFTVVR--EPQIARA--PS---NAMSLRSRLILAG--ALGALAMLAVVILMSC
A0A348SAK1      -------TLKILD--ETGVPDD--TT---KQGVISSSWKRGA--LKGAIIGLVILSLYVL
A0A0M6WYQ8      -------TLKILD--ETGVPDD--TT---NQGVISSSWKRGA--LKGAIIGLVILSLYVL
A0A173TM61      -------TLKILD--ETGVPDD--TT---KQGVISSSWKRGA--LKGAIIGLVILSLYVL
A0A1Y4QKE6      -------QFHMIN--NPQLPTS--PY---NKLTFTNTVIVGG--IIGLVFGTVILGCMAL
B1C231          -------QFHMIN--NPQLPTD--PY---NKLTFTNTVLVGG--IIGLVSGTIILGCMAL
A0A1Y3TUL5      -------SVSVIN--EPKATYR--IG---GNVNASMWLYMS---LLGLAVGIGFSFLKFL
A0A1Y4JAX2      -------SVSVIN--EPKATYR--IG---GNVNASMWLYMS---LLGLAVGIGFSFLKFL
A0A1Y4T590      -------SVSVIN--EPKATYR--IG---GNVNASMWLYMS---LLGLAVGIGFSFLKFL
A0A3C0QME1      -------SVEVID--VAESVYK--PV----SPNKPKMALIGA--MAGLILAAFIVLMIDF
A0A355FYK5      -------NVRLIN--YPSSPAI--SN----SDNSVKIAFLAF--MAGALLIALIVVLVEI
A0A357AQU0      -------SVEIIG--AAVPATV--KS----GPSVSRYTIMGF--LIGFILVAAAIVIRTI
A0A3C1YJQ7      -------SVEIIG--AAVPATV--KS----GPSVSRYTIMGF--LIGFILVAAAIVIRTI
A0A3D0JG38      -------SVEIIG--AAVPATV--KS----GPSVSRYTIMGF--LIGFILVAAAIVIRTI
A0A3C0IHX1      -------SVEVIG--DAEIPQS--PS----APDVKKITMMAA--AAGFVLSAGVAVLIYL
R5V506          -------SVEVIG--DAEIPQS--PS----APDVKKITMMAA--AAGFVLSAGVAVLIYL
A0A352TIU5      -------SVEVIG--DAEVPQS--PS----APDVKKITMMAA--AAGFVLSAGVAVLIYM
A0A3E5FSY5      -------QFHMIN--NPQLPTD--PY---NKLTFTNTVLVGG--IIGLVSGTIILGCMAL
A0A1Y3T163      -------QFNYLN--EPETPTE--PF---NHIGLRRTLALGG--GAGALAGILILGLTAL
A0A1Y3YCA2      -------QFNYLN--EPETPTE--PF---NHIGLRRTLALGG--GAGALAGILILGLTAL
A0A1Y4L6N9      -------KFNMID--VPTEPTE--PF---NKPNYVRTTVKGA--FLGVLAGLLLVVLYAF
A0A173T644      -------KFNMID--VPTAPKE--PY---NQPNFVKKAVKGA--LLGAAAGIFLIVLYAF
A0A1C5TSB8      -------KFNMID--VPTAPKE--PY---NQPNFVKKAVKGA--LLGAAAGIFLIVLYAF
C0CIK6          -------KFNMID--VPTAPKE--PY---NQPNFVKKAVKGA--LLGAAAGIFLIVLYAF
A0A1Y3WEF6      -------RFSMID--EPTTPTE--PY---NRPSYLDQILKGA--LFGAGSGFLLICLCAL
A0A417T0L2      -------KFNMID--EPSTPTE--PY---NRPSYRGQIKKGA--VYGAGAGFLLICLYAF
A0A1H9EPU3      -------TVKAID--GDIGAVT--PT---SPSSPNVSRNTLLGMLIGIFIACAIVVLRFM
A0A354IGV3      -------VLTVID--GPYIPTQ--PS---NQIDSRDLIRKTA--GICALIMIVLIALLTL
A0A417JMV2      -------VLDVLQ--KPTVPSG--PV---NKFQPTALMKKTF--LMTIVALCGLIAILSF
A0A415VWX5      -------VLDVLQ--KPTVPSG--PV---NKFQPTALMKKTF--LMTIVALCGLIAILSF
A0A173UY96      -------VLDVLQ--KPTVPSG--PV---NKFQPTALMKKTF--FTTIVALCGLIAILSF
A0A173QTL1      -------VLDVLQ--KPTVPSG--PV---NKFQPTALMKKTF--FTTIVALCGLIAILSF
B0P408          -------VLDVLQ--KPTVPSG--PV---NKFQPTALMKKTF--FTTIVALCGLIAILSF
D4MV82          -------VLDVLQ--KPTVPSG--PV---NKFQPTALMKKTF--FTTIVALCGLIAILSF
A0A174A3T7      -------VLDVLQ--KPTVPSG--PV---NKFQPTALMKKTF--FTTIVALCGLIAILSF
A0A1Q6K0H6      -------VLDVLQ--KPTVPSG--PV---NKFQPTALMKKTF--FTTIVALCGLIAILSF
A0A174J359      -------VLDVLQ--KPTVPSG--PV---NKFQPTALMKKTF--SMTIVALCGLIAILSF
A0A417UUA3      -------VLDVLQ--KPTVPSG--PV---NKFQPTALMKKTF--FTTIVALCGLIAILSF
A0A1C6EUV9      -------VLDVLQ--NPTVPSG--PV---NEFQPAALMKKTF--VMTIIALCGLIAIVSF
A0A173Y645      -------VLDVLQ--NPTVPSG--PV---NEFQPAALMKKTF--VMTIVALCGLIAIISF
A0A374AVY6      -------VLDVLQ--NPTVPSG--PV---NEFQPAALMKKTF--VMTIVALCGLIAIISF
R7BXS4          -------VLDVLQ--NPTVPSG--PV---NEFQPAALMKKTF--VMTIVALCGLIAIISF
A0A1V5S3C0      -------KYTVVN--DATEPNS--PD---ADYSGFLYTFIGA--VSGAIVAFAIILISNR
A0A1Y3TC98      -------QFNMLD--GPETPAA--PF---NQMSVRRCLLLGG--AGGAAVSLLIFLLMSL
R6VAT5          -------DLVLVV--PPSASST--PI---NPISYREKALIGT--AVGALLGLLIVFFLEN
A0A1Q6S448      -------VLTQLN--APSLSVS--AA---RSYNVPRTCLIAA--AAGAALTAAAVVWAAV
A0A351MYR0      -------VLSQLN--SPSLSVA--PS---RSYNVPRICLIAA--IAGAALTALGVAWASV
R6HPC1          -------VLSQLN--APTLSVA--PS---RSYNVPKICLLAG--VIGAGLTAAAVAWASV
A0A3D4G5Z5      -------VLSQLN--APTLSVA--PS---RSYNVPKICLLAG--VIGAGLTAAAVAWASV
A0A3D5ES03      -------VLSQLN--APTLSVA--PS---RSYNVPKICLLAG--VIGAGLTAAAVAWASV
A0A0F2P7X6      -------SINVLD--NAKVPEF--PN----APATFRNVGVGA--VLGLMLGLGIVFMLMF
A0A359B487      -------SINVLD--NAKVPEF--PN----APATFRNVGVGA--VLGLMLGLGIVFMLMF
A0A348P5V4      -------ALTVID--PPLKAEA--PN---GDNTKLLYPMLGF--VLGFFAACLCIIVAVV
A0A356PT74      -------TLTVID--PPLLASA--PN---RDASARNYTIVGF--AAGLVISIFAIVLAVI
A0A3D5LL19      -------TLTVID--PPLLASA--PN---RDASARNYTIVGF--AAGLVISIFAIVLAVI
R5MNF0          -------TLTVID--PPLLASA--PN---RDASARNYTIVGF--AAGLVISIFAIVLAVI
A0A1Q9JSI0      -------VLDVLQ--NPTVPSG--PVNKFQPTALMKKTFVYT--L--IFLCGLIGII-SF
A0A3D5TNI1      -------I-HLCD--MPELPTE--PD---KSVGITRNAIIGA--LAGAVICALIIIIRDS
A0A358LJD0      -------I-HLCD--EPELPTK--PD---KSVGTVRNTIIGA--LAGAVICALIIIIRDS
R6I3L7          -------I-HLCD--EPELPTK--PD---KSVGTVRNAIIGA--LAGAVICALIIIIRDS
A0A3D1HXX0      -------I-HLCD--EPELPTK--PD---KSVGTVRNAIIGA--LAGAVICALIIIIRDS
A0A3D2QJB8      -------I-HLCD--EPELPTK--PD---KSVGTVRNAIIGA--LAGAVICALIIIIRDS
D4LC36          -------SVEKIG--DAKIYEA--AV----SPSVTKNTAIGF--AGGALLAILVILLIDF
R7MQJ4          -------SVEAIG--TAKVNNN--PV----SPNFLKMAVIGA--FAGMLLAALIILVIDF
A0A1V5GLC0      -------QINYID--TAKVYPN--PV----GPNIKKNTALGA--IAGAMLMALIILVIDF
W7V182          -------QINTIG--TAEVYNS--PV----APNVKKNTMLGL--MAAAMLAACIIVVIDF
                                                                            

S3FFL2          MDEAIADPSEVERQFGLPLL----------GSVP-------------------KVTDGRS
A0A0T8KPS6      LKRGVENPEDIER-TGTPVY----------ASIPFTEKQAT---LEKRLANFKRDKSTAS
A0A0T8LA03      FYRGVESPDVIEK-LGVPVY----------AGLPYSASQDQ---LNRS----RKSRDGKT
A0A328M4V1      LNRGVEDPAAIER-LGLPVY----------VSIPRSELQRERTLLRVR----HRRTVGRQ
A0A1G6BLB6      FQDAIRAENEVEKKIDTKRL----------GTLYHEKKYKTFT-----------------
B5CSZ7          FTDKIHSMEQAKRLLDIPMI----------GSLDYVKKKSGQK-----------------
A0A1C6G8M0      TNTSIKNEEDIQKCSGLSVL----------GTIPDYKGGKKRK-----------------
A0A416MP73      TNTSIKSDEDIQKCTGLSVL----------GAIPDYKG--KKQ-----------------
A0A396G6S7      IRDTIKNPGEVSTKLDTRLL----------GTIAYEKKSKALS-----------------
A0A3E5A223      IRDTIKNPGEVSTKLDTRLL----------GTIAYEKKSKALS-----------------
R7D5E6          IRDTIKNPGEVSTKLDTRLL----------GTIAYEKKSKALS-----------------
A0A415HQH5      IRDTIKNPGEVSTKLDTRLL----------GTIAYEKKSKALS-----------------
A0A414W2C6      IRDTIKNPGEVSTKLDTRLL----------GTIAYEKKSKALS-----------------
A5ZNE7          IRDTIKNPGEVSTKLDTRLL----------GTIAYEKKSKALS-----------------
A0A395X821      IRDTIKNPGEVSTKLDTRLL----------GTIAYEKKSKALS-----------------
A0A1C5PY68      IRDTIKNPGEVSTKLDTRLL----------GTIAYEKKSKALS-----------------
A0A174CJF8      IRDTIKNPGEVSTKLDTRLL----------GTIAYEKKSKALS-----------------
A0A174R7V0      IRDTIKNPGEVSTKLDTRLL----------GTIAYEKKSKALS-----------------
A0A173ZYY6      MKNTIKQENEIEKKLDARSL----------GAISYEWKYKTIR-----------------
A0A3D0F0Y4      MKNTIKQENEIEKKLDARSL----------GAISYEWKYKTIR-----------------
A0A174ASH7      MKNTIKQENEIEKKLDARSL----------GAISYEWKYKTIR-----------------
A0A173SMI2      MKNTIKQENEIEKKLDARSL----------GAISYEWKYKTIR-----------------
A0A174GP12      MKNTIKQENEIEKKLDARSL----------GAISYEWKYKTIR-----------------
A6BH65          MKNTIKQENEIEKKLDARSL----------GAISYEWKYKTIR-----------------
R7G0D7          MKNTIKQENEIEKKLDARSL----------GAISYEWKYKTIR-----------------
A0A373MWV2      LRDTVKNETEFGRKIDADLL----------GTVYHEKKRKNSS-----------------
A0A417CE88      LRDTVKNETEFGRKIDADLL----------GTVYHEKKRKNSS-----------------
A0A416Y441      LRDTVKNETEFGRKIDADLL----------GTVYHEKKRKNSS-----------------
A0A357GPJ7      LRDTVKNETEFGRKIDADLL----------GTVYHEKKRKNSS-----------------
A0A396PAC1      LRDTVKNETEFGRKIDADLL----------GTVYHEKKRKNSS-----------------
A0A416EYU4      LRDTVKNETEFGRKIDADLL----------GTVYHEKKRKNSS-----------------
A0A416SCQ2      LRDTVKNETEFGRKIDADLL----------GTVYHEKKRKNSS-----------------
A0A416TGN7      LRDTVKNETEFGRKIDADLL----------GTVYHEKKRKNSS-----------------
A0A417SMF6      LRDTVKNETEFGRKIDADLL----------GTVYHEKKRKNSS-----------------
A0A1Y4MW77      FRKTVHKTQELEEVTNIKCL----------ATVPYLKQKKRSR-----------------
R6UHV6          YKDTVKKESDINKKLITQRL----------VSIPTQKKRLSVR-----------------
A0A3R9Q621      IDVNVKDEEELKQRYNKPVI----------GNIPSYQGNDAVR-----EKLRRILPGRNK
A0A069RC75      FDNAVRSAEDIQNGIGISVI----------GSVPKLKMSGEKG-----------------
A0A174F2W5      LRDTVKNETEFGRKIDADLL----------GTVYHEKKRKNSS-----------------
A0A174S8E9      LRDTVKNETEFGRKIDADLL----------GTVYHEKKRKNSS-----------------
A0A416ZL97      LRDTVKNEAEFTRKIDADLL----------GVVYHEKKKKNSS-----------------
A0A174LSK1      LRDTVKNEAEFTRKIDADLL----------GVVYHEKKKKNSS-----------------
A0A373GY92      LRDTVKNEAEFTRKIDADLL----------GVVYHEKKKKNSS-----------------
A0A373NZQ6      LRDTVKNEAEFTRKIDADLL----------GVVYHEKKKKNSS-----------------
A0A417I9B9      LRDTVKNEAEFTRKIDADLL----------GVVYHEKKKKNSS-----------------
A0A417MP97      LRDTVKNEAEFTRKIDADLL----------GVVYHEKKKKNSS-----------------
A0A417WQF8      LRDTVKNEAEFTRKIDADLL----------GVVYHEKKKKNSS-----------------
A0A373RZ83      LRDTVKNEAEFTRKIDADLL----------GVVYHEKKKKNSS-----------------
A0A416U6I1      LRDTVKNEAEFTRKIDADLL----------GVVYHEKKKKNSS-----------------
R7JQZ9          LRDTVKNEAEFTRKIDADLL----------GVVYHEKKKKNSS-----------------
A0A1M5UYN6      LDNTIKTKEEVEKFIGLPVI----------GLIPKITEKVYLI-----------------
A0A176JBT8      KNKKFESKKGITDLLGIPYL----------GEIPAIIPQGPTN-----------------
A0A1I5HIC6      IDDTVKDVEQIEKYLGLTVL----------GTIPLETKYAGKI-----------KNKKKA
A0A1Y3TC51      MRFTVKNPLCAQRQLDGKVR----------GVIPFEQKGTALR-----------------
A0A1Y3T1N0      LRFTVKSPSSASRLLDGTVR----------GIIPFESKG--IL-----------------
A0A1Y3Y8U8      LRFTVKSPSSASRLLDGTVR----------GIIPFESKG--IL-----------------
A6CLL4          FFTKLNNQEKVERMLNAPYL----------GSVPKLPPQSNLN-----------------
A0A174DL89      LDQRIKDKDELKELITFPIL----------GEIPDFSSVNINN-----------------
A0A176U8D6      TNVSVKTDEDVQKCTGLSVL----------GAIPDYKG--KKQ-----------------
A0A1Q6KSQ5      TNTSIKNEEDIQKCSGLSVL----------GTIPDYKGGKKRK-----------------
A0A3D3U8B3      TNTSIKNEEDIQKCSGLSVL----------GTIPDYKGGKKRK-----------------
A0A3E5FRL7      FRHTLKSSKNATKLLDGRVV----------GVIPYEKKKRDKH-----------------
A0A1Y4QK93      FRHTLKSSKNAGKLLDGRVV----------GIIPYEKKKRNKH-----------------
B1C232          FRHTLKSSENATKLLDGRVV----------GVIPYEKKKRNKH-----------------
A0A401USI6      LNNTIKSEDDVQRYLNLPMV----------GIIPKQNKMVNLI-----------------
A0A1V4IQ10      LDYTFKNKEKLERIVQLPTF----------GLIPDDTKIRKTK-----------------
A0A1S8TRD2      LDYTFKDKEKLERIVQLPTF----------GIIPDDTKVRKIK-----------------
G7M1U2          LDYTFKDKEKLERIVQLPTF----------GIIPDDTKVRKIK-----------------
A0A2T6KJ75      FFTLVDSSEKAEKALALPVI----------GLVPPGEGKLIHD-----------------
A9KN92          IDDSIKNAEQIEKYLGLTVL----------GTIPLELKNSNKR-------------GKNK
A0A352MUJ1      FDSTVKNDKDIEKTLNIKTL----------ASFAKNQNARPGV-----------------
R5YI67          FDSTVKNDKDIEKALNIKTL----------ATFARNPNIKQGL-----------------
A0A1Y0IQP5      LNNTVKTEGEIEQLLQLPAL----------GAITAYDNKGRAG-----------------
A0A1M6E8I2      LDGTIKTSDDIEKHIGLPVI----------GSIFEFNSESEGI-----------------
A0A1Y4N105      FRQTVKRSKQAKYQLDGRII----------TTIPYERKYHSLQ-----------------
A0A1Y4QP75      FRQTVKRSKQAKYQLDGRII----------TTIPYERKYHSLQ-----------------
A0A3D4QRB5      LDNTIKTQEDAEEFLKLPVI----------GRIPNFDTKKSKK-----------------
A0A2X2LGT4      LDTRMRTEETLTEAGGDPVL----------GVVSKSPLLAMRG-----------------
A0A349DEH5      VKDTAKTADELSDKLDVHIL----------GSVQQITNKNKAA-----------------
A0A3D4T7B4      VKDTAKTADELSDKLDVHIL----------GSVQQITNKNKAA-----------------
A0A350XYC7      VKDTAKTADELSEKLDVHIL----------GSVQQITNKNKTA-----------------
R6DNR8          VKDTAKTADELSEKLDVHIL----------GSVQQITNKNKTA-----------------
A0A355KUM5      VKDTAKTADELSEKLDVHIL----------GSVQQITNKNKTA-----------------
R5YGY6          VKDTAKTADELSEKLDVHIL----------GSVQQITNKNKTA-----------------
A0A0K8J554      IDVKVKSKDDLMEKYQIPIL----------GAIPSFNDMIPRK------------NVLLQ
A0A2S4GG02      LNTTIRRLYEIENLFTIPIL----------GTVPQILSEKEGE-----------------
A0A3N1XSX6      FDVNIKEKEELITNYQLPVL----------GEIPNFNGYKEKQ-------------LYKR
A0A1C6G0U3      LDSKIKNKGDVEKYLDLPII----------GGIPMDKMLKKEV-----------------
A0A3D4LLB3      FDSTAKTEKDIENLLGLSII----------GAVPNFNHGSKTA-----------------
A0A0A5GPA9      IFTRADSEEKVEKVFRLSSL----------GVVPIISDEWNQK-----------------
A0A271M6M4      IFTKFDSQEKIEQAFKLPSL----------GVIPVISDKPKRS-----------------
A0A1V5LU59      IDYTFKKPEQVEKQLGLNLI----------GVVPKFEGGKRGK--------------SKN
A0A1E3BVC3      IDHTFKKPEEVERTLGINVI----------GTIPEFEGGKRGK--------------KKA
A3DF66          IDHTFKKPEEVEKMLGINVI----------GTIPAFDGGKRGK--------------KKA
W4V1T8          IDHTFKKPEEVERILGINVI----------GTIPAFEGGKRGK--------------KKA
A0A2V3W8U6      FNTKISSKEDIEKYLGLSFL----------GEVGIISKNRKNR-----------------
W1UFG0          LDKTIKTTKDIEKYFDFNIL----------GVVSK-------------------------
A0A351SRI8      FDDTVKNESDAERELGVPIL----------GAVPKYKEKVSSG-----------------
A0A1I0RG99      FDLNVKNQDELLKRYQLPIL----------GTIPNFNVNIKRK-FVLKKTILTDLLHKKV
A0A1I5G322      MDVNVKNQDDLLRKYQVPIL----------GVIPNYKNNKKKKVLLIKLTSIAKRLNKKI
A0A1C6ITD7      LDQRIKDKSELKELIHLPIL----------GEIPNFSSININN-----------------
A0A381IX63      FDNKVKTPEELEDILDTSLL----------GVIPFENEEERKK-----------------
A0A1G9IUT4      IDTKVKSSKDVEEKLNLQII----------GNIPNENNLDS-------------------
A0A1M6RWV2      LDNSFKGPDDVEKRLNLPVL----------GAVPAVENENSLR-----------------
A0A3R9WAA7      ARKTIHKPDDLIQITNVKLL----------GLLPHLRERKKNI--------------IGD
R5EFZ0          LRDAVRSGTEAREKLDCSYL----------GEISHERKYKTVF--------------ALL
A0A0H5SF45      IDVKIKSKEDLTKRYQIPIL----------GVIPDFGVKMPKR--------------YLL
A0A1M6JRJ5      LNLKVVSQEDLLKHYNIPLL----------GAIPDFAAEDNSR-----------------
A0A1M7Y1S2      LNLKVINQEDLLKHYDTPLL----------GCIPDFSPVNSSR-----------------
A0A143XN92      KKDTIKSEEEFRKKLDIRYL----------GTIYHERKHKTIR--------------SAI
A0A3D5R4X5      LDKTIKTPEDIERYLNLSII----------GAIPHNEKAEKRK-----------------
A0A3E4LL92      FTDKIHSMEQAKRLLDIPMI----------GSLDYVKKKSGQK--------------AL-
A0A415D1L1      FTDKIHSMEQAKRLLDIPMI----------GSLDHVKKKSGQK--------------AL-
A0A414P2K5      FTDKIHSMEQAKRLLDIPMI----------GSLDYVKKKSGQK--------------AL-
V8C417          FTDKIHSMEQAKRLLDIPMI----------GSLDYVKKKSGQK--------------AL-
W6RXP9          LDNTFKTKESVEGALNIPVM----------GVIPQMSNSSKPG--------------KKY
W6S4G8          MNNTYKSKEEVERNLKLPVL----------GVIPKFGRK------------------REK
R5B467          ARATVMNRDDLQQATSARYL----------GALPAVRVKKRSR--------------TT-
A0A143WVN6      LRPTVKRKSSARRQLDGRIL----------ATIPY-------E--------------RKY
A0A3B8KKL6      VDHTFKKPDEVERYLSLNVV----------GTIPKFKGGKRGK--------------SKA
A0A2K9E6R0      VDHTFKKPDEVERYLSLNVV----------GTIPKFKGGKRGK--------------SKA
A0A2S8RBI0      VDHTFKKPDEVERYLSLNVV----------GTIPKFKGGKRGK--------------SKA
A0A0L6JLG6      IDHTFKKPEDVEHHLGLNVI----------GTVPAFEGGKRGN--------------KKA
G8LSN0          MDYTFKKPEDVERQMELTVI----------GAVPKFEGGKRGK--------------NEK
A0A1Q6REE0      MKNTVHNEDELRETLNAPCL----------GQIPAVKISRKRP--------------YP-
R5ETF9          MKNTVHNEDELRETLNAPCL----------GQIPAVKISRKRP--------------YP-
A0A0X9GDD0      LDVKVRSRADVKEITGAGVI----------GAV--------PE--------------NA-
U2A8X2          LDTRVRSTADVEDVTDAPVL----------GVI--GYEADAPE--------------HP-
U2AC50          LARRVVSSSSIQSMLGVPFL----------GEV--VKVPSRTS--------------LP-
A0A1I4C3N6      QDTRIRRKYEVEDMFNIPII----------GTVPLVESTDK-------------------
A0A3B9CIM7      LDTTVRRKYEIEDLFTIPIL----------GDVPQMEPAAKG------------------
A0A1G9WHW8      LNTTIRKKYEIEDMFTIPIL----------GDVPEIETEEAKG--------------VIK
A0A1H5VAA0      LNTTIRKKYEIEDMFTIPIL----------GDVPEIETEETKG--------------VIK
A0A3R6VK11      MDTTIRRRYELKLAFRIPVL----------GDIPQIQASDRK------------------
A0A3R6QUY7      MDTTIRRRYELKLAFRIPVL----------GDIPQIQAPDRK------------------
A0A373K3P9      MDTTIRRRYELKLAFRIPVL----------GDIPQIQAPDRK------------------
A0A3R6JRU5      MDTTIRRRYELKLAFRIPVL----------GDIPQIQAPDRK------------------
A0A1C5MS04      MDTTIRRRYELKLAFRIPVL----------GDIPQIQAPDRK------------------
A0A3C1J150      MDTTIRRRYELKLAFRIPVL----------GDIPQIQAPDRK------------------
A0A416CXD7      MDTTIRRRYELKLAFRIPVL----------GDIPQIQAPDRK------------------
R6XBL9          MDTTIRRRYELKLAFRIPVL----------GDIPQIQAPDRK------------------
A0A355W5Z7      MDTTIRRRYELKLAFRIPVL----------GDIPQIQAPDRK------------------
A0A143ZUX1      VSHTIQSEDDVYDFLPVKLF----------ASIPTIGSRSRS------------------
A0A143XPI5      TRNTICGDEDVKKIMQIKSL----------GTLPTV--------------KMKKRRK---
A0A355G1X5      ARDTLMSSDDVQIKLDAKLL----------GTVYTV------------------RNKSGK
A0A0M6WXE3      MHNTVKQEREVEKKLDARSL----------GAISYE--------------WKYKTIKEWI
A0A348SAK2      MHNTVKQEREVEKKLDARSL----------GAISYE--------------WKYKTIKEWI
A0A1W1Z4C3      MNHRVEKPAELTDNYTPPIL------------------------------SYIRRAKGE-
A0A239QN83      MNHQVEKPGEITDHYTPPIL------------------------------SYIRRAKGS-
A0A1G9H5B9      LNQKITDLRELKENYKLPIL----------AEIKRLDSAK--------------------
A0A1G6BLF1      TKRTIRKEKDFAKILNVKCI----------AAIPHV--------------RFKKRGKNAS
A0A1Y4H8L0      FRDTVKQEDDVEAKLDTRSL----------GALVYE--------------PKAKNLRELF
R6HZX3          GRKTVRTADDLKRSTSVPCM----------GTIPAI--------------QVKRRRKAAG
A0A1W2CEA6      LDDRIRSGEDITKAVDLPVF----------GAVTRQNME-----------RNAAELGADM
R7FFK6          FDNTIKDSSELGEHFQKPMI----------GEIQSIGG------------KVKKKDRGTS
A0A373MPB9      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A373L519      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A373W906      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A373VCW2      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
W0U604          FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A374B6G0      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A373VM36      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A1C5P379      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A373XXX0      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A356CW82      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
R6T4X7          FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A374HTV1      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A374GB66      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A374ECC6      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A374BM61      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A373UGZ4      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A373SA66      FDNTVKNSDELGDIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A1C5X6X7      FDNTVKNSDELGEIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A1C6JIH3      FDNTVKNSDELGEIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A373PSC3      FDNTVKNSDELGEIYQKPIV----------GEIMNIGG------------KTSKKDEGSS
A0A1K1WYK8      FDNTIKESEKIAKKYDKAII----------GEIQQFG--------------EGKKKKKGK
A0A1H6IUB1      FDNTVKDTDSVADKFKKPII----------GEIAAFG--------------VEKKKKDSD
A0A1M7L1F9      FDNTVRDTDAVGKEFKKPII----------GEIASFG--------------IEKKKKDQD
A0A1C6B4L6      FDNTVKDVALLEKKYKKAII----------GEIQEFA--------------AERNDKSSK
A0A1Q6T9P4      FDNTVKDVALLEKKYKKAII----------GEIQEFA--------------AERNDKSSK
A0A315Y4F9      FDNTIKDTDALGKKYNKAII----------GDIQAFG--------------DSKKKRDAD
A0A354K620      FDTTIKDTDDLGKKYNKAII----------GEIQAFG--------------DSKKKKDAD
A0A355G3J9      LDTTIYGRKEIENAFTLPII----------ATIPIQGE------------GKPNGKRNSF
A0A3D2AD87      SDQSIRGEDEFVNQYEIPLL----------GSIPDFDNIVSSPNYKGYYGKASYRSRLKK
A0A2T5IYJ6      LDSTFKNAEDVEDKLGISML----------GMVPLI---------------------KKR
