BYKdb

Dataset for cluster orphancd of phylum gemmatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

38 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2N1WA66      ------------------------------------------------------------
A0A143BIC3      ---------------------MSGQQIQPVSPRDVALEPYQDGAPPADWGGGQEAAPEPK
A0A2V7SVD5      ------------------------------------------------------------
A0A1Q7JIY3      -----------------------MISDNLPAIRARAAPVSPRRAPPSLAAAEEETG-LDW
A0A0S7Z9Q9      -------------SDEQFALPAAPSDGPGGEIQLRDAAAAAAAPPVWDEGFYPPSDDGDG
A0A2V7GP46      ------------------------------------------------------------
A0A2V7H298      ------------------------------------------------------------
A0A2V7N2D0      --------------MATDLPVGPQGGDTVPLGHGRTRGGRGTSLGYRLPPSGDTPPEEEW
A0A2V7NMY2      ------------------------------------------------------------
A0A2V7RBS9      ------------------------------------------------------------
A0A2V7MB00      ------------------------------------------------------------
A0A2V7PL95      -----------------------MTMDNLPTRFEEPTAPAWQASGTGYAVGRAAAGESDW
A0A2V7T7Z8      ------------------------------------MAGAPRAGGA-----PPPSAEGDW
A0A2V7ILF0      MGARCAPRPSFPYRTPATMPSDQPLQPVISLGRLEPAKSAGSALPSRALQPALPPS-ADW
A0A2V7SCT4      MRGSCKTVGAV----SDLLRGQAMISDNLPAIRARAAPVSPRRAPPSLAAAEEETG-LDW
A0A2V7Q893      -----MTTGGL----ATLLDTTK---------SQRLPTVGDRKAAERRARPTPPDG-GDW
A0A2V7QPQ4      MATFDSPSSGL----PQL---SH---------PRRTAPLGPYDAAHGPAQMEPDPGVVDW
A0A2V7JCT0      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A2N1WA66      --------------------------------------------------IR--------
A0A143BIC3      GPSLGRYLAAINRFKWLIMLLGIVGAGAGYMATTFIE---PEFEVRATILLEQGTGISNG
A0A2V7SVD5      --------------------------------------VEPSYEARAKVWIM-SPKPTNG
A0A1Q7JIY3      ----RRSAIALSRFKWVVLLTVVLGTAAGVAATRFVR---PEFVAQATVWVD-VPDRRGA
A0A0S7Z9Q9      GIDFRRYLVSILRHKWLVASSLLVGVVGSVFVWSRTAV---TYTAEGNLWIE-AEARTAA
A0A2V7GP46      ------------------------------------------------------------
A0A2V7H298      ------------------------------------------------------------
A0A2V7N2D0      ----RGYFGSIKRWKRLVIIVTLAGTALGVVATKLVVPSLPFYAATANIWID-GSGHRPD
A0A2V7NMY2      ----------------MVLAVTLLGTAAGVVAAAKFVG--PRYLARARLWVG-AAEPNPN
A0A2V7RBS9      -----------------------------------MLP--PRYLVQATIWIQ-SSEARGT
A0A2V7MB00      -----------------------------------------------------DQASRSE
A0A2V7PL95      LDEIGRYLRAVRRHKWLVLGTTLLCAGAGIVLARVKLQ--PTFIARASVWIQ-VPSAHVA
A0A2V7T7Z8      LADARRYLIAIQRYRWMVFGLSALGLLVGFAFAGVVLA--PGYAARASLWIH-GPAGQEG
A0A2V7ILF0      ----RRYLVAIRRYKWIVLAGSLLGGGAGFAAGRYLGS--E-YTARATIWID-VPDPRNR
A0A2V7SCT4      ----RRSAIALSRFKWVVLLTVVLGTAAGVAATRFVRP--E-FVAQATVWVD-VPDRRGA
A0A2V7Q893      IGEAQRYLRSVRRHKWLVLSLTLFATAAGVELSMYALP--PNYAARATVWIQ-VPARQAR
A0A2V7QPQ4      ----RRVFAALLRFKWVVVLVTVLGTAGGVVLSRVIKI--P-YTTHATVWVD-VPDVRAH
A0A2V7JCT0      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A2N1WA66      ----G---PNAESMF------------------------GVPLEGPTGPDASLFDNFERT
A0A143BIC3      GQSRG---PIQADEL-LQASGWQDLLRSFAIADPVVNSLALFVTPSAAGDSTLFRSFRVS
A0A2V7SVD5      PQPTG---PIRAEEL-LPQSSWAELFQSFAITDSVVAKRGLAATPEDAKDRPAFMRFATS
A0A1Q7JIY3      ADRSG---PLRPEQL-LDAESWVDLLKSYVVLDQVAREQRLYMGLKTPQDSAVFTSFQVA
A0A0S7Z9Q9      DL--G---PNEPSGL-LQDNAWVELLESFQVLDTVAVRERLFLRVPADYEP-AFQRFSLA
A0A2V7GP46      -------------------ESWIDLLRSYAVLDRVARDLRLFLQLPKGPDP-ALRSFNVA
A0A2V7H298      ----------------------MDLLQSYAVLDDVVRGQRLYLHAKVPGDSDILATLRIK
A0A2V7N2D0      RDQ-ATPGPIHSGQL-LGASGWVNLARSYVVLDSVARGMRLYLGWDSEQDSAALASLELK
A0A2V7NMY2      ALR-GTTPPPGAERL-LGVAAWVDFVRSDAVLDTVVRDVRLYLDPKTPLDGTALLRFGLK
A0A2V7RBS9      PDR-G---PIGANQL-LAPTAWGDLLKSYVVLDAVARERRLYLQARP-RDLPALAGFAVA
A0A2V7MB00      QDR-G---PIQQGELFGSATGWLDLLRSHVVLDDVVRQWRLYLRPKSADDNAALATLTVT
A0A2V7PL95      REP-G---PIWSGQL-PISSGWEELVRTNIVLEDVVRRRRLYLDYKNAADSDLFATFDIK
A0A2V7T7Z8      -EP-G---PLWSGRL-PISAGWSDLVRTNIVLDDVVRGERLYLTNNPASDT-VLATFAIN
A0A2V7ILF0      EE--G---PLWTGQL-RISSGWTDLLETSAVLESVVRERRLYLSLDDPADSAALRSFRIK
A0A2V7SCT4      ADRSG---PLRPEQL-LDAESWVDLLKSYVVLDQVAREQRLYLGLKTPQDSAVFTSFQVA
A0A2V7Q893      DE--G---PIWSGHL-PISSGWIDLIRTNIVLEDVARRERLYLTTDA-GDAAPLTTLAIK
A0A2V7QPQ4      DE--G---PIQTAGL-VGASGWVDLLKSNAVLEDVVRRQRLYLALDSPDDTGAVKSLGVK
A0A2V7JCT0      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A2N1WA66      ETI--RSGSYLLAVNEDSRRWELT------HQGSQQKETGVVGDSVGRAFGFRWAPNLGG
