BYKdb

Dataset for cluster orphancd of phylum fusobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1T4LVC1      ---MELKSKRRVFFKEKANHEISESLRVIRTNLHFLDEKERGRTILVTSSTPREGKSFIA
A0A369XZZ5      ------MAERNIFFKKGQNNQMAELFRILRTNIYFMGKKK-NRVVVVTSTIPGEGKSTVA
A0A349GTC6      -----------MFFNKEQDSHLAESLRILRTNLHFMEEKK-NRIVIFTSTIPKEGKSTVS
A0A369XZK7      -MDKQISSERKMFFKGDQDSHLAESLRVLRTNIHFMEEKE-NRIVVFTSTIPREGKSTIA
A0A377GZU7      ------MSKRKIFFIQEDNMEVTEAFRTVRTNLAFQNEKDIGRKIMITSSIPGEGKSTLA
A0A414PP78      ------MSKRKIFFIQEDNMEATEAFRTVRTNLAFQNDKEIGRKIMVTSSIPGEGKSTLA
U7VC77          MEEMMDRSKRQIFFKDANNHEMNEALRVIRTNLHFLNEKEVARTVLVTSTAPKEGKSTIA
                           :**    :    * :* :***: *  .*.  * ::.**: * **** ::

A0A1T4LVC1      ANYAMSIAITGKKVLLIDCDIRRPRAHESFGKKVEKGLESILLGEKNSRDVILKEVEKNL
A0A369XZZ5      SNYAMSVAIGKEKVLLIDCDIRKPRAHSSFGIQINHGMGEVLSGEKKIDEVILKGVEKNL
A0A349GTC6      ANYAMSVAMSGEKVLIVDCDIRRPRAHSSFGIEVNKGLGEILLEKESLEDVILKDIEPNL
A0A369XZK7      ANYAMSVAISGEKVLLVDCDIRRPRAHSSFGIEITHGMGSVLLGDKKIEDVILKDIEENL
A0A377GZU7      GNYGASLAIAGKKVLLIDCDIRRPRAHESFGIKVERGLEAVLTENADPKSVILKDIIPNF
A0A414PP78      GNYGASLAIAGKKVLLIDCDIRRPRAHESFGIKVERGLESVLTENVNPKDVIIKDLIPNF
U7VC77          SNYAMSIAITGKKVLLVDCDIRRPRAHESFGVSFDKGLESVLAGECEVENVILKDVEKNL
                .**. *:*:  :***::*****.****.*** .. .*:  :*  . .  .**:* :  *:

A0A1T4LVC1      DVLPTKYIKSNVTELFLGDRMKRVIEELRDEYNTIVLDTPPLVVASDGAILSKYCDGVVF
A0A369XZZ5      DILPSKHMDQNVSELFLGDRMRNILEKLRKKYDLIVLDTPPLMVVTDALILSQYGDGVLY
A0A349GTC6      DILPSTHLNHNVTELFLGNRMKNLLLELRKRYDLIVLDTPPLVISTDAVILSEYSDGVVY
A0A369XZK7      DILPSKHLSQNVTELFLGNKMKDLLKALRGKYDLIVLDTPPLVVATDAVILSEYADGVVY
A0A377GZU7      DLLPTKHMKYNVTELFIGDKMKEVIAELENEYNTIILDMPPLAVASDAAILSKYVDGVVV
A0A414PP78      DLLPTKHMRYNVTELFIGDKMKEVISSLENEYNTIILDMPPLAVASDAAILSKYVDGVVV
U7VC77          DILPTRNVAHNVTELFLGDKMKALLKDLKGEYNTVVLDTPPLIIASDAAILSKHCDGVVY
                *:**:  :  **:***:*:.*. ::  *   *: ::** *** : :*. ***:: ***: 

A0A1T4LVC1      VVSYDQVSKSELEFSKKMLDNAGANLYGFVVNRVEKNGFSYGNYCYYNNNYTYYKDYYLD
A0A369XZZ5      VCGYDMVTKQEMNQAKKMLDSAGVTLYGVIVNRINKDGYSHGNYGYYNYKYKDYQDY---
A0A349GTC6      VCGYDMVSKKQLVQSRKILDRAKANIYGVVVNKIDKDGYSYGNYGYYNYNYKYYDEY---
A0A369XZK7      VCGYDMVSKKELLQSKDMLDRAGANIYGIVVNKIDKRGYSYGNYGYYNNNYSYYEEY---
A0A377GZU7      VVAYDQVAKRELEFTKEMLSNAGANIYGFVVTKVDKGGLSYGNYGYYNNYYSYYQEYYSD
A0A414PP78      VVAYDQVAKRELEFTKEMLSNAGANIYGFVVTKVDKGGLSYGNYGYYNNYYSYYQEYYSD
U7VC77          VVAYDQVAKRELEFGKTMLNNAKANIYGFVVNKVDKNGLSYGNYGYYNNNYSYYKDYYTE
                * .** *:* ::   . :*. * ..:**.:*..::* * *:*** ***  *. *.:*   

A0A1T4LVC1      EERGQSR---SKPKSKMEKYMEKLKKAYRRELSGNQKGKKY
A0A369XZZ5      -----------------------------------FNGDKQ
A0A349GTC6      -----------------------------------SKGEK-
A0A369XZK7      -----------------------------------IKGDK-
A0A377GZU7      SDGNRKKHIVKKPKSKFGRFMHAVKEQYKRQFSGDLKGKK-
A0A414PP78      SNGNRKKHTVKKPKSKFGKFIHDIKEQYKRQFSGDLKGKK-
U7VC77          EGEALAR--AYKPQKGFKGFIEKLKRDYKRQLSGDQKGKRW
                                                    :*.. 

© 1998-2019