A0A252F281      LRDTVKREEEVKEKLDTHLI----------ASVPHE-----------------KRPDGKN
A0A348SAK1      TRRTVKTGKEIKTHLNLVDL----------GTLPEV-----------------HVKKRNK
A0A0M6WYQ8      TRRTVKTGKEIKTHLNLVDL----------GTLPEV-----------------HVKKRNK
A0A173TM61      TRRTVKTGKEIKTHLNLVDL----------GTLPEV-----------------HVKKRNK
A0A1Y4QKE6      FRKTVKNPEDMKRITNLNCM----------ATIPRV------------------KIKARK
B1C231          FRKTVKNPEDMKRITNLNCM----------ATIPQV------------------KFKARK
A0A1Y3TUL5      LLPTVVNTKDIENTLGLEVL----------GEIPEN---------------------VEY
A0A1Y4JAX2      LLPTVVNTKDIENTLGLEVL----------GEIPEN---------------------VEY
A0A1Y4T590      LLPTVVNTKDIENTLGLEVL----------GEIPEN---------------------VEY
A0A3C0QME1      FDNSVRSSEMLTTKYEKAVF----------GEIVNFSDGNSK--------KVQSEHR---
A0A355FYK5      FSDTIKDIDDIRNKTNVPII----------GSIPYVGKSTGL--------INKKPL----
A0A357AQU0      TDNTFRDAEDINKKFGLSVL----------GEVMDYGTKKDK--------KKRRNVDPSK
A0A3C1YJQ7      TDNTFRDAEDINKKFGLSVL----------GEVMDYGTKKDK--------KKRRNVDPSK
A0A3D0JG38      TDNTFRDAEDINKKFGLSVL----------GEVMDYGTKKDK--------KKRRNVDPSK
A0A3C0IHX1      LDRTIKGEDDI-QSFSISYL----------GEVPEMVEARSG--------KRKRRKKKNS
R5V506          LDRTIKGEDDI-QSFSISYL----------GEVPEMVEARSG--------KRKRRKKKNS
A0A352TIU5      LDRTIKGEDDI-QSFSISYL----------GEVPEMVEARSG--------KRKRRKKKNS
A0A3E5FSY5      FRKTVKNPEDMKRITNLNCM----------ATIPQV------------------KFKARK
A0A1Y3T163      FRRTARNPEEMQKITSLRCL----------AMIPQV--------------RF----KARK
A0A1Y3YCA2      FRRTARNPEEMQKITSLRCL----------AMIPQV--------------RF----KARK
A0A1Y4L6N9      LKRTVQKPEELKKVSNLKCL----------AKIPNV--------------RQ----KARK
A0A173T644      FRKTVQTPDELKNVMSLPCL----------GNLPEM--------------KQ----KARK
A0A1C5TSB8      FRKTVQTPDELKNVMSLPCL----------GNLPEM--------------KQ----KARK
C0CIK6          FRKTVQTPDELKNVMSLPCL----------GNLPEM--------------KQ----KARK
A0A1Y3WEF6      FKKTVQKPEELNSVMSLSCI----------ANIPEV--------------SK----KLRK
A0A417T0L2      FKKTVQKPEELKSVMSLSCI----------ANIPEV--------------SR----KLRK
A0A1H9EPU3      LDDSIKTQEDVENKIGLSVLANMPYKENIEEGLYEN--------------DPEKKEKNKL
A0A354IGV3      VRDTIQTPTCIERKLDIKRF----------GVIYHE--------------RKNRTLRDSL
A0A417JMV2      LKDTVRKPKEVSRKLDAKLL----------QTLYHE--------------KIYKTWKARI
A0A415VWX5      LKDTVRKPKEVSRKLDAKLL----------QTLYHE--------------KIYKTWKARI
A0A173UY96      LKDTVRKPKEVSRKLDAKLL----------QTLYHE--------------KIYKTWKARI
A0A173QTL1      LKDTVRKPKEVSRKLDAKLL----------QTLYHE--------------KIYKTWKARI
B0P408          LKDTVRKPKEVSRKLDAKLL----------QTLYHE--------------KIYKTWKARI
D4MV82          LKDTVRKPKEVSRKLDAKLL----------QTLYHE--------------KIYKTWKARI
A0A174A3T7      LKDTVRKPKEVSRKLDAKLL----------QTLYHE--------------KIYKTWKARI
A0A1Q6K0H6      LKDTVRKPKEVSRKLDAKLL----------QTLYHE--------------KIYKTWKARI
A0A174J359      LKDTVRKPKEVSRKLDAKLL----------QTLYHE--------------KIYKTWKARI
A0A417UUA3      LKDTVRKPKEVSRKLDAKLL----------QTLYHE--------------KIYKTWKARI
A0A1C6EUV9      LKDTVRKPKEVSKKLDGTLL----------QTLYHE--------------RIYKSWKARI
A0A173Y645      LKDTVRKPKEVSKKLDGTLL----------QTLYHE--------------RLYKSWKARI
A0A374AVY6      LKDTVRKPKEVSKKLDGTLL----------QTLYHE--------------RSYKSWKARI
R7BXS4          LKDTVRKPKEVSKKLDGTLL----------QTLYHE--------------RSYKSWKARI
A0A1V5S3C0      IKNLVQTSDDIRKRYNLNII----------AVVSKLDLKR----------RKNSPKKG--
A0A1Y3TC98      FWKAVCSPEDMKKITSLRCL----------AFIPHV--------------RFKARKKLDD
R6VAT5          LNHTVRHPDEIRKLLNNQRL----------GSIVKVVKKK-------------------S
A0A1Q6S448      FSGTVQTLEGARSGLDARII----------SSVPHEGRRTRKLLGWFDDRRRERRARRGG
A0A351MYR0      SSGTVQTQEGARSDLDAKII----------STVPHEGRRTRKLLGWMDD-RRERQARRGG
R6HPC1          TSGTVQTQEGARSDLDAKLI----------STVPHEGRRTRKLLGWMDD-RWERRSRRGG
A0A3D4G5Z5      TSGTVQTQEGARSDLDAKLI----------STVPHEGRRTRKLLGWMDD-RRERRSRRGG
A0A3D5ES03      TSGTVQTQEGARSDLDAKLI----------STVPHEGRQTRKLLGWMDD-RRERRSRRGG
A0A0F2P7X6      FDRTIKSGDDVKNKLGLTLL----------GSIPYLSPKA----------RKGQGQSQGQ
A0A359B487      FDRTIKSGDDVKNKLGLTLL----------GSIPYLSPKA----------RK------DQ
A0A348P5V4      FKDTIKNSDEVTNKLGMKLL----------GVIGRVYR-K----------NK--KGESKQ
A0A356PT74      AKDTVKTADDVKDKLGVDVI----------GMVAHVNRKK----------KK--KGEDYK
A0A3D5LL19      AKDTVKTADDVKDKLGVDVI----------GMVAHVNRKK----------KK--KGEDYK
R5MNF0          AKDTVKTADDVKDKLGVDVI----------GMVAHVNRKK----------KK--KGEDYK
A0A1Q9JSI0      LKDTVRKPKEVSRKLDGKLL----------ETLYHEKRYK----------TW--KARLHR
A0A3D5TNI1      ARNTVRSQEDIQNKLQLNVI----------GEVSQVPGGE----------RF--YKKSAH
A0A358LJD0      ARNTVRSQEDIQNKLQLNVI----------GEVSQVPGGE----------RF--YKKSAH
R6I3L7          ARNTVRSQEDIQNKLQLNVI----------GEVSQVPSGE----------RF--YKKSAH
A0A3D1HXX0      ARNTVRSQEDIQNKLQLNVI----------GEVSQVPSGE----------RF--YKKSTH
A0A3D2QJB8      ARNTVRSQEDIQNKLQLNVI----------GEVSQVPSGE----------RF--YKKSAH
D4LC36          FDNTVRGTEELREHFSKPII----------AEIQSIGGKA----------KK--KNRGTD
R7MQJ4          FDNTVKDKEEIAQKYEKAII----------GEIPEFIDDK----------KK--KKDSND
A0A1V5GLC0      FDNTFKDPEALREKYKKAVV----------GEIQDFTIGR----------KK--KG--ED
W7V182          FDNTVKDAGRLGESYKKAII----------GEIQQFDESK----------KR--KKDVDD
                                                                            

S3FFL2          P------------------------RDVLFDRKSD------MVDAYLAVQTNLGFTTA--
A0A0T8KPS6      Y------------------------LLTINDPADL------ATEAMRSLRTSLHFAMI--
A0A0T8LA03      R------------------------LLSLTEPTDL------AVESLRSLRTSLKFAML--
A0A328M4V1      N------------------------LLAAGAPTDL------AVEALRSLRTSLHFARL--
A0A1G6BLB6      ---RRSKKKKRSIL-----------ITD--PTVSF-----SYSEAVRRMVSRVRNKMN--
B5CSZ7          -----------ALL-----------ISD--QDTDH-----VYEEAVDRIVTSIRSEMS--
A0A1C6G8M0      -----------EKI-----------IWP--DELPF-----SAAEAIYQLRTAILYSSK--
A0A416MP73      -----------KKI-----------MWP--EDLPF-----NASEAIYQLRTGILYSSK--
A0A396G6S7      ---MKRKKDYLSML-----------IQN--PLRSF-----AYVESSKMAASRVRSYMD--
A0A3E5A223      ---MKRKKDYLSML-----------IQN--PLRSF-----AYVESSKMAASRVRSYMD--
R7D5E6          ---MKRKKDYLSML-----------IQN--PLRSF-----AYVESSKMAASRVRSYMD--
A0A415HQH5      ---MKRKKDYLSML-----------IQN--PLRSF-----AYVESSKMAASRVRSYMD--
A0A414W2C6      ---MKRKKDYLSML-----------IQN--PLRSF-----AYVESSKMAASRVRSYMD--
A5ZNE7          ---MKRKKDYLSML-----------IQN--PLRSF-----AYVESSKMAASRVRSYMD--
A0A395X821      ---MKRKKDYLSML-----------IQN--PLRSF-----AYVESSKMAASRVRSYMD--
A0A1C5PY68      ---MKRKKDYLSML-----------IQN--PLRSF-----AYVESSKMAASRVRSYMD--
A0A174CJF8      ---MKRKKDYLSML-----------IQN--PLRSF-----AYVESSKMAASRVRSYMD--
A0A174R7V0      ---MKRKKDYLSML-----------IQN--PLRSF-----AYVESSKMAASRVRSYMD--
A0A173ZYY6      ---DIFRRKKKAIL-----------VDD--PVASF-----RFVESYKKLAAKVEYRMA--
A0A3D0F0Y4      ---DIFRRKKKAIL-----------VDD--PVASF-----RFVESYKKLAAKVEYRMA--
A0A174ASH7      ---DIFRRKKKAIL-----------VDD--PVASF-----RFVESYKKLAAKVEYRMA--
A0A173SMI2      ---DIFRRKKKAIL-----------VDD--PVASF-----RFVESYKKLAAKVEYRMA--
A0A174GP12      ---DIFRRKKKAIL-----------VDD--PVASF-----RFVESYKKLAAKVEYRMA--
A6BH65          ---DIFRRKKKAIL-----------VDD--PVASF-----RFVESYKKLAAKVEYRMA--
R7G0D7          ---DIFRRKKKAIL-----------VDD--PVASF-----RFVESYKKLAAKVEYRMA--
A0A373MWV2      ------------ML-----------ITN--PARSF-----PYVESLKRIASRVRGRLD--
A0A417CE88      ------------ML-----------ITN--PARSF-----PYVESLKRIASRVRGRLD--
A0A416Y441      ------------ML-----------ITN--PARSF-----PYVESLKRIASRVRGRLD--
A0A357GPJ7      ------------ML-----------ITN--PARSF-----PYVESLKRIASRVRGRLD--
A0A396PAC1      ------------ML-----------ITN--PARSF-----PYVESLKRIASRVRGRLD--
A0A416EYU4      ------------ML-----------ITN--PARSF-----PYVESLKRIASRVRGRLD--
A0A416SCQ2      ------------ML-----------ITN--PARSF-----PYVESLKRIASRVRGRLD--
A0A416TGN7      ------------ML-----------ITN--PARSF-----PYVESLKRIASRVRGRLD--
A0A417SMF6      ------------ML-----------ITN--PARSF-----PYVESLKRIASRVRGRLD--
A0A1Y4MW77      ---------GKTIM-----------PSILNLQTNP-----LFLENIESLHIRLAKELA--
R6UHV6          ---EKVKGIKRPLS-----------ITN--PVISF-----EFREAFKRLRQKIVSDSK--
A0A3R9Q621      NRQAGRGKAKSGGL-----------DKIIDENTKF-----IITEAYRALRSNLRYTLR--
A0A069RC75      -----------AEL-----------VIK--TSPKS-----PGAEAFRSIRTNMQFANI--
A0A174F2W5      ------------ML-----------ITN--PARSF-----PYVESLKRIASRVRGRLD--
A0A174S8E9      ------------ML-----------ITN--PARSF-----PYVESLKRIASRVRGRLD--
A0A416ZL97      ------------ML-----------ITN--PARSF-----LYVESLKRIASRVRGRLN--
A0A174LSK1      ------------ML-----------ITN--PARSF-----LYVESLKRIASRVRGRLD--
A0A373GY92      ------------ML-----------ITN--PARSF-----LYVESLKRIASRVRGRLD--
A0A373NZQ6      ------------ML-----------ITN--PARSF-----LYVESLKRIASRVRGRLD--
A0A417I9B9      ------------ML-----------ITN--PARSF-----LYVESLKRIASRVRGRLD--
A0A417MP97      ------------ML-----------ITN--PARSF-----LYVESLKRIASRVRGRLD--
A0A417WQF8      ------------ML-----------ITN--PARSF-----LYVESLKRIASRVRGRLD--
A0A373RZ83      ------------ML-----------ITN--PARSF-----LYVESLKRIASRVRGRLD--
A0A416U6I1      ------------ML-----------ITN--PARSF-----LYVESLKRIASRVRGRLD--
R7JQZ9          ------------ML-----------ITN--PARSF-----LYVESLKRIASRVRGRLD--
A0A1M5UYN6      ----------------------------VKSNPSS-----IAAEGFRTLRTNIQYSSI--
A0A176JBT8      ----KYLDERYNKL-----------VAH--TEPHS-----SSSEAYRSVRANLDILRQ--
A0A1I5HIC6      IKKRKKEENIYPEG-----------ISIEKASLEF-----SVNEAYKTLRTNIQFCGK--
A0A1Y3TC51      ----QKKNPKEALL-----------LDS--PVVSM-----GFAEAGRRTAARVEYHMR--
A0A1Y3T1N0      ----GRKNTKKALL-----------LNS--PLVSM-----DFAEASRRAEAKVEYHMR--
A0A1Y3Y8U8      ----GRKNAKKALL-----------LNS--PLVSM-----DFAEASRRAEAKVEYHMR--
A6CLL4          -NKHSPNNTYSKFL-----------ISS--SEANS-----PAMELYREIRTNIQFLLK--
A0A174DL89      ---------KGNYL-----------FVN--ESPKS-----LPSEAINILRTNLQFCNV--
A0A176U8D6      -----------KKI-----------MWP--ENLPF-----NASEAIYQLRTGILYSSK--
A0A1Q6KSQ5      -----------EKI-----------IWP--DELPF-----SAAEAIYQLRTAILYSSK--
A0A3D3U8B3      -----------EKI-----------IWP--DELPF-----SAAEAIYQLRTAILYSSK--
A0A3E5FRL7      -----LKKLKQSLL-----------ISS--PIASM-----NFVEANGRMSSRIEYHLN--
A0A1Y4QK93      -----LKKSKQSLL-----------ITS--PIASM-----NFVEANGRMSSRIEHHFD--
B1C232          -----LKKSKQSLL-----------ISS--PIASM-----NFVEANGRMSSRIEHNFD--
A0A401USI6      ----------------------------VEREPKS-----PVTEAFKSMRTNLLFSME--
A0A1V4IQ10      -----------NHI-----------TLIVEQKPKS-----IVAEAYRTLITNILYSES--
A0A1S8TRD2      -----------NHI-----------ALIVEKKPKS-----IVAEAYRTLITNILYSES--
G7M1U2          -----------NHI-----------TLIVEKKPKS-----IVAEAYRTLITNILYSES--
A0A2T6KJ75      ------------------------------LPTFD-----VFTEMFRSIRANLLYVLS--
A9KN92          KAYKRKKGDTNNEH-----------SSIQKATLEF-----TINEAYKSLRTNIQFCGK--
A0A352MUJ1      ----------------------------IDLDPKS-----QIAEGFKSLRTNLQFMKG--
R5YI67          ----------------------------IDLDPKS-----QCAEGFKSLRTNLQFMNG--
A0A1Y0IQP5      -----------HRL-----------AVR--QDPRS-----AEAEAFRTLRTNIQYDEA--
A0A1M6E8I2      -------------------------IVH--ENPKS-----PISEAYRSLRTNINFANL--
A0A1Y4N105      ---ELKKKPKKSVL-----------INS--PLLSM-----PYSEANRKLGALIERHMR--
A0A1Y4QP75      ---ELKKKPKKSVL-----------INS--PLLSM-----PYSEANRKLGALIERHMR--
A0A3D4QRB5      -----KSADRSPRL-----------ATG--AATRA-----PVTEAYKTLRTNIQFSNV--
A0A2X2LGT4      --------------------------IAVAQEPLG-----HTSEEFRRIRSALAYANV--
A0A349DEH5      ----------KGLL-----------VTD--RKNGF-----SFIETYKSIRTKIENNSA--
A0A3D4T7B4      ----------KGLL-----------VTD--RKNGF-----SFIETYKSIRTKIENNSA--
A0A350XYC7      ----------KGLL-----------VTD--RKNGF-----SFIETYKAIRTKIENNST--
R6DNR8          ----------KGLL-----------VTD--RKNGF-----SFIETYKAIRTKIENNST--
A0A355KUM5      ----------KGLL-----------VTD--RKNGF-----SFIETYKAIRTKIENNST--
R5YGY6          ----------KGLL-----------VTD--RKNGF-----SFIETYKSIRTKIENNST--
A0A0K8J554      KMSFLNRKKKKSNL-----------NQMINEQANF-----IITEAYKALRINLLYTIR--
A0A2S4GG02      ----------KADV-----------YLN--EKSSF-----HLKEAYSNIRANLLFTRR--
A0A3N1XSX6      YFPFLLKYKKFSKT-----------ERELMDNSKF-----IITESYKSLRTNLRFTLL--
A0A1C6G0U3      --------------------------TNTLISNEG-----PILEAYRSIRTNIEFFNI--
A0A3D4LLB3      ----------YGNF-----------LIK--DNPSS-----PTAEAYRKITTNIEFSNV--
A0A0A5GPA9      -KEDLMQNDRYFKL-----------LPR--LGTYS-----PITEAYRSIRTNLQYTLN--
A0A271M6M4      -NGLFDREDRFNKM-----------LPQ--LNPYS-----AVTEAYRAVRTNVQYTIS--
A0A1V5LU59      KDQKQLEQDYLKNL-----------ITK--NDPKA-----PASEAFREIRTNLHYTSV--
A0A1E3BVC3      KDEKELQEQYLKNL-----------IVH--NNPKA-----TSAEAFRELRTNLYYSSV--
A3DF66          KDEKELQEQYLKNL-----------IVH--NNPKS-----ATAEAFRELRTNLYYSSV--
W4V1T8          KDEKELQEEYLKNL-----------IVH--NNPKS-----ASAEAFRELRTNLHYSSV--
A0A2V3W8U6      --LNSNKKEDLHSI-----------LTSRKGPMST-----PVLEAYRSIRTNLQFQLM--
W1UFG0          ---------QKEKL-----------MYVKDLDRKN-----LVQEEFIKIRTNIQYANI--
A0A351SRI8      ---------KASDL-----------IIC--KDSKS-----GISEAIRTLRTNLQFSSI--
A0A1I0RG99      ---------KRNNI-----------SKN--KDTEF-----VIAEAYKSLRSNLNFTLR--
A0A1I5G322      DSKENKKAGKSENI-----------KENAEKDTQF-----IITEAYNSLRTNLKFTLR--
A0A1C6ITD7      ---------EDNYL-----------FAN--VSPKS-----LPSEAINILRTNLQFCNV--
A0A381IX63      ---------YEGNV-----------TII--GNSKS-----SVSEAYRNTRTNIQFSNL--
A0A1G9IUT4      ------------------------------KNMKS-----ILDENYKNIRTNIEFSNV--
A0A1M6RWV2      -------------L-----------ITM--KDPKS-----PISEAYRILRTNIQFSNL--
A0A3R9WAA7      VRKR---------------------AQT--DRMAL-----GYMDDMYKIRTRLNKIIT--
R5EFZ0          RRKKTSI------L-----------ITN--PVTSF-----RFVESIRKLRRRVEQHM---
A0A0H5SF45      MQKLPFKNRLNEIIKDKVEF---NQVKN--QEANF-----LVNEAYKALRTNLLYTIR--
A0A1M6JRJ5      --DKSIPARLKKLIRKGYGEDLNQGLIT---QDSF-----LVTESYKALRTNLRFSIR--
A0A1M7Y1S2      --KNKILLELKGILIKGENFMKPEKIQN--RQNSF-----LVAESYKTLRTNLRFSIR--
A0A143XN92      KRESVNM------L-----------ITN--PILSR-----KYINSIEITAAKVRNRMD--
A0A3D5R4X5      -------------V-----------VTF--EDPKS-----PVAEAYRSLRTNLKFASL--
A0A3E4LL92      -------------L-----------ISD--QDTDH-----VYEEAVDRIVTSIGSEMS--
A0A415D1L1      -------------L-----------ISD--QDTDH-----VYEEAVDRIVTSIRSEMS--
A0A414P2K5      -------------L-----------ISD--QDTDH-----VYEEAVDRIVTSIRSEMS--
V8C417          -------------L-----------ISD--QDTDH-----VYEEAVDRIVTSIRSEMS--
W6RXP9          -------------F-----------VVE--DDPKA-----VASESYRTLKTNIQYSSF--
W6S4G8          -------------L-----------VME--EEPRS-----LEAECYRTMVTNIQYSSI--
R5B467          --------------------------PA--ALPEEMARSSAYCEAMRIVAMRVDKAMQ--
A0A143WVN6      KSIHEYLHKPKKSV-----------LIS--SRLLSM----SFTESNRKLATLIERHMT--
A0A3B8KKL6      KNRRELEKEHLKNL-----------ITI--NDPKA-----AATEAFRELRTNLHYINI--
A0A2K9E6R0      KNRRELEKEYLKNL-----------ITK--NDPKA-----AATEAFRELRTNLHYINI--
A0A2S8RBI0      KNRRELEKEYLKNL-----------ITK--NDPKA-----AATEAFRELRTNLHYINI--
A0A0L6JLG6      KDEKQLEEEYLKNL-----------ITA--NDPKA-----AASEAYRELRTNLQYKSV--
G8LSN0          KDSKENERDYLKNL-----------ITK--NDPKA-----PASEAFREIRTNLHYKSV--
A0A1Q6REE0      -------------L-----------LHR--YRSES-----GFSESVRLLRLRVEKAMQ--
R5ETF9          -------------L-----------LHR--YRSES-----GFSESVRLLRLRVEKAMQ--
A0A0X9GDD0      -------------S-----------LTR--TGEEAMDLDPRAGEAIRALRTNLKFVSV--
U2A8X2          -------------L-----------IVQ--ESPQA-----VRAEAFRRLRTNLQFLEL--
U2AC50          -------------A-----------VVA--AGPGS-----RPSESVRTLVANVRFADV--
A0A1I4C3N6      --VKKS-------P-----------ILG--ENSSF-----EMREAYNEIRTFLTFSKR--
A0A3B9CIM7      --EKVN-------K-----------ILH--KESPF-----AVRESYNSIRAKLLFTGK--
A0A1G9WHW8      NSSYNP-------K-----------VLN--EDSTF-----TITEAYNSIRTKLLYTAK--
A0A1H5VAA0      NSSYNP-------K-----------VLN--EDSTF-----TITEAYNSIRTKLLYTAK--
A0A3R6VK11      --SKPV-------L-----------VLG--ENSSF-----AVKESYNTIRANLLFTGK--
A0A3R6QUY7      --SKPV-------L-----------VLG--ENSSF-----AVKESYNTIRANLLFTGK--
A0A373K3P9      --SKPV-------L-----------VLG--ENSSF-----AVKESYNTIRANLLFTGK--
A0A3R6JRU5      --SKPV-------L-----------VLG--ENSSF-----AVKESYNTIRANLLFTGK--
A0A1C5MS04      --SKPV-------L-----------VLG--ENSSF-----AVKESYNTIRANLLFTGK--
A0A3C1J150      --SKPV-------L-----------VLG--ENSSF-----AVKESYNTIRANLLFTGK--
A0A416CXD7      --SKPV-------L-----------VLG--ENSSF-----AVKESYNTIRANLLFTGK--
R6XBL9          --SKPV-------L-----------VLG--ENSSF-----AVKESYNTIRANLLFTGK--
A0A355W5Z7      --SKPV-------L-----------VLG--ENSSF-----AVKESYNTIRANLLFTGK--
A0A143ZUX1      --------RKGNSSL----------LISPR--SDF-----SYVEAYKSLRVRVESLAA--
A0A143XPI5      --------DKNMEVS----------LLNQK--LSP-----SFMEGIRTLRIRVDAALQ--
A0A355G1X5      K-------NQHPVLM----------ITDRS--LGF-----SFIESYKAIRTRVETLCT--
A0A0M6WXE3      K-------HRKKAVL----------VDNPL--ASF-----RFVESFKMLAARVEYHMS--
A0A348SAK2      K-------HRKKAVL----------VDNPL--ASF-----RFVESFKMLAARVEYHMS--
A0A1W1Z4C3      --------EKDAGVF----------LLNDK--TDM-----DMVESYAKLRMNLLYTMS--
A0A239QN83      --------EKDAGAY----------LLNEK--SDM-----DLVEGYAKLRMNLLYTLS--
A0A1G9H5B9      --------KDPEAFL----------LTNRS---PL-----EVSENYAKLRMNLFYTLV--
A0A1G6BLF1      --------KNVELVL----------MDNFR--VPP-----GFVEAMRSVRRRIENHSL--
A0A1Y4H8L0      Q-------KQKKALL----------VSQPL--AGF-----GFVESYRKFVSKLEYQME--
R6HZX3          S-----------GVS----------ILNPH--LGD-----TLSVPIGALQVRLLRSQPA-
A0A1W2CEA6      PRNPAFADGKHQAVF----------RGNLK--LDY-----AGEEAINAVCSSMSFT----
R7FFK6          A-------DRKRKLI----------YHNSD--LPF-----SILETYKALRSSLNFLVS--
A0A373MPB9      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A373L519      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A373W906      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A373VCW2      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
W0U604          A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A374B6G0      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A373VM36      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A1C5P379      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A373XXX0      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A356CW82      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
R6T4X7          A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A374HTV1      A-------DRKKQLL----------FNNKD--IPF-----NVVENYKTMRTNLMFTLS--
A0A374GB66      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A374ECC6      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A374BM61      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A373UGZ4      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A373SA66      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A1C5X6X7      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A1C6JIH3      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A373PSC3      A-------DRKKQLL----------FNNKD--IPF-----NIVENYKTMRTNLMFTLS--
A0A1K1WYK8      H-------RTEPRGL----------LTDKD--VPF-----NIVESYKTIRANILFTAA--
A0A1H6IUB1      E-------DEHVK------------LTDKS--VPF-----NVVESYKSIRTNISFALS--
A0A1M7L1F9      E-------DAHVK------------LTDKN--VPF-----TVVESYKSIRTNVSFALS--
A0A1C6B4L6      --------DNYSK------------LTDKD--IPF-----YIVERYKSIRTNVNFSLA--
A0A1Q6T9P4      --------DNYSK------------LTDKD--IPF-----YIVERYKSIRTNVNFSLA--
A0A315Y4F9      --------DVHLK------------LTDKD--APF-----YIIESYKSIRTNLSFALS--
A0A354K620      --------DDYVK------------LTDKE--TPF-----HIIESYKSIRTNLSFALS--
A0A355G3J9      D-------NAVEQQV----------ILSED--TPF-----SVKEAYHKARSNILYLPSDE
A0A3D2AD87      HLTDSNNADDSKESV----------LEKKQ--IPF-----VIVESYKNIRTGVAYLLS--
A0A2T5IYJ6      K-------KDTSAIY----------FLDSK---QN-----GYAEAMRTVRTSVVLSGI--