A0A143BIC3      EQVPLRPGAYILKL--TGQTYTLE------TSGGLQVEQGAVGDSVGTRVGFMWQPTSQA
A0A2V7SVD5      ERP--IIGDYSLRVDAKGQRYTLT-----RKADGTVVDTGTVGDSIGRTVGFRWAPTPQM
A0A1Q7JIY3      EDY--RPGDYRLAVQGDGRGYDLA------TADGVPLERGAVGDSVGARLGFRWVPPAGA
A0A0S7Z9Q9      DEV--GFGTYVLRVSESGADFVLT------TDDGTLVQQAAFGVPIGENVGFRWNPAPGS
A0A2V7GP46      DQF--RPGAYRLTTD-AARAYVLA------KVDGGVLERGTVGDSIGRGIGFLWAPPAES
A0A2V7H298      DHV--APGKYRLVVEDTGDAPHFT---LYNARSKAPVQTGVAGDSVGPDMGLAWVPPRAV
A0A2V7N2D0      PQF--RSGEYRLQVDSSGRRFRLL------TAQGGEVQHGIAGDSIGGAVGFVWVPPASA
A0A2V7NMY2      DQV--LPGRYRLEVDRDGAGFTLF------SAQGGVVQHGERGDSVGPALGFAWVPGAAV
A0A2V7RBS9      DQF--TPGRYHLTIDHDGQTFHLQ------REDGTELEQGAVGSPVGRTLGFIWTPTTAV
A0A2V7MB00      GEI--RPGRYRLLLDREGKAF-----RLLDVAEQQVLQEGSWGDPVGGVLGVSWTPPTNA
A0A2V7PL95      QRV--RPGAYRLVVNDSGNGLTLSFKRLLFPSARNVLERPAVGDSVGVAQGFAWVPRAGA
A0A2V7T7Z8      QQV--RPGRYRLVVDNGGTAFTLR------DAAGRVLDRGAVGDSVGARLGFVWVPSPGT
A0A2V7ILF0      GQV--RPGTFAFSVAELDPTFTLS------SEDGVH-EQGSLGDSVGADLGFLWAPAPDA
A0A2V7SCT4      EDY--RPGDYRLAVQGDGRGYDLA------TADGVPLERGAVGDSVGARLGFRWVPPAGA
A0A2V7Q893      ERV--RPGTYRLAVDTTGTAFTLS------DAAGAVLDRGAVGDSIGAPLGLAWVAPAGM
A0A2V7QPQ4      ERV--QPGAYRLVVTAQGGRFLLL------DGHGVTLQQGAVGDSVGPALGLAWVPAASA
A0A2V7JCT0      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A2N1WA66      GRRGRSFRFDILTPQEVADDIRGKLRPDLERM---NARFLRLNYEGQNAERAAATLNAIV
A0A143BIC3      LAGRKDVGFNVQTPREASIALIKKLKMNLAN----GSSFLFLNLTGNDAPRTAATLNAWV
A0A2V7SVD5      LKPGRTYNFNVVTPRDASTALLAKLKPPPAV--APNSNFMNVTLVDNDAVEAAATLNTWL
A0A1Q7JIY3      LPSGRTIDFSLTTLRDAARWLGDALGVQMDP----NGNFLKVDLRGKDPRRISVILNAVT
A0A0S7Z9Q9      FPPEAVVRFRVLTARDAGQQLRDQLQTQIDR----AGNFIRLTLSGPNPEKIASILNAVM
A0A2V7GP46      LPPGHTVEFRLQTAREAALYLSDALDARMDY----NGNFLKIELRGGDPARITRILNAVA
A0A2V7H298      LAGPREVDFTLDPPYEAALGLARNLKVAADL----DGNFLRMELGGHDPAQIAATVNAVA
A0A2V7N2D0      FTPRRTIRFSVSSPYDAATNLAQRLQVELDP----DGNFLQISLRGSDPAYIAATVNAVA
A0A2V7NMY2      LTPGRRIEFTLLTPHDAAELLASQLQVTTDP----EGTFVTVQLTGTDPQLTAAIVKGVA
A0A2V7RBS9      LTPGREVRFVVSPLRDAAKKLADNLNVTLDL----SGNFLRVALTSPNGTDAAATVNAVA
A0A2V7MB00      VRPGGSVDFTLATISEAAVELSEQLRIRAGQ----EGNFVRIARRSPNPDQATGIANSVA
A0A2V7PL95      LRPRRKVEFTVAGPSDAAKALGRALKMAADP----DANFLRLELGGPDPVAVTATVNAIA
A0A2V7T7Z8      LHAGETVAFTLITPSAAAAWLTRELKVSPDP----DGNFIQLELYGPDASRTTAIVNAVA
A0A2V7ILF0      VAPGHKIVFTVAAPSDAAKLLAKALVVKSDL----DDNFIQLELRGSSPTGVAGIVNAVA
A0A2V7SCT4      LPSGRTIDFSLTTLRDAARWLGDALGVQMDP----NGNFLKVDLRGKDPRRISVILNAVT
A0A2V7Q893      LRAGDVVNFTVTTPAEAATRLRRELKVSSDV----DGNFLRIELAGPDAAAVTGTVNAVA
A0A2V7QPQ4      LRPGRTIAFALATPPSVAAGLADQLRVQTDMMEGKVGNFISFELRGTSADTITAVVNAIA
A0A2V7JCT0      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ---------------------------------------MRLELTGTSPTAIAGTLNAVL
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A2N1WA66      AQFVTQAAALKNRNLSAEAAVLDTQLTRARDRLNTAQAALESFKVSVVTLPREDV-----
A0A143BIC3      EQFVVVATALKKKNVTSVAAILEGQREFAAKSLNEAEGALESFRVRTVTEPTERQ-----
A0A2V7SVD5      TEFDSTALWLKRRNVSEYSKLLEVQRQYANDKLKDAELRLEGFRTRTITMPSEAT-----
A0A1Q7JIY3      QRYVQVAAELKRQKGTELTKALEEQLNTAHTNLQQAEAALQTVRAQTITLPSDRP-----
A0A0S7Z9Q9      DRHVTIAAELKRNKLDQTLIVLEEQLTQAEAQLQRSERSLEEFRVSTISLPTDQS-----
A0A2V7GP46      ERYVEVAAELKRGRLTELTGIIGDQVRTAKQSLDSAEGDLESFRRRTITLPPDAV-----
A0A2V7H298      ERFVAVAAGLKRDNLTELTRILGDQLAQAQANLRQAEASLKSFRVGAVTTVAAGA-----
A0A2V7N2D0      TRFVDVATDLKGKRLSELTKILATQLEHAQANLRSAESALRSFQIRTATVLPGSAIIPPE
A0A2V7NMY2      DRTVAVAADLRRHKVAALADILGEQVRHAQASLTAAELALKSFRVRAAGVLPAGV-----
A0A2V7RBS9      DRYVAVATDMKRVKVTELSRLLNEQLQAAEANLHKAERALEDFRVRTIMLPAEPV-----
A0A2V7MB00      DRFVAAAADLKRQRLTELTAILQDQLDHAQTNLRTAEAALTAFRVRNAVRPSEGP-----
A0A2V7PL95      ERFVAAAADLKRDNLVQLTGILDNQLDRAQATLRDAEAALKTFRVRAVTQFADGA-----
A0A2V7T7Z8      ARVVAVAADLKRANLTQLNAVLGGQMRRAEADLRSAEGALQRFRMQAATQLADGS-----
A0A2V7ILF0      DRFEALATELKRRKLTELTGILSEQLKQAQGKLAEAEAALKRFRVTAVTQFAEGT-----
A0A2V7SCT4      QRYVQVAAELKRQKGTELTKALEEQLNTAHTNLQQAEAALQTVRAQTITLPSDRP-----
A0A2V7Q893      TRFVATAADLKRDNLTQLTGVLAAQLEQEETKLRSAEGALQRFRVTAVTEYGDGA-----
A0A2V7QPQ4      DRFVLVATDLRREKLSALVKILGDQVQNAQLNLTRAEQRLRDFRVHSVTLLTGTP-----
A0A2V7JCT0      ------------------------------------------------------------
A0A2V7L8K7      -------------------------------LLADARQAVTAFRQRAGTYGSREA-----
A0A1G0LV28      ---------------------------------------MQAYQESQSTTD---------
