BYKdb

Dataset for cluster tadcd of phylum gemmatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

89 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A2V7HBX4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      MIGPQSGAQQGEAIDLRHVQVHEHEVECAALQQVEGFLPPAADGYVVAFVAQNRRAALAQ
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A2V7R2W8      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A2V7HBX4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      -MLVVHDEHPDVGPRPGLDCEQVRHLLREIRRDARGRLARLRFRPGWRHADDSPGGAGGR
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------MFNGVPFLCKRTNRGRALRGAIPLAPMHMTCAPPRPAGRLPE
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7FK98      --------------------------------------MRC-------------------
A0A2V7R3Z8      RVFVIDHQNPHPGLGFRPDGEHGRRLASLDGGGHAVMSKRCRHRGRPRFPVDPPLRRVRA
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------MDIGFVPARVWPPLTQGSGQSVATSQRPDS
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      -MASMADGSRPSTEGLTPSWASGMDIAVVLDFRLTPPYAGFGPTCREVAAARILRITTAK
A0A2V7Q8M6      -----------------------MDIALVLDNGRPHSYAQFGPHCRDPAAWPGLPHGFSN
A0A2V7QBC3      -----------------------------------------------------MPQRRRF
A0A2V7LMU1      -----------------------------------------------------MNSATTD
A0A2V7PBY9      -----------------------------------------------------MKWATNG
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A2V7R2W8      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A2V7HBX4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      AVCDLPHADAESGPVRPLQLHLSGEAVKGDCCANDTGFPCVPLAQQPLQRARQVTAACVG
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      PIALQRVAPASRREHAPARAAHVLRICGATCCAYATRRHRHAPRRRCGREAGVRSQRYRP
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7FK98      --------TDLRHGDG--------------------------------VGGVPRGIG-LA
A0A2V7R3Z8      NLSRGRSGTDSPHNDGKILSSARRGGVVARTKVHPAPGCGAPICGMWTVGAPHRAVSDLP
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      QAIAAPAARRTRAPGWTVAPTCIHRLPHAAPICGMTSPAGGEGVGPCAVSDLLSSRRDAG
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      SASLAVAAGTRPAPRCIRLRE---------AVHRFAACGRCGLRAARYRTCH--------
A0A2V7Q8M6      NRS--CGAGRPRSER-TKLHPFFGC-----DCTELRHQLNRSAGRARYRTCHTLSRDETQ
A0A2V7QBC3      AAR--IGQQRPRASRATPFRPHQGASVPPGDCTELRHQSHRSAGSARYRTCHTSSANEPQ
A0A2V7LMU1      RAY--SRRHRPNAPRCIRYGAL--------IALNCGISADG-LRRRTGIGLATCSAHDTT
A0A2V7PBY9      AQE--GQRRYPSRTKVHRRDVH--------PCTQLRHGGGR-LGVARGIGLAVRRWDDTH
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A2V7R2W8      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      -------------------------------------------------------MQARG
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      --------------------------------MSLAGTSTCCRRTTAYASSPRRAVRQRP
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      --------------------------------MQMRPTAFRGRRRRPRWYRACSAALVPN
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      --------------MITTRDRATTRGTPCRTPRTIWCGPSWHPSIRHPRKVIMSRMGSQA