A0A252F281      K-------KEKHSFL----------ITHTV--ISF-----AFEESIRQIRTRLEYAAK--
A0A348SAK1      E-------SFYNSVN----------VLNKR--IPQ-----GYLEAFRKVGIKVMKQME--
A0A0M6WYQ8      E-------SFYNSVN----------VLNKR--IPQ-----GYLEAFRKVGIKVMKQME--
A0A173TM61      E-------SFYNSVN----------VLNKR--IPQ-----GYLEAFRKVGIKVMKQME--
A0A1Y4QKE6      I-------HKQTRIS----------INDRR--IPF-----AFKENMRSLQMRLERVFK--
B1C231          I-------HKQTRIS----------INDRR--ISF-----AFKENMRSLQIRLERVFK--
A0A1Y3TUL5      F-------RRKKSLL----------VEDDD-PIGA-----EVRESFVSAAHILHNRLG--
A0A1Y4JAX2      F-------RRKKSLL----------VEDDD-PMGA-----EVRESFVSAAHILHNRLG--
A0A1Y4T590      F-------RRKKSLL----------VEDDD-PMGA-----EVRESFVSAAHILHNRLG--
A0A3C0QME1      --------------T----------ILDEK--MDF-----NIVENYKSIRSNIMFAFS--
A0A355FYK5      ----------FTGGL----------LITDEDKVSF-----AFIECVKAIRTKLENLSA--
A0A357AQU0      K-------NNFSFET----------ILNKE--IPF-----SVVESFKSIRTNIMFAVA--
A0A3C1YJQ7      K-------NNFSFET----------ILNKD--IPF-----SVVESFKSIRTNIMFAVA--
A0A3D0JG38      K-------NNFSFET----------ILNKE--IPF-----SVVESFKSIRTNIMFAVA--
A0A3C0IHX1      P-------SALRNML----------LCAKD--IPF-----PCSEAYRSIRTNLMFALA--
R5V506          P-------SALRNML----------LCAKD--IPF-----PCSEAYRSIRTNLMFALA--
A0A352TIU5      P-------SALRNML----------LCAKD--IPF-----PCSEAYRSIRTNLMFALA--
A0A3E5FSY5      I-------HKQTRIS----------INDRR--ISF-----AFKENMRSLQIRLERVFK--
A0A1Y3T163      K-------QKKKKIS----------VLDKR--LSF-----GYRESLRALEIRLENMMA--
A0A1Y3YCA2      K-------QKKKKIS----------VLDKR--LSF-----GYRESLRALEIRLENMMA--
A0A1Y4L6N9      K-------RIESRIT----------VFDSR--VGA-----GFRENIKGLQMRVKREME--
A0A173T644      K-------KRRRDIS----------ILNKE--FSQ-----RFKESLLSIELKAERELQ--
A0A1C5TSB8      K-------KRRRDIS----------ILNKE--FSQ-----RFKESLLSIELKAERELQ--
C0CIK6          K-------KRRRDIS----------ILNKE--FSQ-----RFKESLLSIELKAERELQ--
A0A1Y3WEF6      K-------QDTRWIQ----------MQDSR--TPQ-----AFRENIQSLQIRISRELE--
A0A417T0L2      K-------QTTRWIQ----------MQDSR--TPQ-----AFRENIQSLQIRISRELE--
A0A1H9EPU3      K-------LRQNGQV----------IPT-N--KDI-----RISKNISEAYKKLRSNIQFS
A0A354IGV3      H-------KVNRSVL----------LTNPV--ASF-----PFTETISKMCTRLEYAAT--
A0A417JMV2      H-------RKKSPVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
A0A415VWX5      H-------RKKSPVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
A0A173UY96      H-------RKKSPVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
A0A173QTL1      H-------RKKSPVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
B0P408          H-------RKKSPVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
D4MV82          H-------RKKSPVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
A0A174A3T7      H-------RKKSPVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
A0A1Q6K0H6      H-------RKKSPVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
A0A174J359      H-------RKKSPVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
A0A417UUA3      H-------RKKSPVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
A0A1C6EUV9      H-------RKKSSVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
A0A173Y645      H-------RKKSSVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
A0A374AVY6      H-------RKKSSVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
R7BXS4          H-------RKKSSVL----------LTNPG--TSF-----QYVEDMKKLARKVSSKMK--
A0A1V5S3C0      -------------LL----------IIDKT--VGL-----PFIETFKLIRTKIENASF--
A0A1Y3TC98      T-------R----LS----------LLNEK--LPF-----GYRESIRSLQKRVVKNLE--
R6VAT5          S-------HSTGSLT----------IDDAH--TDP-----RFKESVFSIRNKIIKLCA--
A0A1Q6S448      K-------RLRRNLN----------ISSPA--ISF-----AFTESIHRIAEKFQHEHA--
A0A351MYR0      K-------RLRRNLN----------ISSPA--ISF-----AFTESIHRIAEKFQHEHA--
R6HPC1          K-------RLRRNLN----------ISSPA--ISF-----AFTESIHRIAEKFQHEHA--
A0A3D4G5Z5      R-------RLRRNLN----------ISSPA--ISF-----AFTESIHRIAEKFQHEHA--
A0A3D5ES03      K-------RLRRNLN----------ISSPA--ISF-----AFTESIHRIAEKFQHEHA--
A0A0F2P7X6      G-------QGQGAPL----------VTSDQ--VGF-----GFVESYKAAGTNLRFASA--
A0A359B487      G-------QGQGAPL----------VNSDQ--VGF-----GFVESYKAAGTNLRFASA--
A0A348P5V4      G------------IL----------ITDKK--SGF-----GFIESYKLIRTKIEHAAS--
A0A356PT74      P------------LL----------ISDRR--SGF-----PFIETFKIIRTKIEHTAQ--
A0A3D5LL19      P------------LL----------ISDRR--SGF-----PFIETFKIIRTKIEHTAQ--
R5MNF0          P------------LL----------ISDSR--SGF-----PFIETFKIIRTKIEHTAQ--
A0A1Q9JSI0      K-------KNP--VL----------LTNPG--TSF-----RYVENMKKLARRVSSQMQ--
A0A3D5TNI1      G-------DRE--LL----------ITDKA--CGF-----AFIETYKAMRTKLELLNG--
A0A358LJD0      G-------GRE--LL----------ITDKA--CGF-----AFVETYKAMRTKLELLNG--
R6I3L7          G-------DRE--LL----------ITDKA--CGF-----AFVETYKAMRTKLELLNG--
A0A3D1HXX0      G-------DRE--LL----------ITDKA--CGF-----AFVETYKAMRTKLELLNG--
A0A3D2QJB8      G-------DRE--LL----------ITDKA--CGF-----AFVETYKAMRTKLELLNG--
D4LC36          A-------DRKTRLL----------FGNEN--IPF-----STVEAYKSFRTALSFVIS--
R7MQJ4          Y-------D----LL----------LTQKG--IPF-----TIKESYKSMRTNVMFSLS--
A0A1V5GLC0      D-------H----FK----------LTDGN--IPF-----YITESYKSLRTNITFALA--
W7V182          N-------H----VK----------LTDKN--VPF-----AVVESYKSIRTNITFALS--
                                                                            

S3FFL2          HGV-PRTFAVTSTRPGEGKSTTALALATMLSRA-QRRVILIDGDMRSP---SVHHLGG--
A0A0T8KPS6      EAK-NNVLMITGPSPAVGKSFVTTNLAAVVAQS-GKRVLLIDADMRKG---YLHKVMR--
A0A0T8LA03      EAR-NKVLMITSPTPSVGKSFVSSNLAAVIAQT-GQRVLLIDADMRRG---YLHTLFG--
A0A328M4V1      EAK-NNLLLISSSSPGVGKSFVASNLAAVIAQA-GQRVLLIDADMRKG---TLHKIVG--
A0A1G6BLB6      HRN-SKVLMVTSVLENEGKSTVAVNLALELVEE-EQKVLLIDGDFRKP---ALYKVLQ--
B5CSZ7          AEG-YKTLMVGSIKENDGKSTVTANIALNLARR-GKKVVLVDCDMRHP---SLAKIFD--
A0A1C6G8M0      D---VKMIAVTSAFENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQRRMG--
A0A416MP73      D---VKTIVVTSAFENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQRRMG--
A0A396G6S7      KED-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFN--
A0A3E5A223      KED-AKVLLVTSVMENEGKSTVAANLALSLAQE-GSRVMLIDCDFRKP---AQYKIFN--
R7D5E6          KED-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFN--
A0A415HQH5      KED-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFN--
A0A414W2C6      KED-AKVLLVTSVMENEGKSTVAANLALSLAQE-GSRVMLIDCDFRKP---AQYKIFN--
A5ZNE7          KED-AKVLLVTSVMENEGKSTVAANLALSLAQE-GSRVMLIDCDFRKP---AQYKIFN--
A0A395X821      KED-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFN--
A0A1C5PY68      KED-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFN--
A0A174CJF8      KED-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFN--
A0A174R7V0      KED-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFN--
A0A173ZYY6      KNE-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFG--
A0A3D0F0Y4      KNE-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFG--
A0A174ASH7      KNE-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFG--
A0A173SMI2      KNE-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFG--
A0A174GP12      KNE-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFG--
A6BH65          KNE-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFG--
R7G0D7          KNE-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFG--
A0A373MWV2      RRG-GKVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFE--
A0A417CE88      RRG-GKVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFE--
A0A416Y441      RRG-GKVLLVTSVAENEGKSTLAANLALAISEE-QNRVLLLDCDFRQP---ALYKIFE--
A0A357GPJ7      RRG-GKVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFE--
A0A396PAC1      RRG-GKVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFE--
A0A416EYU4      RRG-GKVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFE--
A0A416SCQ2      RRG-GKVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFE--
A0A416TGN7      RRG-GKVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFE--
A0A417SMF6      RRG-GKVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFE--
A0A1Y4MW77      DIN-GKTLIFTSTVAKEGKSTIATNVAYALAKN-NKKVLLIDADLRKQ---DLSKQMN--
R6UHV6          THH-NKVYAVTSSLENEGKTTVAVNLALSLAKM-DYKVLLIDGDLRKP---AVAKFLE--
A0A3R9Q621      KDG-CKIIMINSPMPEDGKSTTCANLGITMAQT-GARVLLVDCDLRKG---KLHRFFN--
A0A069RC75      DQN-IKTILFTSSIPGEGKTLVSANMATALCGI-GKKVMLFDCDFRKP---RLAKVFG--
A0A174F2W5      RRG-GKVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFE--
A0A174S8E9      RRG-GKVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFE--
A0A416ZL97      RKG-GKVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFE--
A0A174LSK1      RKG-GKVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFE--
A0A373GY92      RKG-GKVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFE--
A0A373NZQ6      RKG-GKVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFE--
A0A417I9B9      RKG-GKVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFE--
A0A417MP97      RKG-GKVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFE--
A0A417WQF8      RKG-GKVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFE--
A0A373RZ83      RKG-GKVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFE--
A0A416U6I1      RKG-GKVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFE--
R7JQZ9          RKG-GKVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFE--
A0A1M5UYN6      DKK-IRTIVVTSAGQGEGKTQVSGNLALTMANL-EKKTIIIDCDMRRP---NVHRKFR--
A0A176JBT8      SKQ-PVTILVTSTSAGDGKSLTCGNLAVTLAKD-NKKVVFVDSDMRKP---NGHSLFN--
A0A1I5HIC6      D---IKTICITSSLPDEGKTVVAFRLATALSES-GKKVLFIDADLRKS---VIVNRLK--
A0A1Y3TC51      RHR-QKMLLVSSIAENEGKSTVAANLALALAEK-HKKVLLVDGDLRRP---AQHKVFE--
A0A1Y3T1N0      RND-QKILLVTSISENEGKSTVAANIALALAEK-HQKVLLVDGDLRQP---AQYKVFE--
A0A1Y3Y8U8      RND-QKILLVTSISENEGKSTVAANIALALAEK-HQKVLLVDGDLRQP---AQYKVFE--
A6CLL4          KEK-TKVLLVTSSGASEGKSLTTGNLAISMAMD-GVKTVVIDMDLRKG---VGSQLFH--
A0A174DL89      NYN-LKKILITSSSPSEGKSTIISNLGISMALT-NKKVIIIDCDMRKP---KIHRIFS--
A0A176U8D6      D---VKTIAVTSAFENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQRRMG--
A0A1Q6KSQ5      D---VKMIAVTSAFENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQRRMG--
A0A3D3U8B3      D---VKMIAVTSAFENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQRRMG--
A0A3E5FRL7      RYN-YQVLLVTGISENEGKSTVAANICLSFVEK-NKKVLLIDGDFRKP---AQYKIFD--
A0A1Y4QK93      KHN-FKVLLVTGIGENDGKSTVAANICLLFVEK-NKKVLLIDGDFRKP---AQYKIFD--
B1C232          KHN-FKVLLVTGTGENEGKSTVAANICLSFVEK-NKKVLLIDGDFRKP---AQYKIFD--
A0A401USI6      NRG-IKTLMVCSPGPKDGKTSVSTNIASTIAQT-GKSILLIDCDLRKP---CIHRHFN--
A0A1V4IQ10      EKN-IKTILITSSKLQEGKSTVAGNLALSFAEN-DNKVIIVDCDLRKP---SLHQKFN--
A0A1S8TRD2      EKT-IKTILVTSSKLQEGKSTVAGNLALSFAEN-DKKVIIVDCDLRKP---SLHEKFN--
G7M1U2          EKT-IKTILVTSSKLQEGKSTVAGNLALSFAEN-DKKVIIVDCDLRKP---SLHEKFN--
A0A2T6KJ75      KNN-AKTLLVTSAESGDGKSFVSANLSIVFAMD-QKKTVFIDADLRRG---TGRNLFH--
A9KN92          D---IKTICITSSLPNEGKTVVSFRLATAFADS-GKKVLFIDADLRKS---VIISKLK--
A0A352MUJ1      SDGDLKSVLITSSLPGEGKSWVATNLAITFARG-GYRTILVDADMRKG---VQHKKFR--
R5YI67          SEG-LKSVLITSALPGAGKSWVATNLAITFARG-GYRTILVDADMRKG---IQHKKFR--
A0A1Y0IQP5      GQH-VKVLMVTSTAAGEGKTTVIANLAVTMAQA-GKKVLLIDGDLRKP---TLHHVFH--
A0A1M6E8I2      DNN-MKTILITSATPGEGKTQTVMNLAVAMAQN-DKKVIVVDCDMRKP---RIHKILN--
A0A1Y4N105      RRN-QQVLLVTSVAENEGKSSTAGNIALSMVDR-GKKVVIIDCDFRKP---ALYKVFE--
A0A1Y4QP75      RRN-QQVLLVTSVAENEGKSSIAGNIALSMVDR-GKKVVIIDCDFRKP---ALYKVFE--
A0A3D4QRB5      DNN-LKVLMVTSTSKDEGKSSTAANLAVSIAQS-NKKVLLIDCDLRSS---IVHRIFH--
A0A2X2LGT4      SSR-VKVLLVTSGMPSEGKSTVSVNLAMTLAGL-RNSVLLIDADMRRP---RAHEHAG--
A0A349DEH5      RTG-NKVFLITSACENEGKTTSCVNIALSLAQN-GKKVLIIDADLRKP---SVSKLLS--
A0A3D4T7B4      RTG-NKVFLITSACENEGKTTSCVNIALSLAQN-GKKVLIIDADLRKP---SVSKLLS--
A0A350XYC7      RTG-NKVFLVTSACENEGKTTVCVNVALSLAQN-GKNVLIIDADLRKP---SVGKMLS--
R6DNR8          KTG-NKVYLVTSACENEGKTTSCVNIALSLAQN-GKNVLIIDADLRKP---SVSKMLS--
A0A355KUM5      RTG-NKVFLVTSACENEGKTTSCVNIALSIAQN-GKNVLIIDADLRKP---SVSKMLS--
R5YGY6          RTG-NKVFLVTSACENEGKTTSCVNIALSIAQN-GKNVLIIDADLRKP---SVSKMLS--
A0A0K8J554      KQG-CKKILINSPNPEEGKSTTCLNIGIALANA-GAKVLLIDCDLRKG---RLHKPLN--
A0A2S4GG02      GEK-CPVYAVTSADVNEGKTLNAFNVAKSYSNL-GKKVLLIDADMRKS---VMGQILK--
A0A3N1XSX6      KDQ-CKKIIVSSPVPEEGKSTTSINLGITISQT-GSKVLLIDCDLRKG---KIHNYFN--
A0A1C6G0U3      DKT-IKVIMVTSSQPGEGKSTFISNISKVFATLDDKKILLIDCDFRRP---KIHKIFK--
A0A3D4LLB3      DNV-IKTIMITSAKQDEGKTTTICNLAMVMTEL-KKNILLIDLDLRKP---TVHKQFK--
A0A0A5GPA9      QKS-AKTVLFTSTHSSEGKSITAANIAYSMAMD-HVNTVFVDLDLRKG---VGNHLFN--
A0A271M6M4      QED-AQTILITSSHPGEGKSLTAANLAICLAMD-HMETIFVDLDLRKG---VGRQLFH--
A0A1V5LU59      DKE-LKTIVVTSPTLGDGKTVTAVNMAVTIAKS-GKKVLIIDTDLRKP---KVHLYFG--
A0A1E3BVC3      DRE-IKTIVVTSPTLGDGKTVTAVNLAVTLARS-GKKVLVIDADLRKP---KVHHYFG--
A3DF66          DSE-VKTIVVTSPTLGDGKTVTAVNLAITLARS-GKKVLVIDADLRKP---KVHHYFG--
W4V1T8          DRE-VKTIVVTSPTLGDGKTVTAVNLATTLARS-GKKVLVIDADLRKP---KVHHYFG--
A0A2V3W8U6      DKS-LKTILVTSTSKNEGKTITCSNLAMMMAID-NKKTVVIDADLRKE---KMGM-----
W1UFG0          DNE-MKVILFTSTHKDEGKSILSLNTAYKFSELEETKVLLIDCDLRNP---TINKILN--
A0A351SRI8      DRK-IKTILVTSSVPGEGKSFVASNLAVALANS-GQRVLLVDCDIRKG---RQHRIFG--
A0A1I0RG99      FNG-CKKIIISSPVPQDGKSTTITNVGISIAQT-GAKVLLMDCDLRKG---RLHRLFN--
A0A1I5G322      HQG-CKKIVISSSLPEDGKSTITTNLGIVIGQT-GSKVLLVDCDLRKG---RLHNFFN--
A0A1C6ITD7      NSN-LKKILITSSSPSEGKSTIISNLGISIALT-NKKVVIIDCDMRKP---RIHRLFS--
A0A381IX63      DEN-LNVIAITSSKPSEGKSTMISNIGAAFGNLENKKVLIIDCDLRNP---SIHRMFG--
A0A1G9IUT4      DKN-IKSIVITSSQKNEGKTTIVSSLGSSFAQL-DKKILIIDCDFRNP---SIHKVFD--
A0A1M6RWV2      DNK-LKTILVTSSGPAEGKSTTISNLAVTMVNM-GHKVLLIDADFRKP---QIHKIFN--
A0A3R9WAA7      NRD-IKTLLITSAIPAEGKSTFAFNLATAMAEL-DRKVILVDCDFRRP---SIMKMLP--
R5EFZ0          -DG-GKVLIVTSLLENEGKSTVTVNLALAMEQK-GKRVLLIDCDLRKP---ACGMVLG--
A0A0H5SF45      KNG-CKKILVNSPNPRDGKSTTCTNIAIALAKT-GARVLLIDCDLRKG---RLHVPFN--
A0A1M6JRJ5      KEE-CKKILITSPSPEDGKSTTSINLSIAISQA-GYKVLLIDCDLRKG---RLHHYFK--
A0A1M7Y1S2      KEG-CKKILITSPSPEDGKSTISINLSIAIAHA-GYKVLLIDCDLRKG---RIHHHFK--
A0A143XN92      AKR-IKTVMITSMMENEGKSTVAANLALEFAKM-GKNVLLIDLDLRKP---AQHDIFG--
A0A3D5R4X5      DKE-IKSIVVTSTIAGEGKSLTTSNLATAIAQT-GNKVLLVDTDFRKP---SIHKIAR--
A0A3E4LL92      AEG-YKTLMVGSIKENDGKSTVTANMVLDLARR-GKKVVLVDCDMRHP---SLAKIFD--
A0A415D1L1      AEG-YKTLMVGSVKENDGKSTVTANIALNLARR-GKKVVLVDCDMRHP---SLAKIFD--
A0A414P2K5      AEG-YKTLMVGSIKENDGKSTVTANIALNLARR-GKKVVLVDCDMRHP---SLAKIFD--
V8C417          AEG-YKTLMVGSIKENDGKSTVTANIALNLARR-GKKVVLVDCDMRHP---SLAKIFD--
W6RXP9          DEK-HRVMVVTSSTPGEGKSTTTGNLALALAEG-EAKVILIDCDMRKP---TVHKKFH--
W6S4G8          DSR-CKTIVVTSSQKGEGKTTISGNLALSLAGW-GNRVVLIDCDIRRA---ALHKAFN--
R5B467          HHA-YRTLLVSSAAPGEGKTTFVCQLALALVRQ-GRHVLVIDCDLRNP---SVHKTLG--
A0A143WVN6      RHQ-QKVLLVCSVAENEGKSSVASNIALALADR-HKKVLLVDGDLRKP---ALHRIFD--
A0A3B8KKL6      DKE-VKTMVVTSPSMGDGKSVTAANLAVILAKS-GKRVLIVDADLRKP---KVHHYFG--
A0A2K9E6R0      DKE-VKTMVVTSPSMGDGKSVTAANLAVILAKS-GKRVLIVDADLRKP---KVHHYFG--
A0A2S8RBI0      DKE-VKTMVVTSPSMGDGKSVTAANLAVTLAKS-GKRVLIVDADLRKP---KVHHYFG--
A0A0L6JLG6      DKD-MKVILLTSPSLGDGKTVTTVNLAITLAQS-GKKVLVIDADLRKP---KVHHYFG--
G8LSN0          DKE-LKTIVITSPALGDGKTVTSVNMAVTLAKS-GKKVLLIDSDLRKP---KVHLYFG--
A0A1Q6REE0      ENG-QKILLVSSAIPGEGKTTVSVNLAVSLAQK-GRRVLLIDCDFRNP---SVAKTLSSK
R5ETF9          ENG-QKILLVSSAIPGEGKTTVSVNLAVSLAQK-GRRVLLIDCDFRNP---SVAKTLSSK
A0A0X9GDD0      DEP-PRVVSFTSADPSEGKSTVASNLARALALA-GERVLVVDADLRRP---RQHDLFQ--
U2A8X2          GPA-ARTYVMTSALPGEGKTTTSVNLAITLADA-GQRVVLVDADLRRP---AVARYLG--
U2AC50          DHG-RRVLMVSSGDAGEGKSSIAISLALSLAED-GSSVLLVDADLRRP---SIARVTG--
A0A1I4C3N6      DEK-CPVYGILSADKGEGKTVSALNIASSLANT-GKKILFIDADLRES---RTAEVLG--
A0A3B9CIM7      GEK-CPVYAITSADPGEGKTLTCINLASAYAQL-GKKILLIDADMRKS---NLKSLLD--
A0A1G9WHW8      DQK-CPIYGITSADSGEGKSLNSMNLAISYSFL-GKKVLLIDGDLRKS---GISRVLK--
A0A1H5VAA0      DQK-CPIYGITSADSGEGKSLNSMNLAISYSFL-GKKVLLIDGDLRKS---GISRVLK--
A0A3R6VK11      GER-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--
A0A3R6QUY7      GER-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--
A0A373K3P9      GER-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--
A0A3R6JRU5      GER-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--
A0A1C5MS04      GER-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---AVASLLK--
A0A3C1J150      GEH-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--
A0A416CXD7      GEH-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--
R6XBL9          GER-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--
A0A355W5Z7      GER-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--
A0A143ZUX1      ERG-YKKFIVTSTLADEGKSTVAANLAIALAQK-GKKVLLIDVDLRRP---TQHNLFQ--
A0A143XPI5      EVS-AKTILVNSAIQGEGKTTIAVNLALVRALR-GEKVLLIDADLRNP---SVSQVLH--
A0A355G1X5      RKD-YKTILVTSAGANEGKTTFSLNLALSLSQN-GKSVLLIDADMRKP---TLYRFLN--
A0A0M6WXE3      KIN-GKVLVVTSVCENEGKSSVAGNLAITLAKK-GKRIILIDGDIRCP---AQYLLLG--
A0A348SAK2      KIN-GKVLVVTSVCENEGKSSVAGNLAITLAKK-GKRIILIDGDIRCP---AQYLLLG--
A0A1W1Z4C3      EKM-RRTVLVTSAISGEGKSTIAANLAVSLALS-GKKVLLVDGDMRRA---CQSEMFY--
A0A239QN83      EKM-HRTVLVTSAISGEGKSTIAANLAVSLAMS-GKKILLVDADMRRA---CQSEIFY--
A0A1G9H5B9      DKE-QKIVVITSSVSGEGKSTISANLAISCAMS-GNKVILVDSDMRRS---SQSEIFK--
A0A1G6BLF1      DTK-KNIYLVTSALPEEGKSTVAANIALSLALK-GEKVVIVDMDLRNP---SLADSFA--
A0A1Y4H8L0      KHH-SKVLVVSSVSENEGKSTVAANIAISLVQR-GKKVLLIDGDLRRP---SQFLILG--
R6HZX3          GGT-GRIILITSTMPGEGKTTVSFNLAASLAQS-GKRVILVDADLRHQ---VVKARFG--
A0A1W2CEA6      GKN-LKRVLVSSCGANEGKTFATIQIAIGMTRR-GARVLLIDADLRLS---VMKEKYD--
R7FFK6          TSE-NKIVAVTSASPNEGKSVTVANLATAISET-DKTVLLIDADMRKP---VQHKNFQ--
A0A373MPB9      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRKP---VQHRNFK--
A0A373L519      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENRVLLIDADMRKP---VQHRNFK--
A0A373W906      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A373VCW2      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
W0U604          TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A374B6G0      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRKP---VQHRNFK--
A0A373VM36      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A1C5P379      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A373XXX0      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A356CW82      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
R6T4X7          TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A374HTV1      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A374GB66      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A374ECC6      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A374BM61      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A373UGZ4      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A373SA66      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A1C5X6X7      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A1C6JIH3      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A373PSC3      TTR-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFK--
A0A1K1WYK8      DSD-KKVIAVSSPNPGEGKSTSAANLAIALAQT-GSAVLLIDADMRKP---VQHRTFK--
A0A1H6IUB1      TVD-KKIFAVSSANPREGKSTTSSNIAIALAQG-GNKILLIDADMRKA---VQHKVFG--
A0A1M7L1F9      TVD-KKIFAVSSSNPREGKSTTSANIAIALAQG-GNKILLIDADMRKA---VQHKIFG--
A0A1C6B4L6      TSD-KKIFAVSSANPSEGKSIISANIAIALAQG-GNKALLIDADMRKA---VQHKIFE--
A0A1Q6T9P4      TSD-KKIFAVSSANPSEGKSIISANIAIALAQG-GNKALLIDADMRKA---VQHKIFE--
A0A315Y4F9      TVE-KKTFVVSSANPGEGKSTTSANIAIAIAQS-GSHVLLIDADMRKS---VQHKIFE--