A0A1Q7E008      QRYVDVAAELKRAKLTELTHILNEQLSTAARHLHDTEGALEGFRVRTITLPSEQA-----
A0A1Q7DXW6      -----------MACPRSDTRILGDQLEHARANLRDAEAAMTRFRVRTATHPTQGA-----
A0A2V7JF48      -----------QQSTRR-REFLESQLKVNDSLLADARQAVTAFRQRAGTYGSREA-----
A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A2N1WA66      --------------PVPAGLQSSTPSVFGNFIRQRNEVDSLRREQTELREALAQARSG--
A0A143BIC3      --------------TITPGIELTTNPVFDNYFRDKVLADGYQRDREALERILNAGKQGA-
A0A2V7SVD5      --------------IVTPGLQETRDPVFRSFFEKKLESSDLRQYADALARAMTAGPAA--
A0A1Q7JIY3      --------------LTSAPGPERRDPVFTNFFDMQIERDQLRRDREAIERLLADARAS--
A0A0S7Z9Q9      -------------MPIAPGLQITRDPTFGNFFDMRVRLDELQQDRRRLQAVIDDFGQR--
A0A2V7GP46      ----------------AAGGDTPRDPVLGDFFEQQVQRQQAARDRAALTRVLAQPADS--
A0A2V7H298      -------------GSVTESSQYPRDPMFAGLVDLKVNLDEVRRDRTAIERLLAPSTDPTV
A0A2V7N2D0      ALAPGANTPPQRRPPVSDLVGQSRDPVFANFLDTRVALEQLKRDRAAIERVLAQTADS--
A0A2V7NMY2      -------------AAP------PPSPAFTNAFELRVAVDQLGRDRQAIDRVLAQQPDS--
A0A2V7RBS9      -------------AGTA-----TRTSPVSEFLTRRVQEDQLRRDQDALAQLLAQGPDS--
A0A2V7MB00      -------------AQGPDGRRITADPTYASYIDLQVSLDELKRDRAAIAQLLTRSADS--
A0A2V7PL95      -------------GSVTPNLRYPQDPVFAGLLDMKVEREGLVRDREAINRLLAKPD-S--
A0A2V7T7Z8      -------------GSVTANFSAPTDPRFARLLDVKSRRTQLLRDREAINRILARSSGS--
A0A2V7ILF0      -------------AAVTPNLERTQDPGFAGLLELKVSREQVRRDRDALRRVLAQARDS--
A0A2V7SCT4      -------------LT-SAPGPERRDPVFTNFFDMQIERDQLRRDREAIERLLADARAS--
A0A2V7Q893      -------------APVTSNMRSPQDPVFAGLLEVKVRRGELLRDQAAIKRILAQPPES--
A0A2V7QPQ4      -------------APLLVPAPQGRDPAAANFFEMKVSSEELRIDRTALARVLAEGADS--
A0A2V7JCT0      ---------------------------------------QLEAERRTDESLLAALRDRDS
A0A2V7L8K7      ------------LAREQ-----------AGLAGVELQRQQLEAERRTDESLLAALRDRDS
A0A1G0LV28      -------------------LSAEEVSLVNTIQDLDREKQRILLDLQTLESSIRPGSDMTI
A0A1Q7E008      ------------TPLAPG-LEATRDPVFKNFFEMRIEREQLRRDREAIERVLAEVADAEV
A0A1Q7DXW6      ------------VPSAEGRPPAATDPAVAGYLDLQVTVAQLAHDREAIGRVLAQGADSGV
A0A2V7JF48      ------------LAREQ-----------AGLAGVELQRQQLEAERRTDESLLAALRDRDS
A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A2N1WA66      ELAIDRFLNIGAVT---RAPELT-QVLTELGEAERQRRTLLLTLMAEHDSVRAVTAKIDE
A0A143BIC3      PITREAVLSVPSVNTDPAAENLR-KVLAEQADREFNLRRLRESYTDEYQKVKDEQAALQT
A0A2V7SVD5      PEAISAIPGLLTQA---GAKDLS-ILLDELTKRQGELRDAQKVYTDEFSKVKDLQKQIAD
A0A1Q7JIY3      ALPADALSLIGSVQ---HSAELS-QALKELTDKQATLRGLQYRYQDDYAPVQRLKAEIAD
A0A0S7Z9Q9      DVRIEALELIPATA---GSSELR-RILDELVDARSELRALRDRYSDDYPPIQDLLNQIES
A0A2V7GP46      GLA-SALEVIGAVQ---HSPELK-DALQELTTKQAALRTLRYHYTEAYPPLARKAAEVAT
A0A2V7H298      EVPVDALSMVGSVQ---RSTELV-QGLRDLTSKQAELRALRAHYTDANPPVRRLASEVDE
A0A2V7N2D0      GLAVDALELVGSVE---RSSELT-DALKELVGKRADLRALRYRYTETNPEVRRVAGEIGT
A0A2V7NMY2      GLSVDALAAIDAVQ---KSPELT-QALKELTDKQAELRALRYTYTDQHFPVQQLADAVAT
A0A2V7RBS9      LGFSERLAAIGAVQ---GSADLT-RALSELTTKRADRRALLYRYTDDHPAVRRVTTDIDE
A0A2V7MB00      GVAVDRLAMIGSVQ---RSSELT-AALKELTDRQAELRALRFRYADTHPPVRRLALQVDT
A0A2V7PL95      GVAVDALAMIASVQ---KSTELS-QALRDLTAREAELRALRARYTDATPNVRRLAGEVAA
A0A2V7T7Z8      GPVVDALATIGAVA---GSTELS-RALGELTQKQAMLRTLQVRYTAESPLVRRLTGEVAT
A0A2V7ILF0      GLSVDALGMIGAVQ---RSLELS-EALKGLTAKQAELRAVRFRYTDATPAVRHLAEEVKL
A0A2V7SCT4      ALPADALSLIGSVQ---HSAELS-QALKELTDKQATLRGLQYRYQDDYAPVQRLKAEIAD
A0A2V7Q893      GLIVDALATIGSVE---RSTELS-QALRDLTAKQAVLRALQARYTAEAPVVRRVAAEVAT
A0A2V7QPQ4      GPSTDALEMIPSVQ---QSSVLT-QALGELTEKQATLRALGYRYTAGLPQVKRLAVEITQ
A0A2V7JCT0      SVSRKALQTALATPGVAASPSVM-QLSTQLYQYERARDSLASR-STSHPDLPRLNQLVSS
A0A2V7L8K7      SVSRRALQTALATPGVAASPSVT-QLSTQLYQYERARDSLASR-STSHPDLPRLNQLIGS
A0A1G0LV28      ET----LNGLAAVPGISGNPAMTFQIQALLRLYDDRRTMMAEGQRESNPQVTALDSRIQT
A0A1Q7E008      AAQGLEVIGV-----VQRSAELT-QAQRELTTKQADLRALRYRYTDEHAAVRRLAVEIET
A0A1Q7DXW6      LTDALAMITA-----VQRSAELT-EALKELTAKQAELRALRFRYADTHPPVRRLAAQVDT
A0A2V7JF48      SVSRRALQTALATPGVAASPSVT-QLSTQLYQYERARDSLASR-STSHPDLPRLNHLIGS
A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      --------------------------------------------------------AILD
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      --------------------------------------------------MRRLATDIDV
A0A2V7EK09      --------------------------------------------------MQRLAEQIAT
A0A2V7QD43      --------------------------------KQAELRALRYKYSDQYPLVQRRLSDVAT
                                                                            