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      -----------------------MSANLVPSAANAAAVPRQDGFAPMP------------
A0A3M2G737      -------------------MYFGRMVPSDSAPKLQAPISTSNGAYHSE------------
A0A0H4TUX7      --------------------MNLRSGTWSHSLSFLSSATTWENRLDAV------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      -------------------------------------------------------MYFGN
W0RI74          --------------------MSANLPPLPAGSDAPLPVPAAEHALQPYD-----------
A0A3M2BJA6      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------MSGQQIQSVTPQAVALEPYQEGTP------------
C1A5W1          ------------------------MSGQQIQSVTPQAVALEPYQEGTP------------
A0A2V7PX99      ------------------------MSNSPSWPVERAGPEVALQPVPDR------------
A0A2V7ERC7      -----------------------MPPLILPPRKSLMSVRLTPSPETPPPFTGAPYGAFPG
A0A2V7HBX4      -------------------------MRVRSLQPDYPLAPHHPGSIPTA------------
A0A2V7JTZ5      -------------------------MSVRSLQPDYPLAPHHPGSIPTA------------
A0A3D4YTR6      ---------------------MLLRTRVYPSPSDFAIAPSNAGSPSPA------------
A0A2V7F1M1      ------------MSSQRGAQLMSELLPEPTPLRLTGPPGSLRPSRDGG------------
A0A2V7KXK7      -------------MRDGERHRACVAHPCMEPKEPHEMSGSNGEGTRIPVLRSESSLDTIR
A0A2V7QDU7      ---------------------------------------MSHDVTHSQ------------
A0A2V7ITT6      ---------------------MACRPPPRPSPRSKDPVPSIEPPQPPPDGFPEVWSGSPF
A0A2V7NJW1      SRADCITSRSRRGAGRYQDCGIACRPPPRPSPRSKDPVSSIEPPQPPPDGFPEVWSGSPF
A0A2V7GFB5      --------------------MERQLPERVDPAVLGAPRPWAAEEVATT------------
A0A2V7RQ86      --------------------MERQLPERVDPAVLGAPRPWVAEEVATT------------
A0A2V7IWX2      CSGDPWSRDVESRAIRFALDMAHEGPSLPEPARLDAIAATPRSRAPTR------------
A0A1Q7KE95      --------------------MRIAVSAYPPSNG--TPVPADQLAAPFG------------
A0A1Q7T8X5      --------------------MRIAVSAYPPSNG--TPVPADQLSAPFG------------
A0A2V7FK98      TGRRDAAPTGRSPANTVEVRVPMSTSPLPFHSG--STVPAVAPAAPPP------------
A0A2V7R3Z8      QGRGDAAPPGAAPPTHVEVRFPMSTSPLPLHAG--ATVPAVAPSAAPP------------
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------MTDLPSAPRSQLPARPALSSIDLA------------
A0A1Q6ZHP2      ----------------------MTISNLPAPLG---PAPMAAPGMPQR------------
A0A1Q7R6Z6      ----------------------MTISNLPAPLG---PAPMAAPGMPQR------------
A0A2V7FYT7      ----------------------MTISNLPAPLG---PAPMAAPGMPQR------------
A0A2V7IGR0      ----------------------MTNSDNHAALARLPPSSDAGAALQPA------------
A0A2V7MR23      ----------------------MTISNLPAA-L--VPPAATPPALPQR------------
A0A2V7L1V3      ----------------------MTMSHLPLPPG--STPPVMVPPSAPP------------
A0A1Q7E5D3      ----------------------MTTSNL-LAPL--APPPAVAPVAPSC------------
A0A2V7ISE2      ARHDAARPARRNRPYRSIGNGSMAFSNLPAAPL--VPPPVVAPGTPHR------------
A0A1Q7J2X5      ----------------------MTLSNLPAAPL--VSPPVVAPGTSHR------------
A0A2V7NPD1      ----------------------MAFSNLPAAPL--VPPPVVAPGTPHR------------
A0A2V7QPD8      -GKTRRRATRRGPANTVEVRFPMSTSPLPLHAG--STVPAVAPAAPLP------------
A0A2V7Q8M6      FSEASPRATPRGTRS-------MSMSHLPLPPG--STAPVMVPPSPPP------------