A0A354K620      TFD-KKVFAVSSANPGEGKSTTSANIAVAIAQS-GSHVLLIDADMRRS---VQHKIFE--
A0A355G3J9      ENG-CKTLVITSALVSEGKSTFSVNLAITLAKS-GNKVLLIDGDLRKP-----KVSLY--
A0A3D2AD87      REE-KSSFTITSANAGEGKSTTAANLAVAFSQL-GKTVLLVDADLRRA---SLHKKFK--
A0A2T5IYJ6      DKP-HKVVMLTSSVPSEGKSTSAINLAVALAQM--ERVLLIDGDMRKP---TIAKVLG--
A0A252F281      QDG-AKVFLISSFGENEGKSTISANSALSLAEK-GYHVLLIDADFRKP---AQYKVLN--
A0A348SAK1      EEE-FKTLLVTSSVPEEGKTAFSVNLAIIEAKL-GKNVILVDCDMRRP---SVSKAMN--
A0A0M6WYQ8      EEE-FKTLLVTSSVPEEGKTAFSVNLAIIEAKL-GKNVILVDCDMRRP---SVAKAMN--
A0A173TM61      EEE-FKTLLVTSSVPEEGKTAFSVNLAIIEAKL-GKNVILVDCDMRRP---SVAKAMN--
A0A1Y4QKE6      KEE-HKVIVVTSTAANEGKTTLTINLAETFATN-GKRVLLIDADLRRQ---SIASI----
B1C231          KEE-HKVIVVTSTAANEGKTTLTINLAETFAAN-GKRVLLIDADLRRQ---SIAKI----
A0A1Y3TUL5      VGE-HQCIYITSAEQDEGKTHVAANLAVQLSDL-EHKVLLIDLDVRNP---SLGGLFL--
A0A1Y4JAX2      VGE-HQCIYITSAEQDEGKTHVAANLAVQLSDL-EHKVLLIDLDVRNP---SLGGLFL--
A0A1Y4T590      VGE-HQCIYITSAEQDEGKTHVAANLAVQLSDL-EHKVLLIDLDVRNP---SLGGLFL--
A0A3C0QME1      TMP-RKILAVSSANPGEGKSTTASNIAIAFAQM-ESKVLLIDADMRKP---VQHKVFE--
A0A355FYK5      NKG-FKTFMVTSTYENEGKTTVAINIATSLAQK-GKSVLLIDADLRKP---AVLRTIG--
A0A357AQU0      TQG-KKVIAVTSANPSEGKSSTTTNIAIAMAMA-NEKVLLIDGDLRKP---VQHKIYN--
A0A3C1YJQ7      TQG-KKVIAVTSANPSEGKSSTTTNIAIAMAMA-NEKVLLIDGDLRKP---VQHKIYN--
A0A3D0JG38      TQG-KKVIAVTSANPSEGKSSTTTNIAIAMAMA-NEKVLLIDGDLRKP---VQHKIYN--
A0A3C0IHX1      PQE-HKIVAVTSPNAADGKSLTAANIAMAMAMM-NKKVLFIDADLRKP---VQHQRLK--
R5V506          PQE-HKIVAVTSPNAADGKSLTAANIAMAMAMM-NKKVLFIDADLRKP---VQHQRLK--
A0A352TIU5      PQE-HKIVAVTSPNAADGKSLTAANIAMAMAMM-NKKVLFIDADLRKP---VQHQRLK--
A0A3E5FSY5      KEE-HKVIVVTSTAANEGKTTLTINLAETFAAN-GKRVLLIDADLRRQ---SIAKI----
A0A1Y3T163      KEG-GKVLLISSTASGEGKSTLAVNLSELLASR-GKRVLLIDGDLRKQ---DDAGI----
A0A1Y3YCA2      KEG-GKVLLISSTASGEGKSTLAVNLSELLASR-GKRVLLIDGDLRKQ---DDAGI----
A0A1Y4L6N9      RID-GKVLLVTSTVAEEGKTTVAVNLAFSLAEY-GYKVLLLDGDMRKQ---TDWKY----
A0A173T644      DKN-GKILLVTSTISGEGKSTVALNMAYAAALH-EKKVLFIDADLRKQ---TDRRC----
A0A1C5TSB8      DKN-GKILLVTSTISGEGKSTVALNMAYAAALH-EKKVLFIDADLRKQ---TDRRC----
C0CIK6          DKN-GKILLVTSTISGEGKSTVALNMAYAAALH-EKKVLFIDADLRKQ---TDRRC----
A0A1Y3WEF6      EKG-GKVLVLTSTLPGEGKSTLAYNLAIAAASH-GVKVLFVDADLRKK---ADRKH----
A0A417T0L2      EKG-GKVLVLTSTMPGEGKSTLAYNLAIAAASH-GVKVLFIDADLRKQ---ADRKH----
A0A1H9EPU3      GRH-VRVIGITSTVPNEGKSVLSLNLAISLAEL-GKRVIFIDADLRKSVLVGRYKI----
A0A354IGV3      RHG-RKVILITSVGENEGKSTIAANLALGLAQR-HSKVLLIDGDLRKP---AVYKLLQ--
A0A417JMV2      EKN-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
A0A415VWX5      EKN-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
A0A173UY96      EKN-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
A0A173QTL1      EKN-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
B0P408          EKN-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
D4MV82          EKN-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
A0A174A3T7      EKN-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
A0A1Q6K0H6      EKN-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
A0A174J359      EKN-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
A0A417UUA3      EKN-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
A0A1C6EUV9      DKQ-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
A0A173Y645      DKQ-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
A0A374AVY6      DKQ-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
R7BXS4          DKQ-AKTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFG--
A0A1V5S3C0      KKG-YKVFAVTSSAENEGKTTVAVNTALSLAKS-GKSVLLIDCDIRKP---AVYKVLG--
A0A1Y3TC98      HMD-GKILMVTSSTAGEGKTTVAVNLAQMLAAD-GSRVLLIDGDLRKH---GSAGLLG--
R6VAT5          DQK-INSVMVASTTTNEGKTTVAANLAIALAKK-HYRTVIIDCDLRNP---TVRQQLN--
A0A1Q6S448      K-G-RRVFLFSSVSAAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQSEMLG--
A0A351MYR0      R-G-RRVFLFSSVSAAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQSEMLG--
R6HPC1          K-G-RRVFLFSSVSAAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQSEMLG--
A0A3D4G5Z5      K-G-RRVFLFSSVSAAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQSEMLG--
A0A3D5ES03      K-G-RRVFLFSSVSAAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQSEMLG--
A0A0F2P7X6      VTS-AKKLLVTSILTGEGKSTVAVNLAITIART-GKSVLLVDCDLRKS---NMHGVLE--
A0A359B487      VTN-AKKLLVTSILTGEGKSTVAVNLAITIAHT-GKSVLLVDCDLRKS---NMHGVLE--
A0A348P5V4      RQD-YKAIIVTSTMENEGKTTSATNIALSLAQN-GKSVLLIDADLRKP---SVAKTLG--
A0A356PT74      REK-YKTFVVTSTAENEGKTTSAVNIALALAQN-GKSVLLVDGDLRKP---AVAKLLG--
A0A3D5LL19      REK-YKTFVVTSTAENEGKTTSAVNIALALAQN-GKSVLLVDGDLRKP---AVAKLLG--
R5MNF0          REK-YKTFVVTSTAENEGKTTSAVNIALALAQN-GKSVLLVDGDLRKP---AVAKLLG--
A0A1Q9JSI0      DHN-AKTLMVTSAVENEGKSTVAANLALAMAEE-SAKVLLIDADLRKP---SQYKIFG--
A0A3D5TNI1      RRG-YKSFVISSAGANEGKTTVAVNLSLALAQN-GYSVLLIDADLRKP---SVLKNLG--
A0A358LJD0      RRG-YKSFVVSSAGANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVLKNLG--
R6I3L7          RRG-YKSFVVSSTGANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVLKNLG--
A0A3D1HXX0      RRG-YKSFVVSSAGANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVLKNLG--
A0A3D2QJB8      RRG-YKSFVVSSAGANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVLKNLG--
D4LC36          TCD-SRIVAMTSANPSEGKSVTVANLAVAVAQT-DKKVLLIDADMRKP---VQHKCFR--
R7MQJ4          VSE-KKVIVVSSANPGEGKSTTAANLAITFSQM-EHKVLLIDADMRKP---VQHKIFG--
A0A1V5GLC0      TSD-KKIFAISSANPSEGKSTVSANTAIALAQG-GNKVLLVDADMRKS---VQHKIFD--
W7V182          TSE-KKIFTVSSANPSEGKSTTSANIAIALAQG-GNKVLLIDGDLRKS---CQHKIFG--
                         . .     **:                  :..* *.*              

S3FFL2          ------VDHNRGLSNFL---AGE-----ND--IASLTFSMSE---LN------FTAMSAG
A0A0T8KPS6      ------CDGDKGLSDIL---SGR-----IT--LFDAIQKTQL---NN------LHVITHG
A0A0T8LA03      ------MAPRHGLSDAL---ASG-----LN--LAEITNRTEQ---KN------LHFISAG
A0A328M4V1      ------GNPERGLSELI---SGQ-----AE--LPEVLRNVDGI--SK------LFFISRG
A0A1G6BLB6      ---IDPKEVT-DLGEVL---NHK-----IS--PKNMIYQKEN---SN------LHLLLNT
B5CSZ7          ---ATVDPKE-QFSEYL---LGK-----CE--LDQVLKQTEV---QAHP----MDCIWQK
A0A1C6G8M0      -----LEGVKLGLSEYL---SGN-----AE--VGQVIYDVGI---PN------MHVLFSG
A0A416MP73      -----LDGVKLGLSEYL---SGN-----AE--LGQVIYDVGL---PN------MHVLFSG
A0A396G6S7      ---VRDNEEK-DLGDVL---INH-----AS--TEKIIRNWNN---SG------LYMILNK
A0A3E5A223      ---VRDNEET-DLGDVL---INH-----AS--TEKIIRNWNN---SG------LYMILNK
R7D5E6          ---VRDNEEK-DLGDVL---INH-----AS--TEKIIRNWNN---SG------LYMILNK
A0A415HQH5      ---VRDNEEK-DLGDVL---INH-----AS--TEKIIRNWNN---SG------LYMILNK
A0A414W2C6      ---VRDNEET-DLGDVL---INH-----AS--TEKIIRNWNN---SG------LYMILNK
A5ZNE7          ---VRDNEET-DLGDVL---INH-----AS--TEKIIRNWNN---SG------LYMILNK
A0A395X821      ---VRDNEEK-DLGDVL---INH-----AS--TEKIIRNWNN---SG------LYMILNK
A0A1C5PY68      ---VRDNEET-DLGDVL---INH-----AS--TEKIIRNWNN---SG------LYMILNK
A0A174CJF8      ---VRDNEET-DLGDVL---INH-----AS--TEKIIRNWNN---SG------LYMILNK
A0A174R7V0      ---VRDNEEK-DLGDVL---INH-----AS--TEKIIRNWNN---SG------LYMILNK
A0A173ZYY6      ---MEPKEEN-ELGEYL---RGN-----GS--LADVMVPCTR---KH------MLFMGGK
A0A3D0F0Y4      ---MEPKEEN-ELGEYL---KGN-----RA--LADVMVPCTR---KH------MLFMGGK
A0A174ASH7      ---MEPKEEN-ELGEYL---RGN-----GS--LADVMVPCTR---KH------MLFMGGK
A0A173SMI2      ---MEPKEEN-ELGEYL---RGN-----GS--LADVMVPCTR---KH------MLFMGGK
A0A174GP12      ---MEPKEEN-ELGEYL---RGN-----GS--LADVMVPCTR---KH------MLFMGGK
A6BH65          ---MEPKEEN-ELGEYL---RGN-----GS--LADVMVPCTR---KH------MLFMGGK
R7G0D7          ---MEPKEEN-ELGEYL---KGN-----RA--LADVMVPCTR---KH------MLFMGGK
A0A373MWV2      ---LPQKAGK-DFGQVA---AGK-----EP--ASSVFEKYKD---TN------VYMGICR
A0A417CE88      ---LPQKAGK-DFGQVA---VGK-----ES--ASSVFEKYKD---TN------VYMGICR
A0A416Y441      ---LPQKAGK-DFGQVA---VGK-----ES--ASSVFEKYKD---TN------VYMGICR
A0A357GPJ7      ---LPQKAGK-DFGQVA---VGK-----ES--ASSVFEKYKD---TN------VYMGICR
A0A396PAC1      ---LPQKAGK-DFGQVA---VGK-----ES--ASSVFEKYKD---TN------VYMGICR
A0A416EYU4      ---LPQKAGK-DFGQVA---VGK-----ES--ASSVFEKYKD---TN------VYMGICR
A0A416SCQ2      ---LPQKAGK-DFGQVA---VGK-----ES--ASSVFEKYKD---TN------VYMGICR
A0A416TGN7      ---LPQKAGK-DFGQVA---VGK-----ES--ASSVFEKYKD---TN------VYMGICR
A0A417SMF6      ---LPQKAGK-DFGQVA---VGK-----ES--ASSVFEKYKD---TN------VYMGICR
A0A1Y4MW77      -----LTTNGVGLSSIK---YGS-----DV--VEDAIVYLEK---QN------LYFLGGN
R6UHV6          ---AKITNGK-SIIDFL---RGK-----AR--LSEIASYDEI---NN------ITIMGSN
A0A3R9Q621      -----FKSMP-GLSDIL---SGL-----AS--ETEVIHSTAY---KN------LHVLPMG
A0A069RC75      -----LSNTV-GITDAL---MSK-----RD--YREFVKETHI---EN------LHIMTAG
A0A174F2W5      ---LPQKAGK-DFGQVA---AGK-----EP--ASSVFEKYKD---TN------VYMGICR
A0A174S8E9      ---LPQKAGK-DFGQVA---VGK-----ES--ASSVFEKYKD---TN------VYMGICR
A0A416ZL97      ---IPEKDGK-DFGKVV---LGK-----ES--ASGVFEKHKD---TN------VYTGICR
A0A174LSK1      ---IPEKDGK-DFGKVV---LGK-----ES--ASGVFEKHKD---TN------VYTGICR
A0A373GY92      ---IPEKDGK-DFGKVV---LGK-----ES--ASGVFEKHKD---TN------VYTGICR
A0A373NZQ6      ---IPEKDGK-DFGKVV---LGK-----ES--ASGVFEKHKD---TN------VYTGICR
A0A417I9B9      ---IPEKDGK-DFGKVV---LGK-----ES--ASGVFEKHKD---TN------VYTGICR
A0A417MP97      ---IPEKDGK-DFGKVV---LGK-----ES--ASGVFEKHKD---TN------VYTGICR
A0A417WQF8      ---IPEKDGK-DFGKVV---LGK-----ES--ASGVFEKHKD---TN------VYTGICR
A0A373RZ83      ---IPEKDGK-DFGKVV---LGK-----ES--ASGVFEKHKD---TN------VYTGICR
A0A416U6I1      ---IPEKDGK-DFGKVV---LGK-----ES--ASGVFEKHKD---TN------VYTGICR
R7JQZ9          ---IPEKDGK-DFGKVV---LGK-----ES--ASGVFEKHKD---TN------VYTGICR
A0A1M5UYN6      -----ISNEI-GLSDIL---SEQ-----AE--FEEVVHSYD----KH------LCVIPSG
A0A176JBT8      -----LHNRC-GLTNYL---TGF-----SS--SDEIIQSTAI---PK------LSFISAG
A0A1I5HIC6      -----ISNGANGLSQYL---SGM-----ST--LEEVIHKTNV---EN------VDIIFTG
A0A1Y3TC51      ---EKGKERF-SFSQVL---KGE-----AD--WKDAAFYNKR---SD------IWELFQF
A0A1Y3T1N0      ---EKSAGRT-SVEQVF---TGK-----AS--WKENLYYNKA---AG------IWELFQF
A0A1Y3Y8U8      ---EKSAGRT-SVEQVF---RGK-----AS--WKENLYYNKA---AG------IWELFQF
A6CLL4          -----LPSKK-GISNYL---HGI-----TP--LNEIIQRTDI---PK------LFFISAG
A0A174DL89      -----LSNII-GLSHIL---SNQ-----AE--LEECLQSSGI---NN------LSILTAG
A0A176U8D6      -----LDGVKLGLSEYL---SGN-----AE--LGQVIYDVGL---PN------MHVLFSG
A0A1Q6KSQ5      -----LEGVKLGLSEYL---SGN-----AE--VGQVIYDVGI---PN------MHVLFSG
A0A3D3U8B3      -----LEGVKLGLSEYL---SGN-----AE--VGQVIYDVGI---PN------MHVLFSG
A0A3E5FRL7      ---KEVLDTN-PLQDVI---TGK-----TT--LKESIYFNKK---SN------IYELFLY
A0A1Y4QK93      ---KEVLDTN-PLQDVI---TEK-----KS--LKDSIYFNKK---SN------IYELFLY
B1C232          ---KEVLDTN-PLQDVI---TGK-----AT--LKESIYFNKK---SN------IYELFLY
A0A401USI6      -----ITNNAKGLVDIV---LQE-----RK--IEEISIGID----DK------FDVLTAG
A0A1V4IQ10      -----IPNTS-GLSDVI---LKK-----ES--LDKVIQKHN----EN------LYLMSSG
A0A1S8TRD2      -----ISNTS-GLSDVI---LKR-----DS--LDNVIQKHN----KN------LYVISSG
G7M1U2          -----ISNTS-GLSDVI---LKR-----DS--LDNVIQKHN----KN------LYVISSG
A0A2T6KJ75      -----LPKRI-GITSYL---AGQ-----CT--LHEIIQSTEV---PN------LSFISAG
A9KN92          -----IDNAVNGLSQYI---SGM-----NS--LEEVIHKSNV---EN------RDIIFTG
A0A352MUJ1      -----LKQVP-GLSDFLNSRIED-----YENELPKYVQPTEL---DN------LCVLPCG
R5YI67          -----LNQVP-GLSDFLSSSSEN-----LEEELQKCIQPTEL---DN------LCVLTCG
A0A1Y0IQP5      -----LGGQK-GLTEVL---CEE-----TP--LEDVIVPSA----AG------PDVITAG
A0A1M6E8I2      -----ISNTS-GIAEYL---MDG-----RN--IDDYINRMYN---LD------IDVMTSG
A0A1Y4N105      -----LKELKNGLSDYL---DGN-----CK--YEDIITYQN-----N------LAIISQK
A0A1Y4QP75      -----LKELKNCLSDYL---DGN-----CK--YEDIITYQN-----N------LAIISQK
A0A3D4QRB5      -----LLNEK-GLTNIL---VGE-----AE--PSSIVNSGGI---SN------LHIISAG
A0A2X2LGT4      -----IDGSI-GLTSVL---LDE-----VE--FEVAKHSVAD---ST------LDILPAG
A0A349DEH5      -----LPDTDCGLSDVI---LGN-----AT--LNQAIKLVNN---FN------VCILADQ
A0A3D4T7B4      -----LPDTDCGLSDVI---LGN-----AT--LNQAIKLVNN---FN------VCILADQ
A0A350XYC7      -----LKENDRGLSDVI---LGK-----VE--LNKAIKSVNT---FN------VCVLADQ
R6DNR8          -----LQDTEEGLSDVI---LGK-----AD--LGKAIKSVNS---FN------VCVLADQ
A0A355KUM5      -----LPATEYGLSDVI---LGN-----VE--LNQAIKRVTS---FN------VCVLADQ
R5YGY6          -----LPTTEYGLSDVI---LGN-----VE--LNQAIKRVTS---FN------VCVLADQ
A0A0K8J554      -----VKSTP-GLSNVL---SVM-----KT--DEEVVQDTDY---EN------LQLIACG
A0A2S4GG02      -----VNTET-GLSQYL---AGI---------VERLEIVSVD---AN------MDLILAG
A0A3N1XSX6      -----LKYKP-GLSDVL---SGM-----AE--LTNVIRKTSY---EN------LNIITIG
A0A1C6G0U3      -----ISNTQ-GLTNIL---VKN-----IH--ISECI--NTV---SG------LNIITSG
A0A3D4LLB3      -----LSNKT-GLTDLL---MKK-----DD---YKAYLQNIY---PG------LDVLTTG
A0A0A5GPA9      -----NPVRK-GATNYL---EGY-----AS--IDEVVSRTDI---PH------LSYVAKG
A0A271M6M4      -----IPLRK-GVTTYL---EGM-----AT--IEEIIVKTNV---SN------LSFIGTG
A0A1V5LU59      -----IKNAE-GVTNML---SSD-----KGNNKVKPTKIEGI---SN------LDIIPSG
A0A1E3BVC3      -----VKNKE-GLTNIL---TDS-----KEDIKVKPTEKSDI---SN------LYIITSG
A3DF66          -----VKNKE-GLTNLL---TDS-----KEEVKIKTTERSDI---SN------LYIITSG
W4V1T8          -----VKNKE-GLTNLL---TES-----KEEIKIKTTEKSDI---SN------LYIITSG
A0A2V3W8U6      -----SNGQI-GLTHYL---AGN-----RS--VQDILLDTFT---PN------LQSITCG
W1UFG0          -----KPNQK-GVMDIL---LGK-----KD--IKNSIEKVN----DK------FDILFTG
A0A351SRI8      -----SPNKK-GLSNLL---LED-----VAQVYRTYINESDV---PN------LYLMFKG
A0A1I0RG99      -----IQLIP-GVSDAL---SST-----MD--VKKSIYKTSY---DN------LYVMPMG
A0A1I5G322      -----IKSSP-GVTNVL---SNM-----ID--IENAIQKTTY---DN------LYVLPLG
A0A1C6ITD7      -----LSNII-GLSHIL---SNQ-----AE--LEECLQSSGI---EN------LSILTAG
A0A381IX63      -----LSNAI-GLTDVL---IGN-----KT--FNQCVQNTEV---KN------LKVLTTG
A0A1G9IUT4      -----ISNKQ-GIADVL---LNK-----VN--LKDCVHEISS---EN------LNVLTCG
A0A1M6RWV2      -----LSNDV-GMTNIL---MGE------K--LEDVIHTVGG---LK------LDIITTG
A0A3R9WAA7      --YSAGTV---CLNDVL---KE-------KEKLTDAIRYYDE---YK------IAVLACS
R5EFZ0          ----QSKFTY-GLNDIL---GG-------KENLSECFLRYQN---SD------MYMLLAK
A0A0H5SF45      ---LNSTP---GVTNLL---SG-------MNTEKETIQYTSY---NN------LQIIPCG
A0A1M6JRJ5      ---AKSQP---GLSDLL---SH-------INSLKECLYITPY---EN------LHMMPMG
A0A1M7Y1S2      ---GKSQP---GLSDFL---SN-------INSLKECLYITPY---DN------LHIMPMG
A0A143XN92      ---RKGEQFV-GIAEWL---EN-------KIDLKEKIVRINN---SN------LFILFNS
A0A3D5R4X5      ---KPNAD---GLADVL---IN-------KSDYRSSVKQSRT---KN------LDLMFSG
A0A3E4LL92      ---AAVDPKE-QLSEYL---LGK-----CELDKVLKRTEVQA---HP------IYCLWQK
A0A415D1L1      ---ATVDPKE-QFSEYL---LGK-----CELDQVLKQTEVQA---HP------MGCIWQK
A0A414P2K5      ---ATVDPKE-QFSEYL---LGK-----CELDQVLKQTEVQA---HP------MDCIWQK
V8C417          ---ATVDPKE-QFSEYL---LGK-----CELDQVLKQTEVQA---HP------MDCIWQK
W6RXP9          ---ISNDK---GLSDVL---IG--------KVDIMEAAHKYN---KN------LLILTAG
W6S4G8          ---ISNSK---GLTDVL---VN--------QASLKDVAVGIK---ET------LLLIPAG
R5B467          ---RPAQT---GLAEYL---AG-------TAKPGQIVTALGK---DK------PDVIFAG
A0A143WVN6      ---LHDQVKY-SLSEYL---LG--------QCSFEQVITEVP---NG------LQIICQT
A0A3B8KKL6      ---VKNNI---GLTSIL---TDT-----KEDIKAKAIEKTEI---SN------LDIITSG
A0A2K9E6R0      ---VKNNI---GLTSIL---TDT-----KEDIKAKAIEKTEI---SN------LDIITSG
A0A2S8RBI0      ---VKNNI---GLTSIL---TDT-----KEDIKAKAIEKTEI---SN------LDIITSG
A0A0L6JLG6      ---VKNTE---GLTNIL---ATE-----KELKKSMIQNKEGI---EN------LFIIPSG
G8LSN0          ---IPNEK---GLTNII---KGD-----IEDKDINVLELKDI---PN------LSVITSG
A0A1Q6REE0      SHPLDEGR---NLTNFT---GS-------GEAAGALAQATDV---EG------LFVIVGN
R5ETF9          SHPLDEGR---NLTNFT---GS-------GEAAGALAQATDV---EG------LFVIVGN
A0A0X9GDD0      ---VAGDV---GLSEVL---AG-------EVQPDDALAATGI---PN------LTLLPAG
U2A8X2          ---IEGSV---GLTTIL---IG-------KVAVEDAVQPWGN---GN------LDVIASG
U2AC50          ---LEGSV---GLTNLL---VG-------DVAQEDIVLPWTR---PN------LFVLPSG
A0A1I4C3N6      ---MSGT----GLSEYL---GS---------DEAELNIQRSG---RG------FDVILAG
A0A3B9CIM7      ---IEGKE---GLSEYL---AG---------ITKELKVYKRA---EN------LYVAMAG
A0A1G9WHW8      ---TTSRQ---GLSQYL---AG---------INKDYELFNYN---NN------LDILFAG
A0A1H5VAA0      ---TTSRQ---GLSQYL---AG---------INKDYDLFNYN---NN------LDILFAG
A0A3R6VK11      ---LRGRL---GLSQYL---AG---------LRETPQIVEYR---QN------LDVLVGG
A0A3R6QUY7      ---LRGRL---GLSQYL---AG---------LRETPQIVEYR---QN------LDVLVGG
A0A373K3P9      ---LRGRL---GLSQYL---AG---------LRETPQIVEYR---QN------LDVLVGG
A0A3R6JRU5      ---LRGRL---GLSQYL---AG---------LRETPQIVEYR---QN------LDVLVGG
A0A1C5MS04      ---LRGRL---GLSQYL---AG---------LRETPQIVEYR---QN------LDVLVGG
A0A3C1J150      ---LRGRL---GLSQYL---AG---------LRETPQIVEYR---QN------LDVLVGG
A0A416CXD7      ---LRGRL---GLSQYL---AG---------LRETPQIVEYR---QN------LDVLVGG
R6XBL9          ---LRGRL---GLSQYL---AG---------LRETPQIVEYR---QN------LDVLVGG
A0A355W5Z7      ---LRGRL---GLSQYL---AG---------LRETPQIVEYR---QN------LDVLVGG
A0A143ZUX1      ---QT-TYRNKGLSDIL---TGS-----VY--PMDAIHHNEK---YG------VYILYSG
A0A143XPI5      ---LD--TNKKEIADVL---EGK-----LS--WKSALISEQE---TG------LQLLAGT
A0A355G1X5      ---LN-IPRGNDLASVI---CGK-----TD--LSDAIKYVEK---YK------LFILSSI
A0A0M6WXE3      ---MS-PKKENELGEFL---NGR-----TG--ANNILLNTER---KR------LGFIGGK
A0A348SAK2      ---MS-PKKENELGEFL---EGR-----ID--ANHILLNTER---KR------LGFIGGK
A0A1W1Z4C3      ---YD--PNSPGLSDIL---TSN-----IK--VEQAILNSTW---DN------LDVLPAG
A0A239QN83      ---YD--PNASGLADIL---TGS-----TT--AKKAIVSTVW---EN------LDILPAG
A0A1G9H5B9      ---YE--TDKEGLSDVL---AGR-----CQ--WQNVIMKDVA---QK------VDLLPAG
A0A1G6BLF1      ---LE--SVKCGTIDVL---KGR-----KE--IQDALVQYKD---TS------LEILPGG
A0A1Y4H8L0      ---IE-TQDKNELGEYL---KSG-----RF--SDEIITKTDI---GG------LYFMGGR
R6HZX3          ---IT--TPSAGLLELS---RA------AK--PDIARVLIPVPGVAN------LSLLAGD
A0A1W2CEA6      ---IHFGGQPTGLAHLL---SGQ-----CA--LEDAIYHTNI---PG------LDLLPDG
R7FFK6          ---VS---NKLGLSNVI---TDA-----SL--LDEALHQNVT---GT------LDLLTAG
A0A373MPB9      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A373L519      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A373W906      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A373VCW2      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
W0U604          ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A374B6G0      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A373VM36      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A1C5P379      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A373XXX0      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A356CW82      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
R6T4X7          ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A374HTV1      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A374GB66      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A374ECC6      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A374BM61      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A373UGZ4      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A373SA66      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A1C5X6X7      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A1C6JIH3      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A373PSC3      ---LK---NNVGLSTIL---SGE-----ST--FDKCVHETKN---GN------FAVLTSG
A0A1K1WYK8      ---IK---NDEGLSTLI---IKK-----SS--MAKSVKSNVI---NN------LDLLPSG
A0A1H6IUB1      ---LK---NKKGLSSAI---SKM-----CS--LEECIHKNVM---EN------LDVMTAG
A0A1M7L1F9      ---LK---NKKGLSSAI---SKM-----SK--LEECIQKDVM---EN------LDVMTAG
A0A1C6B4L6      ---IK---NKKGLSTAI---SKM-----NK--LDECIQKNVM---EN------LDVMTSG
A0A1Q6T9P4      ---IK---NKKGLSTAI---SKM-----NK--LDECIQKNVM---EN------LDVMTSG