A0A2N1WA66      LRIGT---LPTYVQSVLNRLAREQARLETQIQAAQRDLAGIPQRAIQ-EQEYLRELEIAD
A0A143BIC3      LRTVS---VPGALDAYLGQLQLREKALVATIDRSSKDLRNIPARTIE-EQRLKRQVEVSD
A0A2V7SVD5      LRARA---IPAAARNFLAQLRSRENSLNAQLAATSEEIRTIPTRSIE-EQRLRREQAMYE
A0A1Q7JIY3      LENRT---IPTLARTLVAQLAARETEVGRQVNATSHELRQIPPRALE-EERLRRSLTLAE
A0A0S7Z9Q9      IETTA---IPRVVLGIMRELEDQEAELSARLATAQAELQAIPPRTIE-EQRLSRQVATNT
A0A2V7GP46      LERQT---IPTLVRSLIDELGTRMAELDRRIGSASQELRRIPARSVE-EARLRRSVTIAD
A0A2V7H298      LAHRT---VPALAASLVAELRVRESELVQRVDAASSSIQKIPPLAVE-ESRLQRGVTLAE
A0A2V7N2D0      LERQT---IPALTRQLLGELRRREAELVRQVEWASADLRQLPSLAID-ELRLQRDVVDAE
A0A2V7NMY2      LDRRT---IPGMLRALRNNLAARERDLGQRVDSTVRYLSNIPPLLFE-QTRLEREVQVAG
A0A2V7RBS9      LEHQT---IPGLIRGLLAELGTQRRGLASQLETGGRELQGIPQRAIE-DARLRRDVSIAE
A0A2V7MB00      LSRRV---IPGLARTLMAGLAAREQVLAQQRDSIARDLRTAPPVALS-EIRLARDQANAE
A0A2V7PL95      LEHRT---IPAMAAALTQELAVRAGELEHLVDSAAGGLRRVPPLAVE-ETRLQREVTMAE
A0A2V7T7Z8      LEQAT---IPELAAGLARELERQAAELERQANATARDLRRIPPLAVE-QAALQRAVTSKE
A0A2V7ILF0      LERQT---IPRLATALMNELAVRESEVGRDVDSASGNLRRVSPLAVE-EAALQRDVTSAE
A0A2V7SCT4      LENRT---IPTLARTLVAQLAARETEVGRQVNATSHELRQIPPRALE-EERLRRSLTLAE
A0A2V7Q893      LERQT---IPMLATALAREMGLRAAELEHRADSVARDLRRIPPLAAE-ENRLQRDVTQSA
A0A2V7QPQ4      LERQT---IPTMVRALIAQLGAREAAVTQRIDSAAGGLRQIPPLAIE-DARLDRDVTIAA
A0A2V7JCT0      TEADL---LHAVQGGVQSAIASLEGRITAMNDLRARQ-QQLSTSEEE-EARLTERVDNAQ
A0A2V7L8K7      TEADL---LHAVQGGIQSAMTSLEGRITAMNDLRARQ-QQLSTTEEE-EARLTERVDNAQ
A0A1G0LV28      VSRALNDAAAATVRGLRQQIAALERNIAQLRE----RLSTFPGKQTQ-FAQLRLETELQN
A0A1Q7E008      LERRT---IPALTRALLSQIVTREQVLDSLVHSAGRELQQIPLRAVE-EARLRREVSIAE
A0A1Q7DXW6      LQRRI---IPQLARTLMAGMAARERDLQVRVDSVSRDLRRAPPVDLE-GVRLERDELNAS
A0A2V7JF48      TEADL---LHAVQGGIQSAMASLEGRITAMNDLRARQ-QQLSTTEEE-EARLTERVDNAQ
A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------QRAVE-EARLRREVTIAE
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ADKEG---YLRSARALIQTLTGRTRSLTDAIAQTADSLRAIPPRATE-EARLMRRVALAT
A0A2V7HL73      -MRDR---VSAIT------LTSDGETLGTTVKPDVVETTVLAAAPQDATSRAGQDAARRG
A0A2V7K2H8      LQRQA---IPGLARALHADLGARAQTLATEISAGGRELQAIPQRSIE-EGRLRRDVSIAE
A0A2V7EK09      LQRQA---IPTLTRALVSELAAREAEFGRRVAADSRNLREIPARAIE-EARLRRAAGLAE
A0A2V7QD43      LERQT---IPTLARRLLAELSGREAELGRRVAEDTRSIQAVPPRAID-EARLQRQVTLAE
                                                                            

A0A2N1WA66      LQYRDLQQRFENSRLQEASSLPDLSVLDRAFPPSQPEKNRKSVIIALGTLLGLGAGIGLA
A0A143BIC3      AMYRNLNLKAAEAKLAEAATIPDVSILDPAVAPLRPTKNTAPVIIFAAVAAMLGLGVVLA
A0A2V7SVD5      GMYTNLSARYADARLAESSAMPDITILDRAAPANGVVTFRDLKIIGTAILIALGLGLGLS
A0A1Q7JIY3      ELYTTLQRRYEEAQVSERTIVPDLRILDAAVVPRRPVKNTAPRLILLAFCGSFGLAVVGA
A0A0S7Z9Q9      DLYNQVRGRVESARLAAASSIPDVRILDPARVPNQPSDDERMLRAGLVFFGCFGLGLLGA
A0A2V7GP46      NLYTSLQQNYEAARLAEASSIPDIRIFDKAVVPLQPVKNSAPRLLLLGFLGGLGLALAGV
A0A2V7H298      QTVTNLQARYEEARLAEISAIADVRLLDRAVEPQVPVGHMRAILIFLAFWGGLGVGVAGA
A0A2V7N2D0      QLFANIQQRSEEARLAEASSIPDVRILDAAVEPRQPFMDAAPFLLLLSVVGSLGAGVLAA
A0A2V7NMY2      QLYASLQQRYDEARVAEASALPDVRILDAPVQPYQPIGSVAPFLVIMAFLASAGLGVLGA
A0A2V7RBS9      NLFTSVQQRYSEARLAEASSIADVRVLDAAVAPETPVKNTAVRLLIMGLFAGLGLGVVGA
A0A2V7MB00      QLFSNLQHRYQEARLAEVSTLPDVRILERAVRPSRPASNTAPLLIIAAFLTSFGVGVAGA
A0A2V7PL95      QAVVNLQQRHEEARLATVSSLPDVKLVDPATEPQEPATNWAPLVIGLALIVGLGAGVTGA
A0A2V7T7Z8      QVVADLRRKYDKVRLAVTSSIPDLELVDPAVEPQEPSDNWAPVIVMFCAITCFGAGACGA
A0A2V7ILF0      QLVTNIRQRYEEARLADVSSIPDVRILDRAAVPFLPTFNLLPVLVVLGLMGGFGAGGGAA
A0A2V7SCT4      ELYTTLQRRYEEAQVSERTIVPDLRILDAAVVPRRPVKNTAPRLILLAFCGSFGLAVVGA
A0A2V7Q893      QAVANLQRRYEEARLAETSSIPDVRLVDPALEPQEPTENWAPVLVLFTMISGLGAGVGSA
A0A2V7QPQ4      QLFANIQQRYAEAQLADVSSIPEVRILDRAPHPDTPLFNIAAVLIVLAFVGSGVAGVLGV
A0A2V7JCT0      KVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIGLPEQIALGLLLGLMLGSGGA
A0A2V7L8K7      KVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIALPEQIALGLLLGLMLGSGGA
A0A1G0LV28      DTYKYLLSQLEAARISAGTIAPYIEVVESATVSYR-LGMSTRNKVVLGALVGLFLGVLAA
A0A1Q7E008      NLYTTLQQRYEEARLAEASTIPDVRVLDAAVAPHQPIKNTAPRLILLGLFGGLGLSLMGA
A0A1Q7DXW6      QLFSNLQQRYEEARLAEVSSLPDMRILERASKPDKPVSQLAPILIVLSFLGSLSVGTLAA
A0A2V7JF48      KVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIALPEQIALGLLLGLMLGSGGA
A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A2V7NW82      -------------------------------------------------MAGLGLGLLGA