A0A2V7QBC3      FSEATPSATWRGTRS-------MTMSHLPLPPG--STSPVMVPPSPPP------------
A0A2V7LMU1      LCGATPRATRRGTPS-------MTLSHLPLPPS--SPPPVIVPPSSKS------------
A0A2V7PBY9      RAPLRRALPTRGLPS-------MSISRLPIPHG--APPPAAAPPPAPP------------
A0A3M2BLV5      ----------------------------------------------MD------------
A0A2V7KS68      ---------------MLIRHMMTSRHLPALRSDTASPARAERASVSTR------------
A0A2V7N4L3      ---------------------MTPSPFPLIRNQPTGSVASAAPPPSSA------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ---------------------MNPRPLPAIRSQSA-PVLRRANASAA-------------
A0A2V7MFS9      ---------------------MNPLPLPAVRGQTAAPALRRASPPHT-------------
A0A2V7T933      ---------------------MTPRPLPAIRGQSAPAVLRRGGTSDR-------------
A0A2V7J4D7      ----------------------------MMPGESIARFRSTA------------------
A0A2V7LN90      ----------------------------MTTGDLPVPFEPVRTE---V------------
A0A2V7LFN9      ----------------------------MTTGSLPARLDTPKAEDRNA------------
A0A2V7MEK4      ----------------------------MTTGSLPARLDTPKAADRNA------------
A0A2V7P8B1      ----------------------------------MTRVTEPLPSDSRA------------
A0A2V7R2W8      ---------------------MAGD---SLMPSRST------------------------
A0A2V7MS64      ---------------------MIGELPSP----RPENDPRTTTTVIQP------------
A0A2V7Q7N9      PPLVPTLRCWEPVNQETLRGMTTGDLPVPFEPTRAE----------FV------------
A0A2V7IRW6      ------------MKKSPETDMDTGDLPARLDPVQPERLPSPAGSFDAI------------
A0A1Q7DVU6      ------------MKESPETDMETGDLPAALDPERPERLPSTAAPFDTI------------
A0A1Q7JSV2      --------------------METGDLPAALDPERPERLPSTAAPFDTI------------
A0A2V7QN41      ---------------------------MSRERSRLPEVASVDGTWLRA------------
A0A2V7R603      ------MRRSVASPAAPRYPPCSADLAMSRERSRLPEVASVEGAWMRA------------
A0A2V7LJS2      -------------------------------------MSQPHPNDARA------------
A0A1Q7GLJ7      -------------------------------------MSEQLRSEPPA------------
A0A2V7GRE3      -------------------------------------MVEP--SNRPA------------
A0A2V7EU00      -----------------------------------------MQPYGAP------------
A0A1Q6WE01      ----------------------MTEYLPGVA----ASPLVREAPLPVP------------
A0A2V7S9K3      AVGRGSPRPGAAGGIGLAVGNRVPELLPSGA----APQLTHAVPLVAP------------
A0A1Q7DXB9      ------------------MAHEGPSLPESAR----LEAIAATPRPRAP------------
A0A1Q7JD32      ------------------MAHEGPSLPESAR----LEAIAATPRPRAP------------
A0A2V7MVP8      ------------------MAQDPLLIPESAR----VDEVAPLLERRPA------------
A0A2V7N0A9      AGPEPAPRPSPGKFETHTMPSQLTVPPQEGTPDRRL---GAAAAAAGP------------
A0A1Q7DLS9      --------------MFNDLPELPPSSPETPG----------RATVPAP------------
A0A1Q7JK96      --------------MFNDLPELPPSSPETPG----------RATVPAP------------
A0A2V7KQV7      ------------------MASDATLPPNQPA--------------LVP------------
A0A1Q7JGF6      ------------------MPSDPTADPEQSAPDRRLVLAAATAARLAP------------
A0A2V7SG67      ------------------MPSDPTADPEQSAPDRRLVLAAATAARLAP------------
A0A1Q7GIK9      ---------------------------------------MVTSTLVVP------------
                                                                            