A0A315Y4F9      ---LV---NKKGLSTAV---SKM-----HT--PDECIQKNVM---EN------LDVMTAG
A0A354K620      ---LV---NKKGLSTAV---SKM-----HS--PDKCIQKNVM---EN------LDIMTAG
A0A355G3J9      ---LD-LYGKYGLSEYL---ANL-----TD--ELCPMNYSEN-----------LDVITSG
A0A3D2AD87      ---LE---NGKGLADVL---TGT-----AT--LDEAIVTIK----PG------LNILTAG
A0A2T5IYJ6      ---LP-P-NSPGLSNVV---AGT-----SV--LDDCILHVED---AN------IDVLTAG
A0A252F281      ---RD-VDEANCLGEYL---RGT-----CS--VDKIIQTNAE---VN------LYEMFGK
A0A348SAK1      ---QE-G-EFPGLQAVL---QGK-----VK--ISEAMTTVELEKCPGS-----LQILYGG
A0A0M6WYQ8      ---QE-G-EFPGLQAVL---QGK-----VK--ISEAMTTVELEKCPGS-----LQILYGK
A0A173TM61      ---QE-G-EFPGLQAVL---QGK-----VK--ISEAMTTIELEKCPGS-----LQILYGK
A0A1Y4QKE6      ---LH-CKDNQGLIDVY---LQK-----GD--VLKNIRKLDD---SK------LWFIGND
B1C231          ---LK-CDNNEGLVDLY---LQK-----GD--VLKNIRKLDN---SK------FWFIGND
A0A1Y3TUL5      ---DK-VDYAHSLNALY---RGD-----AS--PEDVITHLTG-------------YLDLL
A0A1Y4JAX2      ---DK-VDYAHSLNALY---RGD-----AS--PEDVITHLTG-------------YLDLL
A0A1Y4T590      ---DK-VDYAHSLNALY---RGD-----AS--PEDVITHLTG-------------YLDLL
A0A3C0QME1      ---LS---NKKGLSTAI---GHM-----NP--LEESVHKGVY---KH------LDVMPSG
A0A355FYK5      ---VK-YDDKSGLIPII---KGE-----ST--YQESIKYVKS---LG------LFILPSG
A0A357AQU0      ---IK---NDSGLSNIV---SKQ-----KK--FDAVVHKAVY---KDKDCDGFVDLLTAG
A0A3C1YJQ7      ---IK---NDSGLSNIV---SKQ-----KK--FDAVVHKAVY---KDKDCDGFVDLLTAG
A0A3D0JG38      ---IK---NDSGLSNIV---SKQ-----KK--FDAVVHKAVY---KDKDCDGFVDLLTAG
A0A3C0IHX1      ---LE---NKVGLSEVL---GHM-----TT--WQVARHLAPL---PN------MDVLTAG
R5V506          ---LE---NKVGLSEVL---GHM-----TT--WQVARHLAPL---PN------MDVLTAG
A0A352TIU5      ---LE---NKVGLSEVL---GHM-----TT--WQVARHLAPL---PN------MDVLTAG
A0A3E5FSY5      ---LK-CDNNEGLVDLY---LQK-----GD--VLKNIRKLDN---SK------FWFIGND
A0A1Y3T163      ---IG-IRDGAGLADIV---KGE-----KT--IREGLRKLKK---SG------IWFLGSR
A0A1Y3YCA2      ---IG-IRDSAGLADIV---KGE-----KT--IREGLRKLKK---SG------IWFLGSR
A0A1Y4L6N9      ---IE-GVKGKGLYEVL---RKE-----CT--VKDAIFHDEE---SG------VYFLGGK
A0A173T644      ---LT-ETEGKGLYGVV---TGK-----CS--LEKAVEKDGR---SG------ISFLCGS
A0A1C5TSB8      ---LT-ETEGKGLYGVV---TGK-----CS--LEKAVEKDGR---SG------ISFLCGS
C0CIK6          ---LT-ETEGKGLYGVV---TGK-----CS--LEKAVEKDGR---SG------ISFLCGS
A0A1Y3WEF6      ---LT-EEKGRGLASVV---TGK-----CS--LQEAVYREEE---TG------VDFLGGS
A0A417T0L2      ---LT-EEKGRGLASVV---AGK-----CT--LKEAVYREKE---TG------VDFLGGN
A0A1H9EPU3      ------SKQVKGLTHYL---SGV-----NS--FDEVVCETNV---KN------LHMVFSG
A0A354IGV3      ---LR-LQPEQALSHYL---SDDSVRLSDF--VSSAVMQEEK---TG------LYVIAGD
A0A417JMV2      ---LD-QEEIQQFGEVL---NGN-----EQ--IDNLVTDLPK---SE------LLLIAGS
A0A415VWX5      ---LD-QEEIQQFGEVL---NGN-----EQ--IDNLVTDLPK---SE------LLLIAGS
A0A173UY96      ---LD-QEEIQQFGEVL---NGN-----EQ--IDNLVTDLPK---SE------LLLIAGS
A0A173QTL1      ---LD-QEEIQQFGEVL---NGN-----EQ--IDNLVTDLPK---SE------LLLIAGS
B0P408          ---LN-QEEIQQFGEVL---NGN-----EQ--IDNLVTDLPK---SE------LLLIAGS
D4MV82          ---LN-QEEIQQFGEVL---NGN-----EQ--IDNLVTDLPK---SE------LLLIAGS
A0A174A3T7      ---LD-QEEIQQFGEVL---NGN-----EQ--IDNLVTDLPK---SE------LLLIAGS
A0A1Q6K0H6      ---LN-QEEIQQFGEVL---NGN-----EQ--IDNLVTDLPK---SE------LLLIAGS
A0A174J359      ---LD-QEEIQQFGEVL---NGN-----EQ--IDNLVTDLPK---SE------LLLIAGS
A0A417UUA3      ---LD-QEEIQQFGEVL---NGN-----EQ--IDNLVTDLPK---SE------LLLIAGS
A0A1C6EUV9      ---LA-PEEVQEFGEVL---NGN-----EK--ADHLVHALAK---SE------LLLVTGT
A0A173Y645      ---LA-PEEVQEFGEVL---NGN-----EK--SDHLVHALAK---SE------LLLVTGT
A0A374AVY6      ---LA-PEEVQEFGEVL---NGN-----EK--SDHLVHALAK---SE------LLLVTGT
R7BXS4          ---LA-PEEVQEFGEVL---NGN-----EK--SDHLVHALAK---SE------LLLVTGT
A0A1V5S3C0      ---VP-VGGDKGIYDIV---RGK-----ST--FEEAIKYVEK---YN------MYLLISG
A0A1Y3TC98      ---VS-G--KYSLKDVA---GMD-----TK--KVKAGELLERIPGST------MWLLGNN
R6VAT5          ---IP-ESCSLGIVDVI---TGT-----CS--LQDAIVKTKK---NG------LYVLPGT
A0A1Q6S448      ---LS-VKQKNELGTLL---TES-----AA--PEKILAAAVTDPATG------LHSLLST
A0A351MYR0      ---LS-VKQKNELGTLL---TES-----AA--PEKILSAVVTDPATG------LHSLLST
R6HPC1          ---LP-VKQKNELGTLL---SES-----AA--PEKILSAAVTDPSTG------LHSLLST
A0A3D4G5Z5      ---LS-VKQKNELGTLL---SES-----AA--PEKILSAAVTDPSTG------LHSLLST
A0A3D5ES03      ---LS-VKQKNELGTLL---SES-----AD--PEKILSAAVTDPSTG------LHSLLST
A0A0F2P7X6      ---LD-LEDHQGLAAVL---NGA-----CA--AEEGIVFAAE---QG------IYVMPNG
A0A359B487      ---LD-LEDNQGLAAVL---NGA-----CA--AEECIVFATE---QG------IHVMPNG
A0A348P5V4      ---FS-ASDDEGICGIV---SGK-----KT--LKESIKYSEK---YQ------LFVLVSG
A0A356PT74      ---IN-ASEDGGVYGVI---NGE-----KT--LAEAIKYSEK---YN------LFLLVSG
A0A3D5LL19      ---IN-ASEDGGVYGVI---NGE-----KT--LAEAIKYSEK---YN------LFLLVSG
R5MNF0          ---IN-ASEDGGVYGVI---NGE-----KT--LAEAIKYSEK---YN------LFLLVSG
A0A1Q9JSI0      ---ID-KEEIKQFGEVL---NGN-----EN--AENLVLPIAN---SD------LLLVADS
A0A3D5TNI1      ---IT-NISGNGIADVV---GRV-----KN--SSDAIKYIEK---YK------IFVLAGD
A0A358LJD0      ---IS-NLSGNGIADVV---NGA-----KN--SSDAIKYIEK---YK------IFVLAGD
R6I3L7          ---IS-NLSGNGIADVV---NGE-----KN--SSDAIKYIEK---YK------MFVLAGD
A0A3D1HXX0      ---IS-NLSGNGIADVV---NGA-----KN--SSDAIKYIEK---YK------IFVLAGD
A0A3D2QJB8      ---IS-NLSGNGIADVV---NGA-----KN--SSDAIKYIEK---YK------IFVLAGD
D4LC36          ---LS-N--KVGLSDVI---TGD-----KP--LDKALNRNVT---GS------LDVLTSG
R7MQJ4          ---LK-N--KKGLSSII---GKM-----NK--FDECVNKNVV---KS------LDILTSG
A0A1V5GLC0      ---LK-N--KKGLSTAV---SKM-----NS--VEECIIRNVE---DN------LDVMCAG
W7V182          ---IK-N--KKGLSTAI---SKM-----AA--LDECISKDVM---ED------LDIMTAG
                                                                            

S3FFL2          PI-PPNAAELLTGDRFGVLLTRLLDQYDHVVVDSPPVMGLADAPLIASRVEGVIYAIESH
A0A0T8KPS6      QL-PPNPSELLMHENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYG
A0A0T8LA03      FS-APNPSELLMHDNFSRLLREAEKLYDFIIIDTPPVLAVTDAVLVAQQSGTNLLVARFG
A0A328M4V1      KI-PPNPSELLMHARFTSLLEGLKSRFDLIIIDTPPILAVTDAAVIGHHVGTSLLVVQFG
A0A1G6BLB6      VI-YPNSTELLSQGLLERIIGELKREYDYIIIDCSPMALVADAEEMLNMVDNTLLVVRQH
B5CSZ7          KA-VAKPYRLLGSERFISLINQLKEQFDYVVMDTPPLELIRDAEIISETADAMLMVMRQD
A0A1C6G8M0      KL-VTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGVVGDAAIVSSVCDGTLLVIENG
A0A416MP73      KL-VPNASALLSAKWLENLCAEVRDSYDYVIFDTPPICVVGDAAIVASFCDGALLVIENG
A0A396G6S7      TS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQD
A0A3E5A223      TS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQD
R7D5E6          TS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQD
A0A415HQH5      TS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQD
A0A414W2C6      TS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQD
A5ZNE7          TS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQD
A0A395X821      TS-LNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQD
A0A1C5PY68      TS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQD
A0A174CJF8      TS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQD
A0A174R7V0      TS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQD
A0A173ZYY6      NC-YSSSTEMLNSESFFKLMAACRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVSKQN
A0A3D0F0Y4      NC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVSKQN
A0A174ASH7      NC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVAKQN
A0A173SMI2      NC-YSSSTEMLNSESFFKLMAASRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVAKQN
A0A174GP12      NC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVAKQN
A6BH65          NC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVAKQN
R7G0D7          NC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVSKQN
A0A373MWV2      ER-LEEPSEAVGGEIFRRILDMCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQD
A0A417CE88      ER-LEEPSEAVGGKIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQD
A0A416Y441      ER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQD
A0A357GPJ7      ER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQD
A0A396PAC1      ER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQD
A0A416EYU4      ER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQD
A0A416SCQ2      ER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQD
A0A416TGN7      ER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQD
A0A417SMF6      ER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQD
A0A1Y4MW77      ST-IDDLTAVLTNPNMEQFMNDMRQKMDYIIFDAPPCEAFEDVFLLEKYGDAFVYVIKQD
R6UHV6          KG-TQQANELITGEKMDYLISAAREQYDYIIIDTPPLCFVSDAEDILTLSDSSLIVVRRN
A0A3R9Q621      SK-PPNPAEMLASVHMEELIAKLAKSYDYIIIDTPPINVVSDVIGLVKLVDGMLIVVRQA
A0A069RC75      NS-VQNPAELLQSERIRELIRKIENDYDYIIVDTPPATAVTDASIVSTFSDAAVIVCSSG
A0A174F2W5      ER-LEEPSEAVGGEIFRRILDMCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQD
A0A174S8E9      ER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQD
A0A416ZL97      NR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQD
A0A174LSK1      NR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQD
A0A373GY92      NR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQD
A0A373NZQ6      NR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQD
A0A417I9B9      NR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQD
A0A417MP97      NR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQD
A0A417WQF8      NR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQD
A0A373RZ83      NR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQD
A0A416U6I1      NR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQD
R7JQZ9          NR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQD
A0A1M5UYN6      PM-PPNPAEMLNSIKMKFFIEKLKNDFDYIILDTPPVIPVTDAQVIANEADGVILVVASN
A0A176JBT8      PI-SPNPHELIISKKMDLLIDRLKQKFDVILFDSSPL-LVSDSILLSGKMDGCIYVLNAR
A0A1I5HIC6      IL-PPHPSEMLGNEEFKDLVRSQREIYDYIIIDTPPLGVVIDSANVAEICDGTILVIESG
A0A1Y3TC51      RA-VREPARILREEKLEGLAEEWKREMDYIIIDCSPVAVSADAEVWVSVADSVLLVVRED
A0A1Y3T1N0      SG-AKDPAAVFAEAPMKTLAREWKQEMDYIIIDCPPTAVSTDAEVWMEAADTVLLVVRED
A0A1Y3Y8U8      SG-AKDPAAVFAEAPMKTLAREWKQEMDYIIIDCPPTAVSTDAEVWMEAADTVLLVVRED
A6CLL4          PL-PPNPTELLSSDRLSSMINTLKKEVDLILIDTPPL-IVSDAAVLSSRVDGCLFLINAR
A0A174DL89      VI-PPNPSELISSNGMKILLDRLTSNFDFILIDSPPLPLVADSQALSTFVDGTIIITKLG
A0A176U8D6      KL-VPNASALLSAKWLENLCAEVRDSYDYVIFDTPPICVVGDAAIVASFCDGALLVIENG
A0A1Q6KSQ5      KL-VTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGVVGDAAIVSSVCDGTLLVIENG
A0A3D3U8B3      KL-VTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGVVGDAAIVSSVCDGTLLVIENG
A0A3E5FRL7      HA-IDDPSKLMNAVTLKKIMEQLKEHFDYIVIDCSPVAVSVDAEVWMEVVDSTILVIRQD
A0A1Y4QK93      HA-IDDPSKLMNVVTLKKIMDQLKKHFDYIVIDCSPVAVSVDAEVWMEVVDSTILLVRQD
B1C232          HA-VDDPSKLMDVITLKKIIDQLKEQFDYIIIDCSPISVSVDAEVWMEVVDSTILLVRQD
A0A401USI6      KA-NYNPSELLSSQKMKDFIKDMEKKYDYVILDTPPIIAFADALTLATEKIGVILVIGSE
A0A1V4IQ10      KF-TGKPASMLASQEMDNILTELKKNFDIILLDSPPVQAVTDAQILSTKVDCTLVVIRSG
A0A1S8TRD2      KF-TEKPASMLASQTMDDILTELKQKYDIILLDSPPAQAVTDAQILSSKVDCTLIVIRSG
G7M1U2          KF-TEKPASMLASQTMDDILTELNQKYDIILLDSPPAQAVTDAQILSSKVDCTLIVIRSG
A0A2T6KJ75      PV-PPNPTELLSSTKFVQLLEELKNQFDIIIVDTPPL-LVADTLHISANVDGCLYVVNAE
A9KN92          IL-PPNPSEMLGSEEFKNLVKNLRDEYDYIIIDTPPLGVVIDSANVADICDGTIMVIESN
A0A352MUJ1      SI-TYDSSELLLSNRIIKTVETLKKNCDIVIFDATPSNLVTDAVVLSRLVDTSFIVTEHE
R5YI67          SI-TYDSSELLLSNKIIKAVEILKKNCDIVIFDATPSNLVTDAIVLSRLVDTSFIVTEHE
A0A1Y0IQP5      AI-PSNPSELLGSPKLRAALADVRTRYDLVLIDSPPLLPVTDGQVLSTLCDGVLLVVRSG
A0A1M6E8I2      KL-PGNPSELLQSNVMKKMVEFLEKKYDYVLFDSPPVVPVTDAVVMTRYIEGAILVVASG
A0A1Y4N105      DS-KKNSSNYFLTAQFTQFIKKCRSNFDYIIIDTPPMGACVDVEAIINHSDSSVMVVRED
A0A1Y4QP75      DS-KKNSSNYFLTTQFAQFIKKCRSNFDYIIIDTPPMGACVDVEAIINHSDSSVMVVRED
A0A3D4QRB5      PK-PPNPSELLGSTRMQAFLQQAAEIYDMIILDAPPIMPVSDALVLSKYTDGVVYVVGYG
A0A2X2LGT4      TV-PPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVADANLFATQTDGVILVVDAT
A0A349DEH5      KS-VPNPSELLSTDKMEAIIDEVRKNFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVRED
A0A3D4T7B4      KS-VPNPSELLSTDKMEAIIDEVRKNFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVRED
A0A350XYC7      NG-VNNPSELLSTEKMEHIIEEVRNAFDYVLIDTAPASVVTDTAVIAGFADAAIIVVRED
R6DNR8          KG-VNNPSELLSTEKMESIIEEVRKAFDFVLIDTAPASVVTDTSVIAGFVDAAIVVVRED
A0A355KUM5      KG-VNNPSELLSTEKMESIIEEARKEFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVRED
R5YGY6          KG-VNNPSELLSTEKMESIIEEARKEFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVRED
A0A0K8J554      TI-APNPTELLSSIQMEELLLRLEKRYDYIILDSAPVNLVADALSLAKLVDGILMVVREN
A0A2S4GG02      SI-PPNPAELLAGDQWYQLLQECKKKYDVIFIDTPPIGIVSDALSMAKAATAFILIVREM
A0A3N1XSX6      SI-SPNPSELLSSSHMEELINVLEKDYDYIIFDTPPVNVLSDSLSLVKLSDGLIIVVREG
A0A1C6G0U3      TK-PINPSDILASKKMINFIKQIRNEYDYIFIDSPPVNIVSDSEVLSRIVDGVIVVIGCN
A0A3D4LLB3      MI-PANPAEIINSRALKELIKEVSADYDYILLDVPPVMLVSDPIIISTFSNAVILAIEHG
A0A0A5GPA9      PM-PKNPAEVLSSDKINTMLAELKEHFDLVIIDTPPL-VVADAVALSTRVDGCVFVVNAQ
A0A271M6M4      PL-SANPAELLSSEKIDIMLETLQESYDLVIIDTPPL-VVSDAVVLSTKVDGCIFIVNAQ
A0A1V5LU59      PI-PPNPAELLSSKRMNQLLEELKNEYDVIIIDTPPVGQVTDAAIIAGITDGVLLVFASS
A0A1E3BVC3      PI-PPNPAEMLNSNRMKKLLEKMKEEYDIIIIDTPPVGQVTDAAIVAGITDGVMLVLASG
A3DF66          PI-PPNPAEMLNSNRMKSLLEKVREEYDIVIIDTPPVGQVTDAAILAGITDGVILVLASG
W4V1T8          PI-PPNPAEMLNSNRMKSLLEKVKEEYDIIVIDTPPVGQVTDAAVIAGITDGVMLVLASG
A0A2V3W8U6      PI-PPNPAELLSSERMDQLLQELKEHFDRIIIDSPPL-FFSDAAILATKVDGCLLVVQSD
W1UFG0          KI-PQNPTEILASKKMKNLIDYLKNDYDYIFIDTPPAGVVSDCSILSRYSDGLVYIMASK
A0A351SRI8      VT-PPNPSELLNSDKNKKLVSSLSNNFDIIIFDSAPINGLADSLVMSTLVDGVIIVTACK
A0A1I0RG99      TI-PPNPSELLASIQMEELLSQLNNEYEYILIDTPPVKVVSDALNLVKMVDGVLIVVREG
A0A1I5G322      TI-PPNPSELMASSQMEELLKKLEREYDYIIIDTPPVRVVSDALILMKAADGVLIVVREE
A0A1C6ITD7      VI-PPNPSELISSNGMKMLLDRLSSNFDFILIDSPPLPLVADSQVLSTFVDGTIIVTKFG
A0A381IX63      NI-PNNPAEILNSNRMRSFVEETKEHFDYVFIDTPPIGIVSDAGIVSTYSDGIILVAASN
A0A1G9IUT4      SI-PSNPSELLSSHKMQKLLEELKNEYDYIFIDSPPIGRVTDAGVISNYVDSTIIVIAEN
A0A1M6RWV2      PI-PPNPSEILGSNAMKKFIEQCKEYYDIILIDSPPAGIVTDAAVLSKITDGTLFVVAAG
A0A3R9WAA7      KQ-LEESSEILGKRAIGSILEQLKEEYDYIILDSAPSAVISDTIELAKYADGVIYVIRQD
R5EFZ0          RG-EQNTGDLLISPRMNALLDWARECFDFIVLDLPPMSAASDAEGMADLADASLLVVRQN
A0A0H5SF45      SI-APNPTELLSSIQMEELIKKLEQNYDYIIIDTAPVNLVADALSLAKMVDGVLMVVREK
A0A1M6JRJ5      ST-PPNPSELLGSKQMELLIKELETEYDYIVLDTPPVNVVADSLSFIKSTDGAILVTREN
A0A1M7Y1S2      SI-PPNPSELLGSRQMELLIKELEAEYDYIILDTPPINIVADSLSFIKSTDGAILVVREN
A0A143XN92      QP-LQNSLELMDYSSWKDWIKKMEQEMDYILIDTSPVALTSDGESLAHIIKDTILVVRYD
A0A3D5R4X5      LI-PPNPSELLGSKSMLEFIEKVKEEYDYVIFDTPPVALVTDAAILANEVDGVILVTSFG
A0A3E4LL92      KA-VARPYRLLESERFASLIHQLKEQFDYVVMDTPPLELIRDAEIISETADAMLMVMCQD
A0A415D1L1      KA-VAKPYRLLGSERFISLIDQLKEQFDYVVMDTPPLELIRDAEIISETADAMLMVMRQD
A0A414P2K5      KA-VAKPYRLLGSERFISLINQLKEQFDYVVMDTPPLELIRDAEIISETADAMLMVMRQD
V8C417          KA-VAKPYRLLGSERFISLINQLKEQFDYVVMDTPPLELIRDAEIISETADAMLMVMRQD
W6RXP9          KI-PPNPSEMLGSKTMKELLDRLKEVVDYIILDTPPVQAVADAQILSTRADGTLLVIKAG
W6S4G8          RV-SPNPTELLNSKAMELLLEELKETCDYVILDTAPVEAVADAQILSAKADGTLVVIKSG
R5B467          RR-AGAQTEQLGSAAFHTLLHDLREHYDVVLLDTPPCAVMTDALETGAATDCALLVVRQD
A0A143WVN6      RG-LNNSTKYIMSKNMLDFILKCRENYDLIVLDTPPIGAGVDVEAILNYGDTSIMTVRQD
A0A3B8KKL6      PV-PPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVGQVTDAAILAGLADGTILVLACA
A0A2K9E6R0      PV-PPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVGQVTDAAILAGLADGTILVLACA
A0A2S8RBI0      PV-PPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVGQVTDAAILAGLADGTILVLACA
A0A0L6JLG6      PI-PPNPSEILSSDKMRQLVEKLKSEYDVIFIDTPPVGQVTDAAILTGIADGSIVVVAGG
G8LSN0          PI-PPNPAEILSSNKMQNLLEDLRGNYDFILLDTPPVGQVTDAAILAGIADGTIMVFACS
A0A1Q6REE0      ADGKADYFDAPTQARLTKLIRYARDKYDYVILDTPPCSLLTDAAEAAEAAEAGLMVIRQD
R5ETF9          ADGKADYFDVPTQARLTKLIRYARDKYDYVILDTPPCSLLTDAAEAAEAAEAGLMVIRQD
A0A0X9GDD0      RT-PPNPSELLGSKRMRALLKLASEDF-FVIVDSPPLLPVTDGSLLATAVDGTVLVVRQG
U2A8X2          QI-PPNPSELLGGDSMAQLLERLRTEYDVIVVDTPPLLPVTDAAILAKGVGGAIVVVGAG
U2AC50          VL-PANPGVLLSSERLVAVIGDLRTHYDYVVIDTAPILPLSDPLWLSRAVDGVLVVARAR
A0A1I4C3N6      AK-PSNAADLLAGGKIRELINAQKENYDMIIVDLAPAGRVIDGLELADCLTSYVLVVREM
A0A3B9CIM7      EV-PPNPAELLSGERWSELLEKCKEEYDCIFVDLPPAGIVADALVLAATATAYILVVREG
A0A1G9WHW8      EI-PPNPMELLSSEKCKNLLESLKETYDVIFIDFPPVGEVADALALADSVTSFVLVVREN
A0A1H5VAA0      EI-PPNPMELLSSEKCKNLLESLKETYDVIFIDFPPVGEVADALALADSVTSFVLVVREN
A0A3R6VK11      EN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAG
A0A3R6QUY7      EN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAG
A0A373K3P9      EN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAG
A0A3R6JRU5      EN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAG
A0A1C5MS04      EN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAG
A0A3C1J150      EN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAG
A0A416CXD7      EN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAG
R6XBL9          EN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAG
A0A355W5Z7      EN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAG
A0A143ZUX1      KP-TDQASELLGNDLMNEFFKIVEPNFDFIIIDTPPAHVVSDAMTIRRFVDATILVVRQD
A0A143XPI5      YR-RDNSAKLMESTYMEQLLEEAKEQFDCVIVDAPPCTILSDAIILAKKLDSVIMVIRYD
A0A355G1X5      EP-NSEPTEILASQQMNKIIKAAKKEFDYVIIDTAPAAVVTDATILSNFADACIMVVREN
A0A0M6WXE3      VS-YSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGMIGDAQIFAQHADAVMVVARQN
A0A348SAK2      VS-YSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGMIGDAQIFAQHADAVMVVARQN
A0A1W1Z4C3      AV-PTNPCELLESPAMQELLKELEEKYDLILMDVPPINIVSDPLALSGQCAGALFVVRQN
A0A239QN83      SM-PSNPCELLESPTMAKLIQELEEQYDLVLMDVPPINIVSDPLALSSQAAGTLFVVRQE
A0A1G9H5B9      HL-PPNPAELLESARMQQLLLELNDAYDLVLLDMPPVDIVADPLAVSAHVAGCILMVRQH
A0A1G6BLF1      KA-ISKTSRVLSSEKVGNLIRTLQKEYDYVILDTPPCALLNDATMVASQAQAAIFVVRQD
A0A1Y4H8L0      NC-YSMSTDMLQSGNIEKLLKTCRRLVDYVVIDTPPAGPLGDAELFARYADEVLLVVRQN
R6HZX3          TR-MTSPMGILDSPKMRSLLERTRTLADYVIIDAPPAGLLADAAVLCRSADQVLYVVRYD
A0A1W2CEA6      AS-IKTPLALLTSAEFDSLMATVGRDYDFVIVDTPPLGVVVDAAEISRRCDGSLLVLEYN
R7FFK6          TI-PPNPSELLASKQMAELLDKLKEKYDIILIDCAPVNVVSDVAGMANSIAGVVMVVHYG
A0A373MPB9      VL-PPNPSELLASEKMRELLEYVQHKYDYVIIDGTPLLPVTDVMSLADEVAGVLLIARYG
A0A373L519      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYG
A0A373W906      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYG
A0A373VCW2      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
W0U604          VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A374B6G0      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYG
A0A373VM36      VL-PPNPSELLASEKMRELLEYVQHKYDYVIIDGTPLLPVTDVMSLADEVAGVLLIARYG
A0A1C5P379      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A373XXX0      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A356CW82      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
R6T4X7          VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A374HTV1      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A374GB66      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A374ECC6      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A374BM61      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A373UGZ4      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A373SA66      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A1C5X6X7      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A1C6JIH3      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A373PSC3      VL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYG
A0A1K1WYK8      PL-PPNPSELLASENFKKLLEQFATNYDYVIIDTPPVNVVSDAMVMKDSISGIMLVIRYA