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      NLYTTLQQRYEEARLAEASTIPDVRVLDTAVVPHQPIKNQAPRLILLGLFGGLGLSLMGA
A0A2V7J5T6      -------QRFDQSRLAAEATVPDVRILDPAIVPQRPIKNTTPRLLLMGFVFGLGLGMVGA
A0A2V7KN28      QTYTALQQRFDQARLAAEATVPDVRILDPAMVPQRPVKNTAPRLLLMGLLAGLGLGVLGA
A0A257SFA4      SLFNTLQQRYDETRIAQATDVSDVRILDPAGVPPWPTKNTAPRLLLLAVLGGFGLASLGS
A0A2V7HL73      GIVLPRAPGSVDPQVERSRGRRPRTTIAHRLQDERPSNEVFCHLSREGSPVSKFLKALER
A0A2V7K2H8      NLYASVQQRYNEARLGEASTVADVQVLDAAVSPQEAAKNTASRLVAFGFVVGLSLGMVAA
A0A2V7EK09      TLYTTLQQRYQEARVEVASSVPDVRVLDAAAVPQRAVKNRAPQVILFAFFGSLGLAMIGA
A0A2V7QD43      NLFTSLQKNYDEARLAEESAVPDARILDHAVVPQDPVRNTAPRVVFLGFAASLALGLCGA
                                                                            

A0A2N1WA66      FLLDLTDKRFRYADQITAGLGISILGAVPEIRRAKGET-----------------PSAEE
A0A143BIC3      ILLDQVDKRFRYPEQATDDLGLFVLGVVPVIHSKGKR------------------GKTDE
A0A2V7SVD5      VMLDRLDHKFRHLAQVNADLGLAVLGTVPQIAQPPRR------------------AKPED
A0A1Q7JIY3      IMLDRIDPRVRYPEQVSHELGLPILGAVPHL------------------------KDAAE
A0A0S7Z9Q9      VLLDRVDARFRFASDVGRVIGLDILGSIPRIESANGR------------------RGVLN
A0A2V7GP46      VLLDRFDPRVRYPEQVSHDLGLPILGAVPHLKARTGGQ-----------------LTREQ
A0A2V7H298      VLLDRTDRKVHYPEHVTRAMGLSILGAVPHVDWRNG-------------------NRDAA
A0A2V7N2D0      VLRDRVDPKLRDPAHVTQEMGLPILGAVPHLNAANGKGARGLNG-----------GGAGA
A0A2V7NMY2      VVIDTLDPRFRDPGHVTQGLGLRILGALPHLSRA---------------------GNGEG
A0A2V7RBS9      VVIDRFDPRVRYPAQVTTDMGLRILGALPHVKKRAGA------------------SDDES
A0A2V7MB00      VVRDRADPTVRRPDQITSAMGLPILGAVPHVRQTAPRREPLGKHRGPE-------ADADD
A0A2V7PL95      VVLDRTDRRVQYPEDVTSTMGLNILGVVPHLGRNG---HA---------------KHHEG
A0A2V7T7Z8      ILLDRTDRRVHDPDDVAHKMGLKVLGVLPHFDSPPPPLWA---------------ARSEG
A0A2V7ILF0      VLLDHLDRKVREPDEVTRVMGLPILGAVPHLKQRRNG------------------SVHEG
A0A2V7SCT4      IMLDRIDPRVRYPEQVSHELGLPILGAVPHLKD------------------------AAE
A0A2V7Q893      VVLDYRDRRVHDPEDFTRTIGLKILGVVPHLERKGRN------------------RAPED
A0A2V7QPQ4      VALDHLDSRVRHPDQVTRAMGLTILGAVPHVGQ--RN------------------GKGDQ
A0A2V7JCT0      FLAERLGSTIAQRVQVE-QLGMSVIGVITHLDRDGAETG----------------MKSPD
A0A2V7L8K7      FLAERLGSTIAQRVQVE-QLGMSVIGVITHLDRDGPETG----------------MKSPD
A0A1G0LV28      FFLEYLDQTIKTAQDVERVLDVPVLGLIPLESRQQLLAGNGHHGRRRYAIPLVSLVSPDD
A0A1Q7E008      VLIDRFDRRFRYPQQATGDMGLTILGAVPRLRYG--RRG----------------IDPDD
A0A1Q7DXW6      MTLDRMDRKVRTAEHVSLAMGLPILGAVPHVHRNGKKRN----------------SQDED
A0A2V7JF48      FLAERLGSTIAQRVQVE-QLGMSVIGVITHLDRDGPETG----------------MKSPD
A0A1V4RFS5      ----MLLERSKSPNA---------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A2V7NW82      VLIDRFDPRLRHPDQVTYGMGLRILGVLPHVRD------RRVG------------QDDEH
A0A2V7Q431      -FLADHLNRSVHRREDVAHLGLPVLGVVPHAKG----------------------GSNED
A0A2V7IEC4      -------------------MGLAILGAVPHLRTLPHAGRHGRG------------RVPED
A0A1Q6WKV1      -------------------------------MG--GGGGGKSA------------RPHEG
A0A2V7N4E0      -------------------MGLAILGALPHFAG--RGDGNGAG------------RTPED
A0A2V7EJU4      VMLDRLDRHFRYPQQVTGEMGLAILGAVPRIKRGRRAVDPEDA------------RQVI-
A0A2V7J5T6      IVLDRVDPRVRYPEQVSRDLGLPILGAVPHLR-------TKEP------------AEVV-
A0A2V7KN28      ILLDRADPSVRYPEQVSRDLGLPIIGAVPHLRAKDPAEVV--------------------
A0A257SFA4      VLMDRWDPRFQYPEQVSRDMGIAILGTIPHVRTARDGTLGDPA------------FR---
A0A2V7HL73      AEQQRALGRHPAPSEAASERGLAVPETAPPRPPRASHELAREV------------PNGLE
A0A2V7K2H8      VVVDRLDPRVHHPDQVTEQMGLSIIGVLPHVRDRRAG--------------------PDD
A0A2V7EK09      VLVDRGDPRVRYPYQVSREMGLTILGAVPHLRLTGVPGRHGNE------------RSPED
A0A2V7QD43      VVLDRIDPKLRYPDQVSRGLGIPILGAVPHLRNLPRGGRGSGA------------RVPDD
                                                                            

A0A2N1WA66      ASQVI---------EAFRTIRLNLMHTVAREKGF-AITITSAMPGDGKSLVSSNLALSFA
A0A143BIC3      AAQVV---------ESFRTIRMNVRYAADPSRPL-TMTITSPGPNDGKSLISSNLALSFA
A0A2V7SVD5      AAEVI---------ESFRGIRLRLQYAYSANQPL-VCGVTSPEQGDGKSLVASNLALAFA
A0A1Q7JIY3      PAEVV---------EALRGLCLNLVHAHGAAGPL-LVTITSPGAGDGKSFLASNLALTFA
A0A0S7Z9Q9      AAQAL---------EAFRELRIHVSFAYGSAGPI-TLAVTSPAPNEGKSMISSNLAVAFS
A0A2V7GP46      RVQLV---------EAMRGVCLGVSYTYGAAGPV-VVAVSSPGPGDGKSFITANLAVTFA
A0A2V7H298      ATQVI---------ESLRGVRLNVVHRHGTAGPV-RLTVTSPGKSDGKSFVASNLALAFA
A0A2V7N2D0      AGPVI---------EALRGIRLSLVHAYGTAGPL-LVTITSPGSGEGKSFVAANIALAFA
A0A2V7NMY2      TAQAI---------EAMRTVRVKLQHASNGGNPL-LLTVTSPGVGEGKSLVSANLALAFA
