BYKdb

Dataset for cluster cd of phylum fusobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


C3WFM9      MSKRKIFFIQEDNMEATEAFRTVRTNLAFQNDKEIGRKIMVTSSIPGEGKSTLAGNYGAS
E3H7M5      MRRRKLVFFDRDKEHIAEAIRILRTNLYFTESKD-RKVVLVTSSIPKEGKSTIAANYALS
E3HB18      MTERKLYFKLDGQSPVAESLRVLRTNIHFIDEKE-KKTVVVTSAIPKEGKSFIAANYAMS
            *  **: *   .:   :*::* :***: * :.*:  . ::***:** **** :*.**. *

C3WFM9      LAIAGKKVLLIDCDIRRPRAHESFGIKVERGLESVLTENVNPKDVIIKDLIPNFDLLPTK
E3H7M5      VAISGEKVILVDCDIRRPRVVDSFGIKANYGLEEVLRGKKNLEDVILHNVERNLDLLPAT
E3HB18      EAMVGKKVLLLDCDLRRPRAHSTFGVEGRHGLSEVLMGERNVEELIVKEVEKNLDLLPTK
             *: *:**:*:***:****. .:**::   **..**  : * :::*::::  *:****:.

C3WFM9      HMRYNVTELFIGDKMKEVISSLENEYNTIILDMPPLAVASDAAILSKYVDGVVVVVAYDQ
E3H7M5      SFGENVTELFLGKKIVEILDGLKEKYNLIVLDTPPLTVATDAALLSTYADGVVYVVGYDM
E3HB18      PMEQNVTELLQSKKMESLVEEVQEKYDLVVIDTAPLMVATDAAILSKISDGVIFVNGYDM
             :  *****: ..*: .::. ::::*: :::* .** **:***:**.  ***: * .** 

C3WFM9      VAKRELEFTKEMLSNAGANIYGFVVTKVDKGGLSYG--NYGYYNNYYSYYQEYYSDSNGN
E3H7M5      VFKKELLSGKKLLEKAGANIYGVVVNKVSINGYSMG--NYGHYSSNYKYYDEYKKR----
E3HB18      VSKKELLYAKEILSSAGANIYGMVVNKIDNSGYGYGYKSHGYYNNNYRYYQDYIKEDK--
            * *.**   *::*..*******.**.*:. .* . *  .:*:*.. * **::* .     

C3WFM9      RKKHTVKKPKSKFGKFIHDIKEQYKRQFSGDLKGKK
E3H7M5      ------------------------------------
E3HB18      ------------------------------------
                                                

© 1998-2019