A0A1H6IUB1      PV-PPNPSELLASDNMGAILEKLSEEYSMILIDTPPVNVVTDAMELAKYVSGIVLVLRYG
A0A1M7L1F9      PV-PPNPSELLASDNMGAILEQLSSEYSMILIDTPPVNVVTDAMELAKYISGIIVVLRYG
A0A1C6B4L6      PL-PPNPSELLASENMLAILDELNKKYQIIIIDTPPVNVVTDAMELAKCVSGIVVVLCYG
A0A1Q6T9P4      PL-PPNPSELLASENMLAILDELNKKYQIIIIDTPPVNVVTDAMELAKCVSGIVVVLRYG
A0A315Y4F9      PI-PPNPSELLASEMMEQMLNELSEKYDAILIDTPPVNVVTDAMELAKSVSGIVLVVRYG
A0A354K620      PI-PPNPSELLASDTMEQMLHDLSEKYDVILIDTPPVNVVTDAMELAKMISGIVLVVRYG
A0A355G3J9      KC-TSYAADLLSTTRAKESISAFRKDYDYIIIDSPPINEVSDAMTLVDVVNGYIMCSIAG
A0A3D2AD87      FI-PPNPSELLDSVNFEETMKLLNEQYDYVIVDTPPLNVVTDSMIIAPQTGGVILIVRDG
A0A2T5IYJ6      LV-PPNPLELLSSQKFMDLIAKLSETYDRIVIDSPPTLLVSDSLVMSKAVDAVLYVIRSD
A0A252F281      NY-YSDSVELLGSARMKKLLEVSRQKMDFIIIDSPPMSALSDTEVLAELVDATVLVVRED
A0A348SAK1      TK-EGSSSDLLESKQMERLISILKKKADLVIFDTAPSEMLADAPVLARYLDAAVYVIRYD
A0A0M6WYQ8      TT-EGSSSDLLESKQMERLISILKKKADLVIFDTAPSEMLADAPVLARYLDAAVYVIRYD
A0A173TM61      TT-EGSSSDLLESKQMERLISILKKKADLVIFDTAPSEMLADAPVLARYLDAAVYVIRYD
A0A1Y4QKE6      NP-VDNPVSVLSHPDLKEFIEKMKKEFDYVIIDTPPCGIFQDVTLIQKYADALLYVVKYD
B1C231          KP-INNPVSVLSHPDFKKFIEKMKKEFDYVIIDTPPCGIFQDVTLIQEYSDALLYVVKYD
A0A1Y3TUL5      PS-ILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGRVAETLSLNRIAKSALFVIRFD
A0A1Y4JAX2      PS-ILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGRVAETLSLNRIAKSALFVIRFD
A0A1Y4T590      PS-ILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGRVAETLSLNRIAKSALFVIRFD
A0A3C0QME1      PI-PPNPSEMLASQQFSDILDELEPQYDYIIIDTPPINVVSDTLVMGKILSGLLLVVKYG
A0A355FYK5      GI-TQKSSEVLDADKVRHVIEQARKEFDFIIIDTPPSRVVSDSMVMSSLADSLVFVIRKD
A0A357AQU0      TI-PPNPSEILASEALKNLITEASEQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFE
A0A3C1YJQ7      TI-PPNPSEILASEALKNLITEASEQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFE
A0A3D0JG38      TI-PPNPSEILASEALKNLITEASEQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFE
A0A3C0IHX1      TC-PPNPSELLASPAMKKLLEEAEQQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYY
R5V506          TC-PPNPSELLASPAMKKLLEEAEQQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYY
A0A352TIU5      TC-PPNPSELLASPAMKKLLEEAEQQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYY
A0A3E5FSY5      KP-INNPVSVLSHPDFKKFIEKMKKEFDYVIIDTPPCGIFQDVTLIQEYSDALLYVVKYD
A0A1Y3T163      RI-VKQPASVLSSPRTGELIQALKKEMDYIIIDTPPCEMFQDAGMLSDYADGILYVVKYD
A0A1Y3YCA2      RT-VKQPASVLSSPRTGELIQALKKEMDYIIIDTPPCETFQDAGMLSDYADGILYVVKYD
A0A1Y4L6N9      EP-IKEVTQTLNSSNLLDVMESLRKEMDYVIIDAPPSEMFEDAAVLSEYADGILYVVRYD
A0A173T644      LP-VRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPAEMFEDASLMAEFSDGICYVIRHD
A0A1C5TSB8      LP-VRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPAEMFEDASLMAEFSDGICYVIRHD
C0CIK6          LP-VRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPAEMFEDASLMAEFSDGICYVIRHD
A0A1Y3WEF6      KP-VKGVQQILNHSSFHEVIKEMKAQWDLILLDAPPTEMFEDASILAEQADGILYVIRYD
A0A417T0L2      KP-VKGVQQILNHSHFHEVMEEMKAQWDLILLDAPPVEMFEDASILAEQSDGILYVIRYD
A0A1H9EPU3      IV-PPNPAELLESVYFRELVKQLRQAYDYVVIDTPPVGTVIDGAIIGKECDGVVMVVGSG
A0A354IGV3      HS-VPMSSELVSSARMQALLAHFREEMDFILIDSPPMALFSDAEALANLSDASVMVIRQS
A0A417JMV2      MI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQH
A0A415VWX5      MI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQH
A0A173UY96      MI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVELADASILVVRQH
A0A173QTL1      MI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQH
B0P408          MI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQH
D4MV82          MI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQH
A0A174A3T7      MI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQH
A0A1Q6K0H6      MI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQH
A0A174J359      MI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQH
A0A417UUA3      MI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQH
A0A1C6EUV9      MI-YPNSTEMIASDMFYKIVDFFKDRLDYVIIDTPPMSQAADAEELVDYADASILVVRQH
A0A173Y645      MI-YPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQAADAEELVDYADASILVVRQH
A0A374AVY6      MI-YPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQAADAEELVDYADASILVVRQH
R7BXS4          MI-YPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQAADAEELVDYADASILVVRQH
A0A1V5S3C0      EP-VSDPSEVLASSITQETINEAKKNFDFVIIDCAPAGVVADATIVSNYCDAVLFVVAEN
A0A1Y3TC98      EV-VKQPAPVLSSRMVKLFIREMRRKMDYVIIDSPPCTMFQDAGILADHADAVLYVVKYD
R6VAT5          IP-VNNASELMGSKQLADLVAALEKIFDYVVIDAPPVGIVSDALEMKDYVGGLVFVVRQD
A0A1Q6S448      KS-YTDVIELLASDQLAKVVALARERYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQD
A0A351MYR0      KS-YTDVIELLASAQLAKVVALARERYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQD
R6HPC1          KS-YTDVIELLASDQLAKVVALAREQYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQD
A0A3D4G5Z5      KS-YTDVIELLASDQLAKVVALAREQYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQD
A0A3D5ES03      KS-YTDVIELLASDQLAKVVALAREQYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQD
A0A0F2P7X6      YI-VPNPSELLGSEKMAALLAALEKQYDYIILDTPPSYLLTDAVALSVYADGVILVVKQG
A0A359B487      YI-VPNPSELLGSEKMAALLAALEKQYDYIILDTPPAYLLTDAVALSVYANGVILVVKQG
A0A348P5V4      VA-VENSTEILSSPKMEEIVEAAKKEFDYVIIDTAPCGIIADASILAGYADTIVLVVKQD
A0A356PT74      KP-VFDPSELLSTDAMSDIIKSAEKEFDYIIIDTAPCGVVADASILSSYADGILLVVRND
A0A3D5LL19      KP-VFDPSELLSTDAMSDIIKSAEKEFDYIIIDTAPCGVVADASILSSYADGILLVVRND
R5MNF0          KP-VFDPSELLSTDAMSDIIKSAEKEFDYIIIDTAPCGVVADASILSSYADGILLVVRND
A0A1Q9JSI0      MI-YPNSTEMIARPLFQKVLDFFKERLDYIIIDTPPMSQAADAEEMVDLVDASILVVKQH
A0A3D5TNI1      EC-IADPTEVLSNAKTGEFIAAAKEKFDYIIIDTPPAGIVADAAICAKYTDSSIFVIRED
A0A358LJD0      ES-IADPTEVLSNAKTGEFLAAAREKFDYIIIDTPPVGIVADAAICAKYTDSSIFVIRED
R6I3L7          ES-ITDPTEMLSNAKTGEFIAAAREKFDYIIIDTPPIGIVADAAICAKYTDSSIFVIRED
A0A3D1HXX0      ES-ITDPTEVLSNAKTGEFIAAAREKFDYIIIDTPPVGIVADAAICAKYTDSSIFVIRED
A0A3D2QJB8      ES-ITDPTEVLSNAKTGEFIAAAREKFDYIIIDTPPVGIVADAAICAKYTDSSIFVIRED
D4LC36          TI-PPNPSELLASRQMKELLETLKERYDMILIDCAPINVVSDVAGLSQEIAGVVMVVHYG
R7MQJ4          TK-PANPSELLASEQAAELLNTLSEAYDYIIVDTPPVNIVSDAMGLSNSIAGILMVLRYG
A0A1V5GLC0      PI-PPNPSELLASENMSQMLEKLSAEYSAIVIDTPPINVVTDAMELARNISGIILVTSYG
W7V182          PI-PPNPSELLASSNMENILDQLSERYSVIIIDTPPVNVVTDAMELANKVSGIIMVARYA
                                             :..* .*     :                  

S3FFL2          GIRATLVKTALG-RLLNANVHIFGGVLTKFEATKSNSGYGY-EYGYGYGRDEKAGD----
A0A0T8KPS6      LNGLKEIEAAKR-RLEQNGLLVKGVIFNAVVRKAS----TYGEYGYYQYEYASTNK----
A0A0T8LA03      LSTSSQIDASKR-RLAQNGVLLKGVILNAVKRKASTSPYDSGAYGYYTYTQQA-------
A0A328M4V1      LNQPREIALAKQ-RFEQNGVPIKGAIFNLVEKRSA----GYYAYAYYTYAAAKS------
A0A1G6BLB6      YANVRDINDAID-IINSRKEKLIGCVFNNVGGNRVSLTHGGQGYGEYGNYGYGRYHQYDH
B5CSZ7          EVHAVAVNDTVD-LLEENGVTVIGGVLNMTKGERDTSKDRDGYRKYYNENAKIENAGE--
A0A1C6G8M0      VTKKKTLCQIAA-ELEKIDTNILGVVQNMVGSKKDSSYYGKGNYGYYYGNNQNKK-----
A0A416MP73      VTKKKTLAQMKF-EMDKVGANVIGVVQNMVGSKKDSSYYGKGNYGYYYGNYGNNQNKNKF
A0A396G6S7      TVLTKDINDAID-ILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA---------
A0A3E5A223      TVLTKDINDAID-ILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA---------
R7D5E6          TVLTKDINDAID-ILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA---------
A0A415HQH5      TVLTKDINDAID-ILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA---------
A0A414W2C6      TVLTKDINDAID-ILNNTRGKVLGCILNGVTSQNMAGSGHYGCGGHYGKRA---------
A5ZNE7          TVLTKDINDAID-ILNNTRGKVLGCILNGVTSQNMAGSGHYGCGGHYGKRA---------
A0A395X821      TVLTKDINDAID-ILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA---------
A0A1C5PY68      TVLTKDINDAID-ILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA---------
A0A174CJF8      TVLTKDINDAID-ILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA---------
A0A174R7V0      TVLTKDINDAID-ILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA---------
A0A173ZYY6      YMLAEDINEVMD-DFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRS
A0A3D0F0Y4      YMLAEDINEVMD-AFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRS
A0A174ASH7      YMLAEDINEVMD-AFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRS
A0A173SMI2      YMLAEDINEVMD-AFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRS
A0A174GP12      YMLAEDINEVMD-AFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRS
A6BH65          YMLAEDINEVMD-AFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRS
R7G0D7          YMLAEDINEVMD-AFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRS
A0A373MWV2      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER----
A0A417CE88      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER----
A0A416Y441      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER----
A0A357GPJ7      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER----
A0A396PAC1      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER----
A0A416EYU4      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER----
A0A416SCQ2      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER----
A0A416TGN7      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER----
A0A417SMF6      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER----
A0A1Y4MW77      FVQRPRIVDCIG-TLADSELPLLGYVFNGDSFTFRDYSRYGYRYYNKYGYRHYSYYNNEK
R6UHV6          VANALSINDTID-IILASGVKLMGCVYNDAENVSIVGRGSVYSDYQYGKYGYGKYGKYGS
A0A3R9Q621      VTSHPNIAGALS-KYELVNANILGFVLNGVIRKQGLKSKSGYYYRSKDD-----------
A0A069RC75      IVDIDELKRAKA-QLEGVNARIMGAIFNRASEASSY-------YSYYGK-----------
A0A174F2W5      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER----
A0A174S8E9      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER----
A0A416ZL97      GALTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER----
A0A174LSK1      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER----
A0A373GY92      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER----
A0A373NZQ6      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER----
A0A417I9B9      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER----
A0A417MP97      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER----
A0A417WQF8      GVLTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER----
A0A373RZ83      GALTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER----
A0A416U6I1      GALTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER----
R7JQZ9          GALTRDINDAID-ALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER----
A0A1M5UYN6      EADKDAVVRAKE-LLLKVRANILGVVLNKIEFSKGKGYWYNYEYYYSYGSSNKHKNTKSK
A0A176JBT8      KTNRDDANEKIE-LLKRSSNELIGAILNEKKTHKSN------PHYYYGGYMG--------
A0A1I5HIC6      KISYRLIQRVLK-QLITGKSRVLGAVLNKANIYGKGYKKNYYGKYYGR------------
A0A1Y3TC51      WADVRVINDAVD-MISQNGTDFTGFVLNAFHREWSR-PAGRQEYSYGRAYRSQDMPGEGL
A0A1Y3T1N0      WSDVRIVNDTVD-MIWQSGCDFSGFILNAFHRDWIS-QSSGYGYDY--------------
A0A1Y3Y8U8      WSDVRIVNDTVD-MIWQSGCDFSGFILNAFHRDWIS-QSSGYGYDY--------------
A6CLL4          KTRMETAKKNLN-KLNRVGANIIGVILNKTKKEKSQ-------TYYY-------------
A0A174DL89      YTTKSALLNTKE-ILDGLKTNVIGVVLNNSPLDSSV-------NYYYQ------------
A0A176U8D6      VTKKKTLAQMKS-EMDKVGANVIGVVQNMVGSKKDSSYYGKGNYGYYYGNYGNNQNKK--
A0A1Q6KSQ5      VTKKKTLCQIAA-ELEKIDTNILGVVQNMVGSKKDSSYYGKGNYGYY---YGNNQNKK--
A0A3D3U8B3      VTKKKTLCQIAA-ELEKIDTNILGVVQNMVGSKKDSSYY---------------------
A0A3E5FRL7      WTDIRVVNDTVD-LIWQSNCNFTGFALNMFIDNDSHHNDYGYSYYDYKTHRHESR-----
A0A1Y4QK93      WTDIRMVNDTVD-LIWQSGCDFTGFALNMFIDDEIRHNDYGYSYYDYKNHRHESR-----
B1C232          WTDIRIINDTVD-LIWQSDCDFIGFALNMFIDDEIRHNDYGYSYYDYKTHRHESR-----
A0A401USI6      ESTIENCKKSKQ-LLLNINATIIGIVLNKVDKRSFI--GYGYDYYSYDKEKSSRLRNKSG
A0A1V4IQ10      VTNAKSVLETKS-LLTKINGLVIGTVLHRTEYNKDT--------YYYSSHSSSSNTIKSL
A0A1S8TRD2      LTNAKSVLETKN-LLIKVNGLVIGTVLHRTEYNKDT--------YYYRSHGSSNKITRSL
G7M1U2          LTNAKSVLETKS-LLTKVSGLVIGTVLHRTEYNKDT--------YYYRSHGSSNKTTRSL
A0A2T6KJ75      SSKVEQAIYSIE-LLKQVQAPLIGTIINKSKGSVRS-------YSYYN------------
A9KN92          KISYRFAQRVLK-QLITEKSKVLGAVLNKANIYGVGYNKKYYGKYYSHVYANDYDENGN-
A0A352MUJ1      KTQIDDIAKIKT-QIEDVGGNIAGIVINKVQDDKAS-----KGNYYYMNESDIKRRKTRS
R5YI67          KTQIEDIEKIKT-QIEDVGGNIAGIVINKVQDEKSS-----KGNYYYMNEEDIKRKKRKR
A0A1Y0IQP5      AVTRDHLQQAKA-LLDRVGAQVIGAVLNGKKRKGKE-----QTYSYYASPAGDRDD----
A0A1M6E8I2      NVGVDMVKKAKK-SLEFSGVKLIGSVLNIIPTNHSK--GYNSYYYYYEESET--------
A0A1Y4N105      WSEIGAINDLCD-VLKQNDQDFIGFILNAFHRSIFSNDSYSHYGDYQRRTTSNLHK----
A0A1Y4QP75      WSEIGAINDLCD-VLKQNDQDFIGFILNAFHRSIFSNDSYSHYGDYQRRTTSNLHK----
A0A3D4QRB5      DIAREMVIRAKT-DLEKVGAKILGSVINDIPLDTLV--GYGSYYYYYGSDSDGKGKKSRN
A0A2X2LGT4      KTRRAALAKSIK-SLESGGARILGTVLNRARPDRHR-------SEYYSD-----------
A0A349DEH5      FSPYSRIRMSIE-DIDANGAEIIGCIFNADTSNVSKTGRYGKRYGHYGKSGR--YGYGSY
A0A3D4T7B4      FSPYSRIRMSIE-DIDANGAEIIGCIFNADTSNVSKTGRYGKRYGHYGKSGR--YGYGSY
A0A350XYC7      FAPYSRIRMSIE-DIDSNGAEIIGCVFNADTSNVSNSSRYGRHYGKKGT-----YGYGGY
R6DNR8          FAPYSRIRMSIE-DIDSNGAEIIGCIFNADTSNLSKSSRYGRRYGHYGKSGRYGYGYGSY
A0A355KUM5      FSPYSRIRMSIE-DIDSNGAEIIGCIFNADTSNLSKTSRYGRRYG---------------
R5YGY6          FSPYSRIRMSIE-DIDSNGAEIIGCIFNADTSNLSKTSRYGRRYGGYGK--RYGYGSYGY
A0A0K8J554      GTTYPNIDSALN-KYELIDGKLLGFVINGITFKQGEKSKS---KYYYNVNQDD-------
A0A2S4GG02      MTKFDREEKVVR-KLEALDANIGGFIYNGISAKSPD--------YEYRHYNNEYEKKK--
A0A3N1XSX6      VTSHPNVSNALE-KFRLSQGNILGFVINGVSINQTKKSKY--YYYQYGDSND--------
A0A1C6G0U3      EVDRNSVKQCKE-KLNNLNANILGCIVNKENIKKGN--------YYY-------------
A0A3D4LLB3      KTEKELAKKAVN-SLKQVDANIIGAVFNNIPVSKQN------NYYYYKSYC---------
A0A0A5GPA9      KTNTEQVSKSLQ-RLNKVKATIFGVVLNRGVKETNA-------HYYY-------------
A0A271M6M4      KTKVDQTVKSIQ-KLKKVEANILGVVLNSGKESKRT-------SYYY-------------
A0A1V5LU59      QTRIDIAKRAKK-ALESVNSNIIGAILTKLNTGRGS-------YYSYKYK----------
A0A1E3BVC3      QTRIEMAKRATK-SLESVKARFVGAVLTKLDTERTG-------YYSYKYE----------
A3DF66          QTRIEMAKRAFK-SLESVKARFIGAVLTKLDTERTG------YYYSYKYE----------
W4V1T8          QTRIEMAKRAYK-SLESVKAQFVGAVLTKLDTERTG-------YYSYKYD----------
A0A2V3W8U6      TTKVTHIQQGLG-QLTNVNATILGAIINKKKERKNDI-----NYYHYGTR----------
W1UFG0          ESEIDYIKDSIK-GLQGI--KIIGCILNKFDAKSVSYYNYSNYSYYYGE-----------
A0A351SRI8      ETSKTLLKTVKK-DLENVGANILGIVLNRTDTNKSK---Y--YGHYYQ------------
A0A1I0RG99      VTSHPCVSSVIT-KFQFLNANILGFVLNGISLNQQERSKY--RYYN--------------
A0A1I5G322      VTSHSDITNFLS-KCKYMEIKVLGFILNGISLNQEKKSKY--HYYYYNNYND--------
A0A1C6ITD7      YTTKSALINTKE-ILDGLNTNVIGVLLNNSPINSSS-------NYYYKE-----------
A0A381IX63      EVDDNVIKLSKD-RLVKVNANIIGCILNKFDYKNHNEYEY--YGYYYSAEGNKRKKRKNK
A0A1G9IUT4      EVNIDDVKVAKK-KLQQVNANILGSIFNKSSLYKSE--CY--YGYYYENE----------
A0A1M6RWV2      QTTIELAQKAKD-MLDKVQAKVIGVLVNKVNIEKRR--YQ--YYYYYLED----------
A0A3R9WAA7      YSRVRQIQQGMEHIVESSRAEIIGCVLNNVRHMPAGYGYGYGYYGKYGRKSYYGKNTGIA
R5EFZ0          AAAAPALNNAVA-SLDGHKAKVLGCVLNNVYATQLSTGQSYGGYSKYSHYGHYGNYGSSG
A0A0H5SF45      STTYPHVETALN-KYELIGGNILGFVLNGSALT---QENKSKSSYYYYQRNND-------
A0A1M6JRJ5      KTTYSDIDNALM-KYHYAKANILGFVLNGISEK---ELGGHKSKYYYSTKKNKNNGIVH-
A0A1M7Y1S2      KTTYTDIDNALM-KYRYARANILGVVLNGISER---DLGGYKSKYYYYNPDNK-------
A0A143XN92      TMLAADLNEVAD-TLNEAGSRVIGGIFNNAYSNILERIGMEQYGRKTSY-----------
A0A3D5R4X5      MVDYQIAKRAVE-LLKNANANILGSVLNKIPMG------RGGYSYYKYYSSYYGEYEKTS
A0A3E4LL92      EVHAVAVNDAVD-LLEENGVTVIGGVLNMTKGERNISKDRESYGKYYNENAK-KNAGE--
A0A415D1L1      EVHAVAVNDTVD-LLEENGVTVIGGVLNMTKGERDTSKDRYGYSKYYKENAKIENAGE--
A0A414P2K5      EVHAVAVNDTVD-LLEENGVTVIGGVLNMTKGERDTSKDRDGYRKYYNENAKIENAGE--
V8C417          EVHAVAVNDTVD-LLEENGVTVIGGVLNMTKGERDTSKDRDGYRKYYNENAKIENAGE--
W6RXP9          ETKKEATENAIN-LLNKVNANVIGGILNGAED-------RKNKTYYYYGE----------
W6S4G8          DTRINVIQDALN-LLNKVRGKILGVVLNATEDG------RLSKMYQYYGEEHKKKGDKVS
R5B467          ASSRVSVINSLA-ALDALGVPVLGYTLNACAGR---SHGGYGYGFGYGYGG------YGY
A0A143WVN6      WSEIGAINDFSD-LLKQNDKEFMGFVLNAFHENILIEKSYGQYPYQNYQSRSVRKAEE--
A0A3B8KKL6      GTRIDMAKRACK-ALEGVNANMIGAVLTKIDFR---KTSYYGYSYSYQYD----------
A0A2K9E6R0      GTRIDMAKRACK-ALEGVNANMIGAVLTKIDFR---KTSYYGYSYSYQYD----------
A0A2S8RBI0      GTRIDMAKRACK-ALEGVNANMIGAVLTKIDFR---KTSYYGYSYSYQYD----------
A0A0L6JLG6      QTRIDMAKRAKK-ALTAINANIIGIVMTKIDSR---SAYYHYYKYE--------------
G8LSN0          QTRIDMAKRAKK-ALESVGSNILGTVLTKLDIG---RARYYSYNYEYK------------
A0A1Q6REE0      YASRDQILDGAQ-RLSDSRLPIIGCALNNVRRG---LSGSKEYGYGYGYGYG-----YGY
R5ETF9          YASRDQILDGAQ-RLSDSRLPIIGCALNNVRKS---LSGSKEYGYGYGYGYG-----YGY
A0A0X9GDD0      RTRKDHLEAAVE-NLAAVDAHLLGVVMNGV-AR---SQRGGGYSYGYGYESTYHKSHEKY
U2A8X2          TVHRNQLETALS-ALGTVGVRPLGIVVNRVPVK---GPGAGPYEYGY----------YEY
U2AC50          KTRISRLRQTVD-KFERGEADVIGIVLNDVKPR---GRSA------Y----------YVN
A0A1I4C3N6      VTKFEREEMIIR-NIEELKGDICGFIYNGISTK--------SEDYNYKKAAEKYGFVDTS
A0A3B9CIM7      VTKFDREQMVVQ-MLEPVGANICGFVFNGISMK--------SQDYHYK--HYAKDYKY--
A0A1G9WHW8      HTKFDKEENVIR-TIEPLGADICGFIYNGIAVN--------SREYKYNTKKYGKEYGYGL
A0A1H5VAA0      HTKFDKEENVIR-TIEPLGADICGFIYNGIAVN--------SREYKYNTKKYGKEYGYGL
A0A3R6VK11      VSHMSREKSAVT-LLEQVDADICGILFNGLPPK--------SKDCNYRLQQYWQEYKQQN
A0A3R6QUY7      VSHMSREKAAVT-LLEQVDADICGILFNGLPPK--------SKDCNYRLQQYWQEYKQQN
A0A373K3P9      VSHMSREKSAVT-LLEQVDADICGILFNGLPPK--------SKDCNYRLQQYWQEYKQQN
A0A3R6JRU5      VSHMSREKSAVT-LLEQVDADICGILFNGLPPK--------SKDCNYRLQQYWQEYKQQN
A0A1C5MS04      VSHMSREKSAVT-LLEQVDADICGILFNGLPPK--------SKDCNYRLQQYWQEYKQQN
A0A3C1J150      VSHMSREKSAVT-LLEQVDADICGILFNGLPPK--------SKDCNYRLQQYWQEYKQQN
A0A416CXD7      VSHMSREKSAVT-LLEQVDADICGILFNGLPPK--------SKDCNYRLQQYWQEYKQQN
R6XBL9          VSHMSREKSAVT-LLEQVDADICGILFNGLPPK--------SKDCNYRLQQYWQEYKQQN
A0A355W5Z7      VSHMSREKAAVT-LLEQVDADICGILFNGLPPK--------SKDCNYRLQQYWQEYKQQN
A0A143ZUX1      FTPASTIRHTLE-DLDSEETPVIGCVFNGVARPNRLL-----------------------
A0A143XPI5      YARVNQILRGSE-SLADTGISMIGYVLNAVESGIMSYGY------------------YAY
A0A355G1X5      FSDVSRIRSVIS-DLESYKAELIGCVYNNTANRDG-----LLGLYSKSSYGYKSYHSYGY
A0A0M6WXE3      VTLAEDINEMMD-DFRDNHTKVLGVVLNGVMTFQSIA-----------DSPVGDHYSRYS
A0A348SAK2      VTLAEDINEMMD-DFRDNHTKVLGVVLNGVMTFQSIA-----------DSPVGDHYSRYS
A0A1W1Z4C3      FSDHREIRRALI-SAEMTGLEVLGFVFYGENIHQGRYYSKRSQRGYQY------------
A0A239QN83      FSDHREIRRALV-SCEMTGLEVLGFVFYGEKLHQGKYYSKRSQRGYEY------------
A0A1G9H5B9      FTTHQDLRKALN-AAEMTDMNVLGFVFYGEHMHESGY--------------------YSR
A0A1G6BLF1      YARVDRIYEGIE-NLAETGVDIMGCLLNGAEVGLTGTGYSKSYSYARYGYGHGEKR-YGY
A0A1Y4H8L0      YMLAEDINDVLD-HFREVGCHVVGVVLNRVQS------FENLTAQTVGRYAGRYGYGYGY
R6HZX3          SFARNQVADAMH-SVSGRGAELTGYVINGRPTRRGRG--------------------YGY
A0A1W2CEA6      RTHGKALKEAVR-LLRRTGTPVLGCILNKTAVSRIGK--------------SGYSYYYGG
R7FFK6          TTTYAETEDAVK-QLELANCNVLGFVLNEVVHKHSAG--------------------YYS
A0A373MPB9      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A373L519      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A373W906      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YG-
A0A373VCW2      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
W0U604          RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A374B6G0      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A373VM36      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A1C5P379      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YRY
A0A373XXX0      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YG-
A0A356CW82      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISTKNGSH--------------------YGY