A0A2V7RBS9      GALVI---------ETMRGVRLSLIHAYGTAGPL-VVTITSPGPGDGKSFVSANLALACA
A0A2V7MB00      GARAV---------EALRGIRLNVHHAAGAVGPL-LATITSAGRGEGKSFVSANLAYAFS
A0A2V7PL95      VLQVL---------EAVRAIRLNVLHAHG-VGPA-IVTVTSPGRADGKSFLASNLAVAFA
A0A2V7T7Z8      GVKLI---------EAMRGIHVNVLHSHG-VGPA-IMTVTSPGRADGKSFVAAYLATAFA
A0A2V7ILF0      GLPII---------EAIRGIRLSVQYAHGAAGPL-VCTITSPGRSDGKSFLASNLALGLA
A0A2V7SCT4      PAEVV---------EALRGLCLNLVHAHGAAGPL-LVTITSPGAGDGKSFLASNLALTFA
A0A2V7Q893      ALHVL---------EAMRGTCLNVLHAHGT-GPV-IVTVTSPGRADGKSFVASNLAVAFA
A0A2V7QPQ4      VAPVI---------EALRAIRLRVVHAHGSAGPI-AVTISSPGRSDGKSLIASNLALAFA
A0A2V7JCT0      A--VV---------EAFRGLRLSLVNEYGAPGPL-VITVTSPGSGDGKSFVSSNLSLAFA
A0A2V7L8K7      A--VV---------EAFRGLRLSLVNEYGAPGPL-VITVTSPGSGDGKSFVSSNLSLAFA
A0A1G0LV28      P--SS---------EAYRALRTNVTFVNAEQRSLRVICVTSPGPGEGKSTTAANLAITLA
A0A1Q7E008      LTQVI---------EALRTVRLNVAHAYGAAGPM-VVTITSPGPGDGKSFLAANLARSFA
A0A1Q7DXW6      SQPAV---------EAMRGIRLNVQHAYGAAGPL-LLTVTSPGRGEGKSFVTANLALAFA
A0A2V7JF48      A--VV---------EAFRGLRLSLVNEYGAPGPL-VITVTSPGSGDGKSFVSSNLSLAFA
A0A1V4RFS5      --------------EAIRDLRTSLSFSRPEQGIK-SLLVTSSGPREGKSSVSANLAVAEA
A0A1Q6ZF81      ---------------------------------M-VLTISSPGSGDGKSFLSANLGLTFA
A0A2V7NW82      VIQLV---------EAVRSVRLSLAHAYGAAGPM-VVTLTSPGVGDGKSFLSANLALAFA
A0A2V7Q431      AAPIV---------EAMRGIRFNVLHAYGAAGPA-MFTITSPGSREGKSFVASNVALAFA
A0A2V7IEC4      VNQVV---------EALRGVCLNLVYAHGGRAPL-LVTVTSPGAGDGKSFLAANLAHTFA
A0A1Q6WKV1      VAELV---------EALRGTCLNLVYAYGAAGPM-LVTITSPGPGDGKSFLAANLALTFA
A0A2V7N4E0      IAQVV---------EALRGVCLNVVHAYGAAGPL-IVAITSPGPGDGKSFLAANLAHTFA
A0A2V7EJU4      --------------EALRTVRLNLTHAYGAAGPL-LVTITSPGPGDGKSFVSGNLARAFA
A0A2V7J5T6      --------------EALRGLRLNVAHEFG-AGPV-VFTVTSPEPGDGKSFVSANLALTFA
A0A2V7KN28      --------------EALRGVRLSLANEHGP-GPL-LVTVTSPGPGDGKSFLSANLALTFA
A0A257SFA4      --------------EAMRGVRMNIAFAYGAAGPV-TLTVTSPGSADGKSFVALWLARAFG
A0A2V7HL73      EHLVSLLAPRSFEAEQYRTLRHLIEQLHKSTGLS-VVAISSPGVADGKTTTAINLAGALA
A0A2V7K2H8      QQVAHAI-------EAMRSIRLSLTHAHGAAGPM-LVTISSPGVGDGKSFVSANLALAFA
A0A2V7EK09      --IAAVV-------EGLRGICLNLVYAHGATVPL-LVTITSPEPGDGKSFLSANIAHTFA
A0A2V7QD43      --VNEVV-------EALRGVCLNLVYAHGGRAPL-LVTITSPGAGDGKSFISANLAHTFA
                                                      ::*.   :**:  :  :.   .

A0A2N1WA66      EAGF-KTLLIDGDTRRGELHRTFGVERRPG---LLDHLAEQVPIADALHPT-NHPRLTVL
A0A143BIC3      ESGA-RTLLIDGDIRRGELAKTFQITSKPG---LVEYLDGTALIAEVLHPVQSHPNLTVM
A0A2V7SVD5      EAGY-RTLLIDADTRRGSLHDVFGAQRRPG---LIEVLSGEVTRAEVMHPT-TQERLSLL
A0A1Q7JIY3      DGGH-RTLLVDGDLRRGLLHRRFNANRKPG---LIEFLHGDAAREQIVQPT-SYPWLYLI
A0A0S7Z9Q9      EVGR-RTLLIDGDTRRGDAHRLLGRERSPG---LIDHLRGETGQD-IIQAT-DHPNLDFI
A0A2V7GP46      DAGR-RTLLVDGDLRRGAQHRLFGADRRPG---LTDALRGEVPLEAGLRPT-GYDALTLL
A0A2V7H298      DAGY-RTLLVDGDVRRGRLHHTLSAARRPG---LTELLEGSAPQDAAVQAT-RYKNLSFI
A0A2V7N2D0      DAGH-RTLLIDGDIRRGQLHRVLNAARVPG---LTNGLTEGTPLDAILQTT-PYPRLSFI
A0A2V7NMY2      YAGL-RTVVIDGDIRRGALHRLLRGSRRPG---LTDHLTGRAPLEKVLQTT-PYKCLSFI
A0A2V7RBS9      QAGQ-RTLLIDGDTRRGALHRVLGAVRRPG---LTDFLAGHVSFEGLIQTL-KFGSLQFI
A0A2V7MB00      AVGF-RTLLIDGDVRLGALHRPLRGARRPG---LTDVLAGSIPPELAVQNT-PHERLSFI
A0A2V7PL95      DAGY-RTLLIDGDIRCGTLHRVLKRPRRPG---LTDVLAGNATTAQAIQQT-TYRTLSFI
A0A2V7T7Z8      DAGY-RTLLIDGDVRCGVLHRAVKLLRRPG---LTDLLGGEAIEAQVVQRT-RQGGLWFI
A0A2V7ILF0      DAGL-RTVLIDGDIRRGALHRVLAVARKPG---LTDVLAGKATVDEVVRAT-AFPRVSFV
A0A2V7SCT4      DGGH-RTLLVDGDLRRGLLHRRFNANRKPG---LIEFLHGDAAREQIVQPT-SYPWLYLI
A0A2V7Q893      DGGY-RTLLVDGDVRCGTLHRTLKLARRPG---LTDLLQGRAGQEQVVQPS-AYGTLSFL
A0A2V7QPQ4      DSGY-RTLLVDGDVRRGALHRVLKTARKPG---LTELLAGTASREEAVRAT-AYPSLWFI
A0A2V7JCT0      YAKQ-RTLLVDADLRRGALHRVLNLRRQPG---LTDFLAGDVSRAPVVQTT-SHPCLDFI
A0A2V7L8K7      YAKQ-RTLLVDADLRRGALHRVLNLRRQPG---LTDFLAGDVSRAPVVQTT-SHPCLDFI
A0A1G0LV28      QQGS-ATLLVDADLRRPLVHRAFNLVQEPG---LTDVLVGSSQLREAVRPN-VIPKLDVL
A0A1Q7E008      DSGR-RTLLIDGDGRRGVLHRVLKVVRKPG---LIDYLAGAVPFATIVQQT-DHAKLWFV
A0A1Q7DXW6      DVGY-RTLLIDGDVRLGALHHAVRAQRRPG---LTDVLANRATPDQAVQRT-EHRQLWFI
A0A2V7JF48      YAKQ-RTLLVDADLRRGALHRVLNLRRQPG---LTDFLAGDVSRAPVVQTT-SHPCLDFI
A0A1V4RFS5      EAGK-KVILVDCDLRRPTVNKTFGFKRKPG---FTELISGKATIDEVVKKT-EVEGLFVI
A0A1Q6ZF81      DGGH-KTLLIDGDIRRGVLHRRFKGNRQPG---LVDYLLGDAGHDAIVQKT-AYPRLSLI
A0A2V7NW82      EAGH-RTLLVDGDVRRGALHRALHATRQPG---LTDFLAGRAPLEAIVQET-TSPSLHFI
