BYKdb

Dataset for cluster tad of phylum fusobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E3H7M4      MQDNNKKEREKNEI----RKEIDMVELFMIVKQNWKVLFRTIFIMVALGFTYSYYKADTY
C3WFM8      MSRKKKY-EDYDEEFENDEDEIDLADLIFTLIRRWKLIVLTAIPVVILGVIFAITRPTVY
E3HB17      MFKKSRYEEDINTHWMEEDDEIELMDLLFILIRRWKMIIAIAVPVIIIGLTYAVLKPAMY
            *  :..   : :       .**:: :*:: : ..**::.   . :: :*. ::  ..  *

E3H7M4      KAEVILMVSGSNLISPDRLENSQVSLNQKLVSTYTEIAQSSSIMRDVVQKLDLKNSPESL
C3WFM8      QAETTLIVSNN--MSSVSLDSSDISLSQRLVITYSEIAKNKSILNKVINKYDLKETTEQL
E3HB17      KAETTLMVSSGQIYSVEKLDSSEISKNQKLVSSYTEVARSKSIMKNVIKRLGLEAEPEEI
            :**. *:**..   *   *:.*::* .*.** :*:*:*...**:..*::. .*:  .*.:

E3H7M4      ARKVEVAPVGMTELIKISYEDENPQKAALIVNHVSEEFMIKIKSVMRFDNLKIIESSRVP
C3WFM8      AKLVTITPVDSTELISLTYKNSDPQLAAMVTNEIANEFMDKVVQVMRVRNVNIVEKAQVP
E3HB17      AKLVKVTPVDETEFIKISYTDINARKATLMVNEVSKEFMLKIRDLMNFENLKIVEKAEIP
            *. * ::**. **:*.::* : :.. *:::.* :::*** *: .:*.. *::*:*.: :*

E3H7M4      VNPESKKTKLIIAISMIIGILLGIFEVMWGEYYQNKIKNPEDIERLLDCQVLANVPDYST
C3WFM8      VQPLPKKRALILLASVVLGLAAGTGMAFVMEFLHKKLRKPSEIQAILGVSMIGMIPDLEN
E3HB17      TKPESRKRVLIVAISGVLGIMLGVFGAFLVEFLHSNIRKPEDLQNIMGCKIIANVPDFEK
            .:* ..*  **:  * ::*:  *   .:  *: :.::.:*.::: ::. .::. :** ..

E3H7M4      VKLDKKSNELKKVKKR
C3WFM8      VIAEKDEDSNE-----
E3HB17      IEAEVKR---------
            :  : .          

© 1998-2019