R6T4X7          RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A374HTV1      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A374GB66      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A374ECC6      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A374BM61      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A373UGZ4      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A373SA66      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A1C5X6X7      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A1C6JIH3      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A373PSC3      RTTYQEIEESMK-KLEIGDCNLLGFVLNDISAKNGSH--------------------YGY
A0A1K1WYK8      MTTYEELANCMK-QIELAKVNMLGFVLNDVHHNHGAN--------------------YYN
A0A1H6IUB1      VTTNEDAEDAIK-KIEFAKMNMLGFIMNDIKMKKSGY--------------------YSS
A0A1M7L1F9      VTTNEDVDAAIK-KVEFAQMNMLGFIMNDVKIKKAGY--------------------Y-S
A0A1C6B4L6      RTTTEDIEAVVK-KMEFSKVNMLGFILNSIKNKRSGR--------------------YYS
A0A1Q6T9P4      RTTTEDIEAVVK-KMDFSKVNMLGFILNGIKNKRSGR--------------------YYS
A0A315Y4F9      RTTDEDVDNVFK-RVELANMNLLGFILNGVKSKHAG---------------------YYS
A0A354K620      KTTDEDVENVFK-RIELAKMNLLGFIMNGINTKRAG---------------------YYA
A0A355G3J9      YSDAEETKQAVL-SLEQIGAKIFGFVVIGVDFKVEQYGRYKRYGKYGYR-----SYRYSK
A0A3D2AD87      YTPHYSIKKVLG-DMDFANINILGAVMNGSHPKNK-----NKYIYRKYSYGY-----YGS
A0A2T5IYJ6      TTAQNAARTGVN-RLRAAKAPLIGVILNKVNMKRAAQYYGT----------------YSS
A0A252F281      TSAVPDLNESIM-ILNESKSRLLGCVYNDK--------HTSPLSRLPIYGKYADYYGYRG
A0A348SAK1      YAKMRQIRMGVE-NLSMSGIHMLGYVLNRDRSTGGG---------YGYGYGYYGRYRYG-
A0A0M6WYQ8      YAKMRQIRMGVE-NISMSGIHMLGYVLNRDRSTGGG---------YGYGYGYYGRYRYG-
A0A173TM61      YAKMRQIRMGVE-NISMSGIHMLGYVLNRDRSTGGG---------YGYGYGYYGRYRYG-
A0A1Y4QKE6      FLPYQKIQNGLS-ILKE-DCCFMGYVFNIYTKKSSEYGHHS-------------------
B1C231          FLPYQKIQNGLS-ILKE-DCCFMGYVFNIYTKKSSEYGHYS-------------------
A0A1Y3TUL5      YSNMNTIRDSLE-RLDKSGINPLGCIVNRVKTLGDKL---------------------NN
A0A1Y4JAX2      YSNMNTIRDSLE-RLDKSGINPLGCIVNRVKTLGDKL---------------------NN
A0A1Y4T590      YSNMNTIRDSLE-RLDKSGINPLGCIVNRVKTLGDKL--------------------NNN
A0A3C0QME1      QTTFEELQDAIN-HANLSELNVIGFVVNNISRKGSGH-YYSYKYKYKYRY-KSYEYHYVS
A0A355FYK5      HAKIADINETLE-EIAGTNIDIAGAVFTMNDEESRGRILNKGGSGSRY---YKRYYRYGG
A0A357AQU0      GTTSYDIKHALE-GAKLSNVNVLGVILNAVAGSSTGYGYKKYGYKYGYKYGYKYGYRYGY
A0A3C1YJQ7      GTTSYDIKHALE-GAKLSNVNVLGVILNAVAGSSTGYGYKKYGYKYGYKYGYKYGYRYGY
A0A3D0JG38      GTTSYDIKHALE-GAKLSNVNVLGVILNAVAGSSTGYGYKKYGYKYGYKYGYKYGYRYGY
A0A3C0IHX1      VTTTKELETALQ-AISVTGATVLGLVLTEVDFKQGGY-YKKYYKKGSY-------YTYGN
R5V506          VTTTKELETALQ-AISVTGATVLGLVLTEVDFKQGGY-YKKYYKKGSY-------YTYGN
A0A352TIU5      VTTTKELETALQ-AISVTGATVLGLVLTEVDFKQGGY-YKKYYKKGSY-------YTYGN
A0A3E5FSY5      FLPYQKIQNGLS-ILKE-DCCFMGYVFNIYTKKSSE---------------------YG-
A0A1Y3T163      FIPQRRIWEGLS-FLGGRSARILGYVFNSYPESVS-------------EYGYGR-YGYG-
A0A1Y3YCA2      FIPQRRIWEGLS-FLGGRSARILGYVFNSYPESVS-------------EYGYGR-YGYG-
A0A1Y4L6N9      FVQRRRVLDGLA-ELDGVHTRLLGYVFNGIKVGHS-------------GYGYGYGYGYGY
A0A173T644      FVQKRRILESLA-GLESSGTTILGYAFNGVPLHKG-------------RYGY---YGYG-
A0A1C5TSB8      FVQKRRILESLA-GLESSGTTILGYAFNGVPLHKG-------------RYGY---YGYG-
C0CIK6          FVQKRRILESLA-GLESSGTTILGYAFNGVPLHKG-------------RYGY---YGYG-
A0A1Y3WEF6      QVQKRRILDSIS-GLEDSSAPLLGYVFNGVPVHRG-------------GYGY---YGYG-
A0A417T0L2      QVQKRRILDSIS-GLEDSKAPLLGYVFNGVPVHRG-------------GYGY---YGYG-
A0A1H9EPU3      DISYKLVERAKE-QLETSGSRILGVALNKV----------PMDKGKGYYGKYYGGY-YGG
A0A354IGV3      RSLAQEINTAAD-TLESGHSELLGCILNDVY-GMPF--PLSLLDNDSYSYGYGDLHNYGR
A0A417JMV2      TALVKDINETIG-ILNSAEGTMLGCVYNDVFHGVA-----QTARNYGYKYAYGSGYGYGS
A0A415VWX5      TALVKDINETIS-ILNSAEGTMLGCVYNDVFHGVA-----QTARNYGYKYAYGSGYGYGN
A0A173UY96      TALVKDINETIG-ILNSAEGTMLGCVYNDVFHGVA-----QTARNYGYKYAYGSGYGYGS
A0A173QTL1      TALVKDINETIG-ILNSAEGTMLGCVYNDVFHGVA-----QTARNYGYKYAYGSGYGYGS
B0P408          TALVKDINETIS-ILNSAEGTMLGCVYNDVFHGVA-----QTARNYGYKYAYGSGYGYGN
D4MV82          TALVKDINETIS-ILNSAEGTMLGCVYNDVFHGVA-----QTARNYGYKYAYGSGYGYGN
A0A174A3T7      TALVKDINETIS-ILNSAEGTMLGCVYNDVFHGVA-----QTARNYGYKYAYGSGYGYGN
A0A1Q6K0H6      TALVKDINETIS-ILNSAEGTMLGCVYNDVFHGVA-----QTARNYGYKYAYGSGYGYGS
A0A174J359      TALVKDINETIS-ILNSAEGTMLGCVYNDVFHGVA-----QTARNYGYKYAYGSGYGYGS
A0A417UUA3      TALVKDINETIS-ILNSAEGTMLGCVYNDVFHGVA-----QTARNYGYKYAYGSGYGYGS
A0A1C6EUV9      TALVKDINEAIS-VLNSGDGTMLGCVYNDVFHGIA-----QTARNYGYRYAYGSGSSYGY
A0A173Y645      TALVKDINEAIS-ILNSGEGTMLGCVYNDVFHGIA-----QTARNYGYRYAYGSGSSYGY
A0A374AVY6      TALVKDINEAIS-ILNSGEGTMLGCVYNDVFHGIA-----QTARNYGYRYAYGSGSSYGY
R7BXS4          TALVKDINEAIS-ILNSGEGTMLGCVYNDVFHGIA-----QTARNYGYRYAYGSGSSYGY
A0A1V5S3C0      KTSLREIEYAVS-DLSTTKAEVFGCIYNNA--------RRGILSMAGDTRGGYFSRSYS-
A0A1Y3TC98      ELPLQKIQEGLS-FLGSQRTPFTGYVFNNFPEGPGEY-GYSRYGYGRYGYG---KYGYG-
R6VAT5          YAKVSKILDSIS-LFGYSKIKILGCIFNMASGVLST--RGYGRYGYNSYGGYGSYGSYG-
A0A1Q6S448      TVPAPEINDAID-ALRAGKAEFLGCILNDM----------AHLTAYSAGYGYGCGY-YG-
A0A351MYR0      TVPAPEINDAID-ALRAGKAEFLGCILNDM----------SHLTAYSAGYGYGYGY-YG-
R6HPC1          TVPAPEINDAID-ALRAGKAEFLGCILNDM----------AHLTAYSAGYGYGYGY-YG-
A0A3D4G5Z5      TVPAPEINDAID-ALRAGKAEFLGCILNDM----------VHLTAYSAGYGYGYGY-YG-
A0A3D5ES03      TVPAPEINDAID-ALRAGKAEFLGCILNDM----------AHLTAYSAGYGYGYGY-YG-
A0A0F2P7X6      CAKVDVINSAQA-AFENAGVRIIGCILNGIKYNQLG--AFYQSQNYERFLG---DYYKD-
A0A359B487      CAKVDVINSAQA-AFENAGVRIIGCILNGIKYNQLG--AFYQSRNYERFLG---DYYKN-
A0A348P5V4      YASARRIKRAVD-NFENSGTEIIGCIFNNSENGMSN--------SKIYGRK------YG-
A0A356PT74      MVASRRIKRAVE-NLENSGTKLVGCIYNDTESGMPK--RFMSSYNKKYGYG------YG-
A0A3D5LL19      MVASRRIKRAVE-NLENSGTKLVGCIYNDTESGMPK--RFMSSYNKKYGYG------YG-
R5MNF0          MVASRRIKRAVE-NLENSGTKLVGCIYNDTESGMPN--RFMSSYNKKYGYG------YG-
A0A1Q9JSI0      TALVKDINEAIA-ILKSGEGTMLGCVYN-------D--VFPGFAETAKAYGYKYGYGYG-
A0A3D5TNI1      RFPVPAILEAVS-DLTQGGTDLAGCVYNISTDRSRG--GYGSYSVSRRRYGYGYGRHYG-
A0A358LJD0      VFPVPAILEAVS-DLTQGGSDLAGCVYNISTDRSKG--GYGNYSISRRRYG------YG-
R6I3L7          VFPVPAILEAVS-DLTQGGTDLAGCVYNISTDRSKG--GYGNYSISRRGYG------YG-
A0A3D1HXX0      VFPVPAILEAVS-DLTQGGTDLAGCVYNISTDRSKG--GYGNYSISRRRYG------YG-
A0A3D2QJB8      VFPVPAILEAVS-DLTQGGTDLAGCVYNISTDRSKG--GYGNYSISSRRYG------YG-
D4LC36          FTTYPELDDAVN-RLALANCNVLGFAVNEV--SSKH--GSGYYSNYKYKYK------YK-
R7MQJ4          RTTFDDLDNAMK-KIELADVKMLGFILNDISKKHGS--YSKYGYNYKSHYY------DS-
A0A1V5GLC0      KTTVDDMDSAMK-KIEFANMNLLGFILNGI--KIKK--NGKYYSNYK--YR------SV-
W7V182          KTTTDDIDNAMK-KIEFAKMNMLGFILNDI--KTGR--SGKYYSKYR--YD------KG-
                                       *                                    

S3FFL2          ------------------------------------------------------------
A0A0T8KPS6      ------------------------------------------------------------
A0A0T8LA03      ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A1G6BLB6      SEREGE------------------------------------------------------
B5CSZ7          ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      TKAIVN------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A173ZYY6      KGM---------------------------------------------------------
A0A3D0F0Y4      KGM---------------------------------------------------------
A0A174ASH7      KGM---------------------------------------------------------
A0A173SMI2      KGM---------------------------------------------------------
A0A174GP12      KGM---------------------------------------------------------
A6BH65          KGM---------------------------------------------------------
R7G0D7          KGM---------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      KAAK--------------------------------------------------------
R6UHV6          TAE---------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      RLKQKS------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      TGRSGE------------------------------------------------------
A0A1Y3T1N0      -GNYGK------------------------------------------------------
A0A1Y3Y8U8      -GDYGK------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      RKKRNN------------------------------------------------------
A0A1V4IQ10      LG----------------------------------------------------------
A0A1S8TRD2      LG----------------------------------------------------------
G7M1U2          LG----------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      RR----------------------------------------------------------
R5YI67          SEHH--------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      KKRRAQ------------------------------------------------------
A0A2X2LGT4      ------------------------------------------------------------
A0A349DEH5      GYGYGQ------------------------------------------------------
A0A3D4T7B4      GYGYGQ------------------------------------------------------
A0A350XYC7      G-GYGQ------------------------------------------------------
R6DNR8          GYGYGQ------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          GYGQSS------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A2S4GG02      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A3R9WAA7      ANQVD-------------------------------------------------------
R5EFZ0          SRK---------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A3D5R4X5      RKKRKK------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
R5B467          GYGYGG------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Q6REE0      GYGYGS------------------------------------------------------
R5ETF9          GYGYGS------------------------------------------------------
A0A0X9GDD0      LSSVGS------------------------------------------------------
U2A8X2          TADAAA------------------------------------------------------
U2AC50          DSRVGV------------------------------------------------------
A0A1I4C3N6      AKVVSA------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      KYSASK------------------------------------------------------
A0A1H5VAA0      KYSASK------------------------------------------------------
A0A3R6VK11      GEAV--------------------------------------------------------
A0A3R6QUY7      GEAV--------------------------------------------------------
A0A373K3P9      GEAV--------------------------------------------------------
A0A3R6JRU5      GEAV--------------------------------------------------------
A0A1C5MS04      GEAV--------------------------------------------------------
A0A3C1J150      GEAV--------------------------------------------------------
A0A416CXD7      GEAV--------------------------------------------------------
R6XBL9          GEAV--------------------------------------------------------
A0A355W5Z7      GEAV--------------------------------------------------------
A0A143ZUX1      GYGRYS------------------------------------------------------
A0A143XPI5      RYGYYH------------------------------------------------------
A0A355G1X5      GYG-FE------------------------------------------------------
A0A0M6WXE3      RYGRYG------------------------------------------------------
A0A348SAK2      RYGRYG------------------------------------------------------
A0A1W1Z4C3      -YNKYD------------------------------------------------------
A0A239QN83      -YNKYD------------------------------------------------------
A0A1G9H5B9      KYY---------------------------------------------------------
A0A1G6BLF1      GYGGYG------------------------------------------------------
A0A1Y4H8L0      GYGAYA------------------------------------------------------
R6HZX3          GYDRYG------------------------------------------------------
A0A1W2CEA6      KNG-YG------------------------------------------------------
R7FFK6          NYK-YK------------------------------------------------------
A0A373MPB9      KYS-YK------------------------------------------------------
A0A373L519      KYS-YK------------------------------------------------------
A0A373W906      ----YK------------------------------------------------------
A0A373VCW2      KYS-YK------------------------------------------------------
W0U604          KYS-YK------------------------------------------------------
A0A374B6G0      KYS-YK------------------------------------------------------
A0A373VM36      KYS-YK------------------------------------------------------
A0A1C5P379      KYS-YK------------------------------------------------------
A0A373XXX0      ----YK------------------------------------------------------
A0A356CW82      KYN-YK------------------------------------------------------
R6T4X7          KYS-YK------------------------------------------------------
A0A374HTV1      KYS-YK------------------------------------------------------
A0A374GB66      KYS-YK------------------------------------------------------
A0A374ECC6      KYS-YK------------------------------------------------------
A0A374BM61      KYS-YK------------------------------------------------------
A0A373UGZ4      KYS-YK------------------------------------------------------
A0A373SA66      KYS-YK------------------------------------------------------
A0A1C5X6X7      KYS-YK------------------------------------------------------
A0A1C6JIH3      KYS-YK------------------------------------------------------
A0A373PSC3      KYN-YK------------------------------------------------------
A0A1K1WYK8      Y----K------------------------------------------------------
A0A1H6IUB1      KYK-GK------------------------------------------------------
A0A1M7L1F9      KYK-NK------------------------------------------------------
A0A1C6B4L6      KY---K------------------------------------------------------
A0A1Q6T9P4      KY---K------------------------------------------------------
A0A315Y4F9      K-----------------------------------------------------------
A0A354K620      KG---K------------------------------------------------------
A0A355G3J9      EYG-YK------------------------------------------------------
A0A3D2AD87      YYK-YD------------------------------------------------------
A0A2T5IYJ6      YYA-YG------------------------------------------------------
A0A252F281      YYGNYG------------------------------------------------------
A0A348SAK1      RYGRYG------------------------------------------------------
A0A0M6WYQ8      RYGRYG------------------------------------------------------
A0A173TM61      RYGRYG------------------------------------------------------
A0A1Y4QKE6      -YG-YN------------------------------------------------------
B1C231          -YG-YN------------------------------------------------------
A0A1Y3TUL5      NYN-YE------------------------------------------------------
A0A1Y4JAX2      NYN-YE------------------------------------------------------
A0A1Y4T590      NYN-YE------------------------------------------------------
A0A3C0QME1      HSE-DSMTSTPKLSMREDAPQEVPAETKAVETTAPIEETPAEVVEESAPIEETPAEVVEE
A0A355FYK5      KYG-YG------------------------------------------------------
A0A357AQU0      GYG-NN------------------------------------------------------
A0A3C1YJQ7      GYG-NN------------------------------------------------------
A0A3D0JG38      GYG-NN------------------------------------------------------
A0A3C0IHX1      GNG-NG------------------------------------------------------
R5V506          GNG-NG------------------------------------------------------
A0A352TIU5      ENG-NG------------------------------------------------------
A0A3E5FSY5      HYS-YG------------------------------------------------------
A0A1Y3T163      RYGRYG------------------------------------------------------
A0A1Y3YCA2      RYGRYG------------------------------------------------------
A0A1Y4L6N9      NYG-YG------------------------------------------------------
A0A173T644      RYG-YG------------------------------------------------------
A0A1C5TSB8      RYG-YG------------------------------------------------------
C0CIK6          RYG-YG------------------------------------------------------
A0A1Y3WEF6      RYG-YG------------------------------------------------------
A0A417T0L2      RYG-YG------------------------------------------------------
A0A1H9EPU3      YYG-YG------------------------------------------------------
A0A354IGV3      YRK-YG------------------------------------------------------
A0A417JMV2      KYG-YG------------------------------------------------------
A0A415VWX5      KYG-YG------------------------------------------------------
A0A173UY96      KYG-YG------------------------------------------------------
A0A173QTL1      KYG-YG------------------------------------------------------
B0P408          KYG-YG------------------------------------------------------
D4MV82          KYG-YG------------------------------------------------------
A0A174A3T7      KYG-YG------------------------------------------------------
A0A1Q6K0H6      KYG-YG------------------------------------------------------
A0A174J359      KYG-YG------------------------------------------------------
A0A417UUA3      KYG-YG------------------------------------------------------
A0A1C6EUV9      GYG-YG------------------------------------------------------
A0A173Y645      GYG-YG------------------------------------------------------
A0A374AVY6      GYG-YG------------------------------------------------------
R7BXS4          GYG-YG------------------------------------------------------
A0A1V5S3C0      -YS-YS------------------------------------------------------
A0A1Y3TC98      RYG-YG------------------------------------------------------
R6VAT5          RYG-YG------------------------------------------------------
A0A1Q6S448      -YG-YG------------------------------------------------------
A0A351MYR0      -YG-YG------------------------------------------------------
R6HPC1          -YG-YG------------------------------------------------------
A0A3D4G5Z5      -YG-YG------------------------------------------------------
A0A3D5ES03      -YG-YG------------------------------------------------------
A0A0F2P7X6      -YA-LT------------------------------------------------------
A0A359B487      -YA-LT------------------------------------------------------
A0A348P5V4      -YG-YG------------------------------------------------------
A0A356PT74      -YG-YG------------------------------------------------------
A0A3D5LL19      -YG-YG------------------------------------------------------
R5MNF0          -YG-YG------------------------------------------------------
A0A1Q9JSI0      -YG-YG------------------------------------------------------
A0A3D5TNI1      -YG-YG------------------------------------------------------
A0A358LJD0      -YS-YG------------------------------------------------------
R6I3L7          -YG-YG------------------------------------------------------
A0A3D1HXX0      -YG-YG------------------------------------------------------
A0A3D2QJB8      -YG-YG------------------------------------------------------
D4LC36          -YD-YQ------------------------------------------------------
R7MQJ4          -YG-YG------------------------------------------------------
A0A1V5GLC0      -YG-YG------------------------------------------------------
W7V182          -YG-YG------------------------------------------------------
                                                                            

S3FFL2          ------------------------------------------------------------
A0A0T8KPS6      ------------------------------------------------------------