A0A2V7Q431      DAGH-RTLLIDGDMRRGSLYRILNTRRKPG---LTDVLHDEVSAEDVIQPT-RYPPLFFV
A0A2V7IEC4      DGGH-RALLIDADIRRGVLHRRLNARRRPG---LSDFLRGETPLDSIVQAT-PYPSLSLI
A0A1Q6WKV1      EGGH-RTLLVDADIRRGVLHRRLTARRRPG---LTDCLRGEVPFEAILQQT-AYPLLTLV
A0A2V7N4E0      EGGH-RTLLVDGDIRRGVLHRRLSARRRPG---LTDYLRGEVPLEAILQPT-GCHTLTLI
A0A2V7EJU4      DAGQ-RTLLIDGDSRRGVLHRLFKGLRKPG---LTDYLTGVVPLEAVVQPT-DHATLWFI
A0A2V7J5T6      DGGH-RTLLIDGDIRRGVLHRRFKCNRQPG---LVDFIQGHAPRDQIVQET-PYPRLSII
A0A2V7KN28      DAGQ-RTLLVDGDIRRGVLHRRFKANRQPG---LVDFLRTEAGQGDIVQRT-AYPRLAFI
A0A257SFA4      EAGR-RTVIVDADVRRGALHRRCDLLRKPG---LTDLLKGDVPLERVVRAT-GMPGLDLI
A0A2V7HL73      QASDARVLLVDVDLRGGALAARLGIDERAGRGLVDAILNAELTLEAVVEVR-PDLNLTIL
A0A2V7K2H8      EAGR-RTLLIDGDVRRGSLHRAVRARRQPG---LTDFLAGRAPFEATVQGT-PYPDLQFI
A0A2V7EK09      QGGH-RTLLIDGDIRRGVLHRRLNGRRRPG---LTDFLQGETSLDTIVQAT-PYPAFSLI
A0A2V7QD43      DGGH-RTLLIDADIRRGVLHRRLSVRRRPG---LSDFLRGEAQLDVIVQAT-QFPALSLI
                      .:::* * *             .*   .   :         :        . .:

A0A2N1WA66      TGGSRHRNGPELLGSAAMRELMDQLQKEYDVILVDSPPLGAGIDPFLLGTLTGHLMLVVR
A0A143BIC3      PGGARRRRAPELLATPRLNQLINQMAAEYDVVIVDSPPLGAGFDAYALATATGNMALVMR
A0A2V7SVD5      PCGGRRTTNPELIASPALPRLLSELVGEFSVIIVDGPPLSAG----------ENTLMILR
A0A1Q7JIY3      GCGTRTNRAPELLGSAAMGQLVAALRQEYDVILIDSPPLGAGVDPFILGTVTGNVLLVLR
A0A0S7Z9Q9      GCGSRGVSTPELLASPRMAYFIGTLKRTYDVIIIDCPPLASGGDPLILGSLTGNLAVVIR
A0A2V7GP46      PCGVRTSDAPELLGSAKMPELLARLRGDYDVILVDSPPLGAGIDPFVLGTLTGNLLLVLR
A0A2V7H298      SCGLRSHAGPALLSSVAMARLLDALRASYEAIIVDSPPLAAGADGLALATVTGSLVLVLR
A0A2V7N2D0      GCGPRTPLGPELLGSGEMARLFASLRPRFEVILVDSPPLSVGVDPYILGTLTGNLLLVLR
A0A2V7NMY2      GCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMVLR
A0A2V7RBS9      GGGSRIRESPELLGSPRMVELLVRLRAMYPVIIVDSPPLGAGVDPYTLGTMTGAMMLVLR
A0A2V7MB00      GAGSRMHRGPELLCSDAMPRLLATFRSSYDVILVDSAPLAAGVDPYALGAATGNVLLVLR
A0A2V7PL95      ASGTRTHGGPALINSAALPRLLAELRPYHDAIIVDSSPLSAGADAFALGTAAGSMVLVLR
A0A2V7T7Z8      GCGTRTRAAPTLVGSGALPRALARLRPNYDAIIIDSSPLAAGADALALGTAAGSLLLVLR
A0A2V7ILF0      PCGTRRFSGPELLGSPAMRALLANLRGRFDAVLVDSPPLDAGVDAYLLGTLTANLLLVLR
A0A2V7SCT4      GCGTRTNRAPELLGSAAMGQLVAALRQEYDVILIDSPPLGAGVDPFILGTVTGNVLLVLR
A0A2V7Q893      GCGSRTHDGPALVSSAALPRALAGLRSSYDVIIVDSSPLAAGTDAFALGTATGTLLLVLR
A0A2V7QPQ4      GCGARSQQGPERLTSAPMVRLLADLRPAFDVILVDSPPLAAGADAFALGTMTGAMLLVLR
A0A2V7JCT0      ASGTRRRDAPELLGSAAMTDLVTSLRSTYEVIVVDTAPLGAGVDALVLAKLARNLLMVLR
A0A2V7L8K7      ASGTRRRDAPELMGSPAMADLVTTLRSTYDVIVLDTAPLGAGVDALVLAKLAGNLLMVLR
A0A1G0LV28      PAGALPPNPSELLGSEAMRRLMEQLRTHYDIIIFDSPPTLAVTDATVLGASSDAVILVLR
A0A1Q7E008      GSGTRKQDVPELLASPAMARFLVSARADYQVILVDSPPLGAGVDPFVLGTFTGSLVLVLR
A0A1Q7DXW6      GAGSRMHRGPELLCSAGVPRLITAMRGGYDVILVDSAPLAAGVDPYALGTVTGSMLLVLR
A0A2V7JF48      ASGTRRRDAPELMGSPAMADLVTTLRSTYDVIVLDTAPLGAGVDALVLAKLAGNLLMVLR
A0A1V4RFS5      CSGHIPHNPAEMVETAVKKGVFSQIAEACDMLIIDTPPAAVVTDAVVIAPAVDSVILVVR
A0A1Q6ZF81      GCGTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLLLVLR
A0A2V7NW82      GSGTRHRDAPELLGSPPMVELLTRLRTSHRVILVDSPPLGSGVDPLTLGTLTGSLLLVLR
A0A2V7Q431      GCGTRTPDAPELLGSEAMSRFIAGVRESFSAIVIDSPPLGAGVDAYALGAVTGNVVLVLR
A0A2V7IEC4      GCGTRAYNAPELLGSPPMSELVNGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLVLVLR
A0A1Q6WKV1      GCGTRVHNAPELLSSEAMAQLVTRVRPDYDVILMDSPPLAGGVDPFILGTLTGSLLLVLR
A0A2V7N4E0      GCGTRAHNAPELLGSQAMGELITGWRASYDVILIDTPPLGGGVDPLILGTLTGNLLLVLR
A0A2V7EJU4      GSGSRKQDAPELLGAPTMAQLLASARASYQVILIDSSPLGAGVDPFLLGTLTGSLLIVLR
A0A2V7J5T6      GCGTRTQRAPEVLGSPAMADLFTELREQYDVIVVDSPPLTAGVDPFVLGTVTGALLVVLR
A0A2V7KN28      GCGTRTQRAPEVLGSPAMAQLIAELRGQHDVILIDSPPLTAGVDPFILGTVTGSLLLVLR
A0A257SFA4      TSGTRMDDGPELLAGPAMRSLVGDLRARFDVVVFDSPPLSAGIDPFVLASLSANMLLVIR
A0A2V7HL73      PAGRLPRAPFEVLKSPRVEELLAEARRRYDYIVLDTPPLVSFPDCRVIEKCVDGFLIAVA
A0A2V7K2H8      GAGTRFRDSPELLGSGAMSELLARLRASWSVILVDSPPLGSGVDPYTLGTLTSNMLLVLR
A0A2V7EK09      GCGVRAYNGPELLGSAAMSQLLTTLRSSYDVILIDSPPLAAGVDPLILGMLTQSLALVLR
A0A2V7QD43      GCGTRAYNAPELLGSPAMTSLVNGLRGSYDVVLIDSPPLAAGVDPLILSTLTGTLALVLR
                  *         :        .         ::.* .*                  : : 

A0A2N1WA66      AGETNREFTEAKLQIIDQLPIRLVGAVLNDIRTSM--NEYSYYAYS-SGYAATDEAERTE
A0A143BIC3      AGVTDRKMAAAKMQVVDTLPVRVMGAVLNGIKMT---GAYQYYSYY-QDYAATDEEPVAR
A0A2V7SVD5      HSKTDMRMAKTKLALLRRLPLRTVGVVLNDVKAM---GDYKYYGYDTAYRALPEERAVAT
A0A1Q7JIY3      TGYSHRDAAGAKLEVLNRLPVRTLGAVLNDVPRGAAYGYYSYYSYYLPGYEAVDEDDSLE
A0A0S7Z9Q9      TGATEKALAQAKIDQLSRLPIRILGAILNDVSAHD--TYHSYYASYLPSYEPVPEEGDEV
A0A2V7GP46      TGVSHREVMAAKLEVLRRLPVRLLGAVLNDVPPG---AAYQYYSYYTPGYEATDEKPARL
A0A2V7H298      TGVSDRELTETKLGALHHLPVRVLGAVLNDVRPG---GAYRYYSYYLEGYEVHDEPAAAE
A0A2V7N2D0      SGVTDRELAATKLDALDRLPIRLLGAVLNDIRQD---GAYRCYSYFPEGYELREEESAGQ
A0A2V7NMY2      AGVTDLELAQAKLESFEDLPVRVVGTVLNDVQPK---GAYRYYAYYVPGYETKEEADLGP
A0A2V7RBS9      TGATNLDLARTKVAMLENLPIRVVGAVLNDVRLG---QMYGEYYGYMAGYGTTTEDGGTR
A0A2V7MB00      TGVTDRGLAEAKVEMLHRLPLRVLGAIMNDVRPG---TAYSYYSYSLEGYEVWEEDPEGK
A0A2V7PL95      TGVSDRALMQTKLGVLDHLPIRVLGAVLNGVVPG---GVYRYYSYYLEGYEA-KDEPAGA
A0A2V7T7Z8      TGVSDGALARVKLYDIRRLPIRVLGAVVNGVRLR---RGSSQDAYYLEGYEA-KDEPESV
A0A2V7ILF0      TGVTDRELAAAKLGVLDRLPVRVLGAVLNDVEPR---GAYRYYSYSLEGYELKEEQDPDD
A0A2V7SCT4      TGYSHRDAAGAKLEVLNRLPVRTLGAVLNDVPRGAAYGYYSYYSYYLPGYEAVDEDDSLE
A0A2V7Q893      TGVSDGGLAQAKLQVMNHLPIRVLGAVLNDVRRD---RLYRNYSYYLEGYEAQDE-PDGA
A0A2V7QPQ4      TGFSDREQAEAKLDVLARLPIRVLGAVLNDVRLG---GEYRYYSYYMAGYEAEDEHPAWD
A0A2V7JCT0      LGRTDRVLAEAKLEILRRLPLRLLGAVLNDVRDE---SEYRAYAYYMDGYALTNEPLFRP
A0A2V7L8K7      LGRTDRVLAEAKLEILRRLPLRLLGAVLNDVRDE---SEYRAYAYYMDGYALTNEPLFRP
A0A1G0LV28      AGETEEIAAQRALEQLRRVQARVAGSVLNGVEKD---RD-RYYNYYY--YKHHDDGERRD
A0A1Q7E008      SGTTNRELAQAKLDVLDRLPVRVLGAVLNDVEPH---GVYRYYTY-LSGYAAEDEP--RR
A0A1Q7DXW6      TGVSDRAIAEAKVAVLQRLPIRVLGAVLNDVPPG---TAYSYYGYSLAGYEMKEED----
A0A2V7JF48      LGRTDRVLAEAKLEILRRLPLRLLGAVLNDVRDE---SEYRAYAYYMDGYALTNEPLFRP
A0A1V4RFS5      SGKIQKKVVQGVWQKLLRSGGHLSGAVINGFDPIRTYTSYTYYTYKYQYYYEEQSE----
A0A1Q6ZF81      TGHSHRDITGAKLEVLDRLPIRLLGAVLNDVPRGAAYGYYAYYSYYLPGYEAVEES----
A0A2V7NW82      AGASNLDLTRTKLALLELLPIRLLGVVLNDVPAAGA---YRYYS-YLSGYEAADEPE---
A0A2V7Q431      LGTTDRETTEAKLDLLDRLPVRLLGTVLNDVPEHSA---YAPYSYYMEGYAYEAERGREP
A0A2V7IEC4      TGYSHRDVAAAKLEVLQRLPVRLLGAILNDVPAGGA---YRYYSYYLPGYEAADED----
A0A1Q6WKV1      TGHSHRDMAAAKLEMLHRLPVRLLGAVLNDVPAEAG---YRYYSYYLPGYEATDEY----
A0A2V7N4E0      TGCSDRDVMAAKLEVLGRLPIRVLGAVLNDVPPGAA---YRYYSYYLPGYEAVDED----
A0A2V7EJU4      SGTTDRELAHANLDVLGRLPIRVLGAVLNDVEPRGAYRYYS----YLSGYAAEDEA----
A0A2V7J5T6      TGKSHRGITGAKLEVLERLPIRLLGAVLNDVPRGAAYGYYAYYSYYLPGYEAVEEA----
A0A2V7KN28      TGHSHRDITGAKLEVLDRLPIRLLGAVLNDVPRGAAYGYYAYYSYYLPGYEAVEET----
A0A257SFA4      TGLSVRELTYTKLEALNRLPIRLLGAVLNDVPDTAP---FAYYSNYLPGYEAEAEH----
A0A2V7HL73      AHKTSRKLLEEALNVTER--AKIVGFVFNGDDRHLS---RDSYGTY-ASTRSVDLG----
A0A2V7K2H8      TDATDLSLARTKLSVLDHLPIRLLGVVVNDVRPGGV---YRYYSYF-AGYGTRDEG----
A0A2V7EK09      TGYSRREVAASKLEALQRLPLRLLGAILNDVPPRGG---YPYYSYYLPGYEAVDEE----
A0A2V7QD43      TGYSHRDVAAAKLEVLQRLPVRMLGAVLNDVPAGGA---YRYYSYYLPGYEAMDEN----
                                     .  * :.*.                              

A0A2N1WA66      ---ARARPVVPTIPAEVGTRD-----
A0A143BIC3      ---ITDGTRGDGEMKQGGRS------
A0A2V7SVD5      ---V----------------------
A0A1Q7JIY3      ---AHSRPRVV---------------
A0A0S7Z9Q9      ---PTQILSGPSDRELDLEEEGARKG
A0A2V7GP46      ---TPSVG------------------
A0A2V7H298      ---VHVLRGPER--------------
A0A2V7N2D0      ---RKRILTAAQ--------------
A0A2V7NMY2      ---EKPVLGVPSV-------------
A0A2V7RBS9      ---IARRRLQGAL-------------
A0A2V7MB00      ---VSKMLLSEESKPTGAGIP-----
A0A2V7PL95      ---AGQVLRAPE--------------
A0A2V7T7Z8      ---GGPVVGASG--------------
A0A2V7ILF0      ---EGAAARVLVRSPK----------
A0A2V7SCT4      ---AHSRPRVV---------------
A0A2V7Q893      ---RGQVLRAPV--------------
A0A2V7QPQ4      ---DRPVLQPSD--------------
A0A2V7JCT0      ---LAGNKQGVGSRPAR---------
A0A2V7L8K7      ---LAGSKQGASSRPTR---------
A0A1G0LV28      ---GPFATLRKRLLGVG---------
A0A1Q7E008      ---TEGWALARRPRGAS---------
A0A1Q7DXW6      ----PGGAAGEILLPERS--------
A0A2V7JF48      ---LAGSKQGASSRPTR---------
A0A1V4RFS5      --------------------------
A0A1Q6ZF81      ---SGQASAPRVV-------------
A0A2V7NW82      ---SVAVQRVRALL------------
A0A2V7Q431      RTLTGGRSRS----------------
A0A2V7IEC4      ---SGSRR---VPV------------
A0A1Q6WKV1      ---PAGRK---LVV------------
A0A2V7N4E0      ---TGRNKRQPLVI------------
A0A2V7EJU4      ---SAPPQRWAVARRLPGASSPSA--
A0A2V7J5T6      ---GTSGSQVV---------------
A0A2V7KN28      ---DGRRTSSPQVV------------
A0A257SFA4      ---RDASATRATAAEAR---------
A0A2V7HL73      ---GGGWRRLVSSSSRTHRRQTASDH
A0A2V7K2H8      ---VAIATHRVRGVL-----------
A0A2V7EK09      ---SGRRSGPTGRPLVA---------
A0A2V7QD43      ---SGSPRVPV---------------
                                          

© 1998-2019