A0A0T8LA03      ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
B5CSZ7          ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A3D0F0Y4      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174GP12      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A2X2LGT4      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A2S4GG02      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
A0A0X9GDD0      ------------------------------------------------------------
U2A8X2          ------------------------------------------------------------
U2AC50          ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A173TM61      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
A0A3C0QME1      SAPIEETPAEVVEESAPIEETPAEVVEESAPIEETPAELLEAENLLEEIPLQDAEEAPVK
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A1Q6K0H6      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

S3FFL2          ------------------------------------------------------------
A0A0T8KPS6      ------------------------------------------------------------
A0A0T8LA03      ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
B5CSZ7          ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A3D0F0Y4      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174GP12      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A2X2LGT4      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A2S4GG02      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
A0A0X9GDD0      ------------------------------------------------------------
U2A8X2          ------------------------------------------------------------
U2AC50          ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143ZUX1      ------------------------SYYYDYRESDSSQSQSSKKKQRITRNG---------
A0A143XPI5      ---------------KGYRYYSINNKDMELHNKSTSQEK---------------------
A0A355G1X5      ------------------------------DDEESAGNEE--------------------
A0A0M6WXE3      ----------------------------RYGKYTNNKEV---------------------
A0A348SAK2      ----------------------------RYGKYANNKEV---------------------
A0A1W1Z4C3      ----------TRIQASSQKLSQNDNRNQETRNNRRGNKE---------------------
A0A239QN83      ----------TRSRVIG-----------DPDNPKKKQKQ---------------------
A0A1G9H5B9      ----------RKYYKNYYSKRTTRGSTLGSNLETARGSTLQTNQGSTQGSNLETTRGSTH
A0A1G6BLF1      ---------------------------IKEDEEKKSENNK--------------------
A0A1Y4H8L0      --------------------------QYANDRGEQQ------------------------
R6HZX3          ------------------YGKYGYGTKYGYGKNGSRKQDNAHRSSGDLGRG---------
A0A1W2CEA6      ------------------------KQETKAGRHPVRIKKGN-------------------
R7FFK6          ----------YKY-----------KYDYQYRTEPSETESTETVAAEAEADAKHIEGEKQA
A0A373MPB9      ----------YKY-----------DYSYKYGGKDTSAES---------------------
A0A373L519      ----------YKY-----------DYSYKYGGKDTSAES---------------------
A0A373W906      ----------YKY-----------DYSYKYGGKDTSAES---------------------
A0A373VCW2      ----------YKY-----------DYSYKYGGKDASAES---------------------
W0U604          ----------YKY-----------DYSYKYGGKDASAES---------------------
A0A374B6G0      ----------YKY-----------DYSYKYGGKDASAES---------------------
A0A373VM36      ----------YKY-----------DYSYKYGGKDASAES---------------------
A0A1C5P379      ----------YKY-----------DYSYKYGGKDTSAES---------------------
A0A373XXX0      ----------YKY-----------DYSYKYGGKDASAES---------------------
A0A356CW82      ----------YKY-----------DYSYKYGGKDTSAES---------------------
R6T4X7          ----------YKY-----------DYSYKYGGKDTSAES---------------------
A0A374HTV1      ----------YKY-----------DYSYKYGGKDTSAES---------------------
A0A374GB66      ----------YKY-----------DYSYKYGGKDTSAES---------------------
A0A374ECC6      ----------YKY-----------DYSYKYGGKDASAES---------------------
A0A374BM61      ----------YKY-----------DYSYKYGGKDASAES---------------------
A0A373UGZ4      ----------YKY-----------DYSYKYGGKDTSAES---------------------
A0A373SA66      ----------YKY-----------DYSYKYGGKDTSAES---------------------
A0A1C5X6X7      ----------YKY-----------DYSYKYGGKDTSAES---------------------
A0A1C6JIH3      ----------YKY-----------DYSYKYGGKDASAES---------------------
A0A373PSC3      ----------YKY-----------DYSYKYGGKDASAES---------------------
A0A1K1WYK8      ----------YKYKKYGYGYGSY-GYGYTYGNNPTE------------------------
A0A1H6IUB1      ----------YYYKK-GYGYGGYGGY---YGSKPET-DDDTAEEVKEETAKKETVKKESP
A0A1M7L1F9      ----------YYYKK-GYGYGGY-GY---YGSKPETSDDDTDVEEKEETVKKEAAPKKT-
A0A1C6B4L6      ----------YDYKR-G--Y----GY---YGEKTDK------------------------
A0A1Q6T9P4      ----------YDYKR-G--Y----GY---YGEKTDT------------------------
A0A315Y4F9      ------------YGK-GKYY----GY---YGAKPEL------------------------
A0A354K620      ----------YYYKK-GYGY----GY---YGEKPEP------------------------
A0A355G3J9      -----------------------KKYDRSYESYDREKAQT--------------------
A0A3D2AD87      --------------------YHKNGYNYDYTSKPESQKETGEQ-----------------
A0A2T5IYJ6      --------------------------DYVYGSSKKKD-----------------------
A0A252F281      ----------------------------KYGKSSRKREG---------------------
A0A348SAK1      ----------RYGGYRHYSRYEKQLDEPVAETGAVNQKEVFTETKET-------------
A0A0M6WYQ8      ----------RYGGYRHYSRYEKQFDEPEEETGAVNQKEVFTETKEN-------------
A0A173TM61      ----------RYGGYRHYSRYEKQLDEPVAETGAVNQKEVFTETKEN-------------
A0A1Y4QKE6      --------------------------RYGYVK-DEYKE----------------------
B1C231          --------------------------QYRYSKGGEYKE----------------------
A0A1Y3TUL5      ----------------SEGSASRRGRGSSSGKSSSRH-----------------------
A0A1Y4JAX2      ----------------SEGSASRRGRGSSSGKSSSRH-----------------------
A0A1Y4T590      ----------------SEGSASRRGRGSSSGKSSSRH-----------------------
A0A3C0QME1      SAIEEAPVALTEETAVEESSEQADIETTKVDLSKESDKKESE------------------
A0A355FYK5      ----------DGKYGYGSGGSGYGSGSGGYGYGYGSGGYG--------------------
A0A357AQU0      ----------NEKKA-------EEALAAKKEQEKATDKKS--------------------
A0A3C1YJQ7      ----------NEKKA-------EEALAAKKEQEKATDKKS--------------------
A0A3D0JG38      ----------NEKKA-------EEALAAKKEQEKATDKKS--------------------
A0A3C0IHX1      ----------SKKKSHSHSTQQSEPVSTTTDTDSDKQPVS--------------------
R5V506          ----------SKKKSHSHSTQQSEPVSTTTDTDSDKQPVS--------------------
A0A352TIU5      ----------SKKKSHSHSTQQSEPVSTTTDTDSDKQPVS--------------------
A0A3E5FSY5      ----------YN--------------QYRYSKGGEYKE----------------------
A0A1Y3T163      ----------Y-------G-------KYGYGGGSYRQPYG--------------------
A0A1Y3YCA2      ----------Y-------G-------KYGYGGGSYRQPYG--------------------
A0A1Y4L6N9      ----------YR----RDG-------EYGDEKYANREK----------------------
A0A173T644      ----------Y------YG-------KYGYGEQDEETQS---------------------
A0A1C5TSB8      ----------Y------YG-------KYGYGEQDEETQS---------------------
C0CIK6          ----------Y------YG-------KYGYGEQDEETQS---------------------
A0A1Y3WEF6      ----------YY----GYG-------SYGYGERKNRERIS--------------------
A0A417T0L2      ----------YY----GYG-------SYGYGKKQESKKKN--------------------
A0A1H9EPU3      ----------NY----SYG-----------------------------------------
A0A354IGV3      ----------KYGKYGGYGRYGGYGRYGDYGAAAQAEAEN--------------------
A0A417JMV2      ----------NHGY--GYG----YGYGYGYGYGSRTKKGN--------------------
A0A415VWX5      ----------NH----GYG----YGYGYGYGYGSRTKKGN--------------------
A0A173UY96      ----------NHGY--GYG----YGYGYGYGYGSRTKKGN--------------------
A0A173QTL1      ----------NHGY--GYG----YGYGYGYGYGSRTKKGN--------------------
B0P408          ----------NHGY--GYG----YGYGYGYGYGSRTKKGN--------------------
D4MV82          ----------NHGY--GYG----YGYGYGYGYGSRTKKGN--------------------
A0A174A3T7      ----------NHGY--GYG----YGYGYGYGYGSRTKKGN--------------------
A0A1Q6K0H6      ----------NH----GYG----YGYGYGYGYGSRTKKGN--------------------
A0A174J359      ----------NH----GYG----YGYGYGYGYGSRTKKGN--------------------
A0A417UUA3      ----------NH----GYG----YGYGYGYGYGSRTKKGN--------------------
A0A1C6EUV9      ----------SK-Y--GYGGKYGYGYGYGYGRSSRQSQKEDQKEEHQKEQYKKEDHNKEQ
A0A173Y645      ----------NK-Y--GYGGK--YGYGYGYGRSSRQSKQE------------------EQ
A0A374AVY6      ----------NK-Y--G------YGYGYGYGRSSRQSKQE------------------EQ
R7BXS4          ----------NK-Y--G------YGYGYGYGRSSRQSKQE------------------EQ
A0A1V5S3C0      ----------KS-----------YGADYGQESNTRRK-----------------------
A0A1Y3TC98      ----------KYGY---------GRYGYGSDGDETETEEQ--------------------
R6VAT5          ----------YGQ----------YGDYYGNEENSQAEEAS--------------------
A0A1Q6S448      ----------KKY----------DKYGCGHRSGQKQQ-----------------------
A0A351MYR0      ----------KKY----------DKYGYGHRSGRKQQ-----------------------
R6HPC1          ----------KKY----------DKYGYGHRSGQKQQ-----------------------
A0A3D4G5Z5      ----------KKY----------DKYGYGHRSGQKQQ-----------------------
A0A3D5ES03      ----------KKY----------DKYGYGHRSGQKQQ-----------------------
A0A0F2P7X6      ----------NKPAQEAAAASDKN------------------------------------
A0A359B487      ----------NKPAQEAAAASDKN------------------------------------
A0A348P5V4      ----------YG------------------------------------------------
A0A356PT74      ----------YGSNQK--------------------------------------------
A0A3D5LL19      ----------YGSNQK--------------------------------------------
R5MNF0          ----------YGSNQK--------------------------------------------
A0A1Q9JSI0      ----------YG--YGSYGYGGKYGYGYGKRDQKKSERSK--------------------
A0A3D5TNI1      ----------KH--YG-------YGYGYGGHAGSRDKKDK--------------------
A0A358LJD0      ----------KRYGYG-------YGYGYGGHSGSNDKNSR--------------------
R6I3L7          ----------KH--YG-------YGYGYGSHSGSHGKNSK--------------------
A0A3D1HXX0      ----------KH--YG-------YGYGYGSHSGSHGKNSK--------------------
A0A3D2QJB8      ----------KH--YG-------YGYGYGSHSGSHGKNSK--------------------
D4LC36          ----------YGSAKQAE------------------------------------------
R7MQJ4          ----------EETSEDKD----------------ESKKDK--------------------
A0A1V5GLC0      ----------NDPEQDDDDSSDSDKNNKSDSKENDKKDSK--------------------
W7V182          ----------VKYEEDSD-----EDKTETPEKSEKKTEEK--------------------
                                                                            

S3FFL2          -------------------
A0A0T8KPS6      -------------------
A0A0T8LA03      -------------------
A0A328M4V1      -------------------
A0A1G6BLB6      -------------------
B5CSZ7          -------------------
A0A1C6G8M0      -------------------
A0A416MP73      -------------------
A0A396G6S7      -------------------
A0A3E5A223      -------------------
R7D5E6          -------------------
A0A415HQH5      -------------------
A0A414W2C6      -------------------
A5ZNE7          -------------------
A0A395X821      -------------------
A0A1C5PY68      -------------------
A0A174CJF8      -------------------
A0A174R7V0      -------------------
A0A173ZYY6      -------------------
A0A3D0F0Y4      -------------------
A0A174ASH7      -------------------
A0A173SMI2      -------------------
A0A174GP12      -------------------
A6BH65          -------------------
R7G0D7          -------------------
A0A373MWV2      -------------------
A0A417CE88      -------------------
A0A416Y441      -------------------
A0A357GPJ7      -------------------
A0A396PAC1      -------------------
A0A416EYU4      -------------------
A0A416SCQ2      -------------------
A0A416TGN7      -------------------
A0A417SMF6      -------------------
A0A1Y4MW77      -------------------
R6UHV6          -------------------
A0A3R9Q621      -------------------
A0A069RC75      -------------------
A0A174F2W5      -------------------
A0A174S8E9      -------------------
A0A416ZL97      -------------------
A0A174LSK1      -------------------
A0A373GY92      -------------------
A0A373NZQ6      -------------------
A0A417I9B9      -------------------
A0A417MP97      -------------------
A0A417WQF8      -------------------
A0A373RZ83      -------------------
A0A416U6I1      -------------------
R7JQZ9          -------------------
A0A1M5UYN6      --I----------------
A0A176JBT8      -------------------
A0A1I5HIC6      -------------------
A0A1Y3TC51      --HTARGE-RG--------
A0A1Y3T1N0      --NIRRGDQRG--------
A0A1Y3Y8U8      --NIRRGDQRG--------
A6CLL4          -------------------
A0A174DL89      -------------------
A0A176U8D6      -------------------
A0A1Q6KSQ5      -------------------
A0A3D3U8B3      -------------------
A0A3E5FRL7      -------------------
A0A1Y4QK93      -------------------
B1C232          -------------------
A0A401USI6      --NEKPNPINI--------
A0A1V4IQ10      -------------------
A0A1S8TRD2      -------------------
G7M1U2          -------------------
A0A2T6KJ75      -------------------
A9KN92          -------------------
A0A352MUJ1      -------------------
R5YI67          -------------------
A0A1Y0IQP5      -------------------
A0A1M6E8I2      -------------------
A0A1Y4N105      -------------------
A0A1Y4QP75      -------------------
A0A3D4QRB5      --HSA--------------
A0A2X2LGT4      -------------------
A0A349DEH5      --SKK--------------
A0A3D4T7B4      --SKK--------------
A0A350XYC7      --SSK--------------
R6DNR8          --SKK--------------
A0A355KUM5      -------------------
R5YGY6          --SKK--------------
A0A0K8J554      -------------------
A0A2S4GG02      -------------------
A0A3N1XSX6      -------------------
A0A1C6G0U3      -------------------
A0A3D4LLB3      -------------------
A0A0A5GPA9      -------------------
A0A271M6M4      -------------------
A0A1V5LU59      -------------------
A0A1E3BVC3      -------------------
A3DF66          -------------------
W4V1T8          -------------------
A0A2V3W8U6      -------------------
W1UFG0          -------------------
A0A351SRI8      -------------------
A0A1I0RG99      -------------------
A0A1I5G322      -------------------
A0A1C6ITD7      -------------------
A0A381IX63      -------------------
A0A1G9IUT4      -------------------
A0A1M6RWV2      -------------------
A0A3R9WAA7      -------------------
R5EFZ0          -------------------
A0A0H5SF45      -------------------
A0A1M6JRJ5      -------------------
A0A1M7Y1S2      -------------------
A0A143XN92      -------------------
A0A3D5R4X5      --RSDVID-----------
A0A3E4LL92      -------------------
A0A415D1L1      -------------------
A0A414P2K5      -------------------
V8C417          -------------------
W6RXP9          -------------------
W6S4G8          -------------------
R5B467          --YGYGYGSGENRERNGAD
A0A143WVN6      -------------------
A0A3B8KKL6      -------------------
A0A2K9E6R0      -------------------
A0A2S8RBI0      -------------------
A0A0L6JLG6      -------------------
G8LSN0          -------------------
A0A1Q6REE0      --KSRQEKK----------
R5ETF9          --KSRQEKK----------
A0A0X9GDD0      --SAKKGRRSRRRARTRS-
U2A8X2          --EASQGRSARRSAVRGSR
U2AC50          --PGAFSREAGSPDVSP--
A0A1I4C3N6      --KKKVAAR----------
A0A3B9CIM7      -------------------
A0A1G9WHW8      -------------------
A0A1H5VAA0      -------------------
A0A3R6VK11      -------------------
A0A3R6QUY7      -------------------
A0A373K3P9      -------------------
A0A3R6JRU5      -------------------
A0A1C5MS04      -------------------
A0A3C1J150      -------------------
A0A416CXD7      -------------------
R6XBL9          -------------------
A0A355W5Z7      -------------------
A0A143ZUX1      -------------------
A0A143XPI5      -------------------
A0A355G1X5      -------------------
A0A0M6WXE3      -------------------
A0A348SAK2      -------------------
A0A1W1Z4C3      -------------------
A0A239QN83      -------------------
A0A1G9H5B9      INTQETENESADHRSVDK-
A0A1G6BLF1      -------------------
A0A1Y4H8L0      -------------------
R6HZX3          -------------------
A0A1W2CEA6      -------------------
R7FFK6          -------------------
A0A373MPB9      -------------------
A0A373L519      -------------------
A0A373W906      -------------------
A0A373VCW2      -------------------
W0U604          -------------------
A0A374B6G0      -------------------
A0A373VM36      -------------------
A0A1C5P379      -------------------
A0A373XXX0      -------------------
A0A356CW82      -------------------
R6T4X7          -------------------
A0A374HTV1      -------------------
A0A374GB66      -------------------
A0A374ECC6      -------------------
A0A374BM61      -------------------
A0A373UGZ4      -------------------
A0A373SA66      -------------------
A0A1C5X6X7      -------------------
A0A1C6JIH3      -------------------
A0A373PSC3      -------------------
A0A1K1WYK8      ------ETKENENAD----
A0A1H6IUB1      STKTNKNSKNKNAKKKGKK
A0A1M7L1F9      NNNSNNKSKKSNGKKKGKK
A0A1C6B4L6      ------NETKNEKK-----
A0A1Q6T9P4      ------NETKNEKK-----
A0A315Y4F9      ------DTVEAKAETQGKD
A0A354K620      ------DTEESKAETQEKN
A0A355G3J9      ---------KKRKHNKKKI
A0A3D2AD87      -------------------
A0A2T5IYJ6      -------------------
A0A252F281      -------------------
A0A348SAK1      -------------------
A0A0M6WYQ8      -------------------
A0A173TM61      -------------------
A0A1Y4QKE6      -------------------
B1C231          -------------------
A0A1Y3TUL5      -------------------
A0A1Y4JAX2      -------------------
A0A1Y4T590      -------------------
A0A3C0QME1      -------------------
A0A355FYK5      -------------------
A0A357AQU0      -------------------
A0A3C1YJQ7      -------------------
A0A3D0JG38      -------------------
A0A3C0IHX1      -------------------
R5V506          -------------------
A0A352TIU5      -------------------
A0A3E5FSY5      -------------------
A0A1Y3T163      -----QKNAYEEEEAENG-
A0A1Y3YCA2      -----QKNAY-EEEAGNG-
A0A1Y4L6N9      -------------------
A0A173T644      -------------------
A0A1C5TSB8      -------------------
C0CIK6          -------------------
A0A1Y3WEF6      -----AEEDRGRNRRAKDD
A0A417T0L2      -----DTEELQS-------
A0A1H9EPU3      -------SYENEEASKDKK
A0A354IGV3      ----VSATDKEPEVK----
A0A417JMV2      -EDKTQESKTERQVKKDHE
A0A415VWX5      -EDKTQESKTERQVKKDHE
A0A173UY96      -EDKTQESKTERQVKKDHE
A0A173QTL1      -EDKTQESKTERQVKKDHE
B0P408          -EDKTQESKTERQVKKDHE
D4MV82          -EDKTQESKTERQVKKDHE
A0A174A3T7      -EDKTQESKTERQVKKDHE
A0A1Q6K0H6      -EDKTQESKTERQVKKDHE
A0A174J359      -EDKTQESKTERQVKKDHE
A0A417UUA3      -EDKTQESKTERQVKKDHE
A0A1C6EUV9      KEQHNKDSVTERQVKKEDE
A0A173Y645      KEQHNKDSVTERQVKKEDE
A0A374AVY6      KEQHNKDSVTERQVKKEDE
R7BXS4          KEQHNKDSVTERQVKKEDE
A0A1V5S3C0      -------------------
A0A1Y3TC98      --------ED---------
R6VAT5          --------YTDSDSADED-
A0A1Q6S448      -------------------
A0A351MYR0      -------------------
R6HPC1          -------------------
A0A3D4G5Z5      -------------------
A0A3D5ES03      -------------------
A0A0F2P7X6      -------------------
A0A359B487      -------------------
A0A348P5V4      -------------------
A0A356PT74      -------------------
A0A3D5LL19      -------------------
R5MNF0          -------------------
A0A1Q9JSI0      --------LKTDKSKSDF-
A0A3D5TNI1      -------------------
A0A358LJD0      --------SK---------
R6I3L7          -------------------
A0A3D1HXX0      -------------------
A0A3D2QJB8      -------------------
D4LC36          ----------EKEKAGSAC
R7MQJ4          --------SDNKVKKEKK-
A0A1V5GLC0      --------NNKKGKKGGK-
W7V182          --------NQSKKKKGGK-
                                   

© 1998-2019