A0A2D5ZJF2      TGEGNGSQAAPAGLSPEITPPGLLEILWRRRWIVTLV-TLASIVGAFIYL-MKATPIYTS
A0A0S8H9P3      -----------MGRYERTHLEDYWRVVRRRAWLILLT-ALVALLAATWAA-SRRPRLYRA
A0A1E4BBP7      QWGGAPSAPPPSQGGVGDQLARTLAAIKRYKWLVLAV-IAVGSTAGVTLT-RFVKPKYDV
A0A3M2G737      -----------------NPIHEYFQIIVRGRWIILVVFTLVMAATMIYVLRNKPRLVYST
A0A0H4TUX7      RRPEGTEALRRIVHQREVHLRDLVGVVSRHWRLVALL-TVLVAGGAWYSA-RRQVPRYQS
A0A1G0LUG0      ------------MHQREVHLRDLVAVVTRHWRLVAAV-TAVLVGFSWYNG-RNQVARYQS
A0A1Q7E3T7      ---------------MRVNLRDPLAVVRRHLWLVLGMTAVVGGIVGYRA--YAAVPSYRA
A0A1G0L906      ------------------MHLRDLAQVLFSHWKVVVFLTVLVVFSTSYAS-RKAVPRYQS
A0A1G0LCC0      ------------------MHLRDLAQVLFSHWKVVVFLTALVVFSTSYAS-RKAVPRYQS
A0A2D5ZJE2      ---------MDEHQAHGVTLADYVRIIWSRKWMVGLV-ATAVLAFTIFFT-LRMQPVYES
A0A3M2G624      GKNYPVEVTTSSYLEADFDVRKYVRMLWRRRYIVLLLFVLIFGFSTYRALTQKVTPVYRS
W0RI74          PAAYAPPAAPADEAGGALSVGRFMAAMSRYKWLVAAL-VVLGLGGGFVAT-RFIDPEYEV
A0A3M2BJA6      ---MEKPTFEGGYVDDEISLRDIWNLLRRNQWLIFLC-VLLVTGGAAAYS-YFAVPVYES
A0A3D4VBZ5      PGDWGGGTAEGAPEPKGPSLRRYLAAVNRFKWLVLVF-AILGGAGGYAAT-RFIEPEYEV
C1A5W1          PGDWGGGTAEGAPEPKGPSLRRYLAAVNRFKWLVLVF-AILGGAGGYAAT-RFIEPEYEV
A0A2V7PX99      GTAAAHGRAYEPPTPEPSDWQRMLAAAMRRRWLVILV-TLAGTAAGVIGS-RFLDPRFAA
A0A2V7ERC7      NTGPSTGPAVVLQESEGVQWGRYFDVLKRHALLIVLL-VAVGTVWGLNAA-RQVRPDYET
A0A2V7HBX4      EWTPARPRSEDFEDAEGIPWSRYVDAIRRHVLLIVGL-AAVGSVLGVVAA-RRVRPIYEA
A0A2V7JTZ5      EWTPARPRSEDFEDAEGIPWSRYVDAIRRHVLLIVGL-AAVGSVLGVVAA-RRVRPIYEA
A0A3D4YTR6      PYKGGPQRMDGPSDSEGIPWSRYIDAISRHSLLILAI-ALLGSLVGLYAA-RQVRLSYDA
A0A2V7F1M1      -------GRSADSAEIRTDFKQLLMLLRRRIGLVAGI-AALIVFVVALFV-VLERPVYRS
A0A2V7KXK7      MKSLTTPSAPPPPPAEHSDWQRYFNSVMRHKWFVIVV-TLVGTALGIVAT-RFLDPRYTA
A0A2V7QDU7      GLRSPSLDGAPAGFLPGAGAAELVDILRRRLWSILGC-TVLCVGAAVLYV-VLARPSYRA
A0A2V7ITT6      RGAQPVPSAFRPEHDGVHDWQQYRGAVARYKWVVVLV-STVGTLIGVAAT-RFLRPEYEV
A0A2V7NJW1      RGAQPVPSAFRPENDGVHDWQQYRGAVARYKWVVVLV-STVGTLIGVAAT-RFLRPEYEV
A0A2V7GFB5      S------------PEGALDWRRIAQVVTRFKWLVFGI-TVAGGAAG-FAATKVVRPQYLT
A0A2V7RQ86      S------------PEGALDWRRIAQVVTRFKWLVFGI-TVAGGAAG-FAATKVVRPQYLT
A0A2V7IWX2      YEQLPRL-----LPAAEPDWRRILGAIGRRRWVVLAV-TLLGTAAGVVAAAKFVGPRYLA
A0A1Q7KE95      AGRGGRLEESGAGLVQPTDWRRHGATALRYRWWILGL-AALGTLGG-TAAGRLLPPRYQV
A0A1Q7T8X5      AGRGGRLEESGAGLVQPTDWRRHGATALRYRWWILGL-AALGTLGG-TAAGRLLPPRYQV
A0A2V7FK98      MGADMGFGQGFAQPETGVDWRRVLSAVARFKWLIAVV-TIVGTVGG-LAATRFIKPQYMV
A0A2V7R3Z8      MAADLGFSQGFAQPETGVDWRRVLSAVARFKWLIAVV-TIVGTVGG-LAATRFIKPQYMV
A0A2V7J3C0      --------------------------TRRYRWWVLAL-TGVGILGG-ILAGRLLPPRYQV
A0A2V7KWV9      A-----------DSGGAPDWRRHGTAVWRHRWWILGL-TVLGTIGG-VGASRVLPPRYLV
A0A1Q6ZHP2      G--ISVFD--LDGRESGVDWRRILSALLRFKWLIATT-TLVGTIAG-VGATRFLKPQYSA
A0A1Q7R6Z6      G--ISVFD--LDGRESGVDWRRILSALLRFKWLIATT-TLVGTIAG-VGATRFLKPQYSA
A0A2V7FYT7      G--ISVFD--LDGRESGVDWRRILSALLRFKWLIATT-TLVGTIAG-VGATRFLKPQYSA
A0A2V7IGR0      A--LSLVEPGFSEVEGALDWRRVWSAVVRFKWLILAV-TLLGVAAG-GAATRFLKPQYLV
A0A2V7MR23      G--VSPF--DLDGPEGGLDWRRILSALLRFKWLIATF-TLVGTVAG-VGATRFIKPVYSA
A0A2V7L1V3      A--TTGW--GGPESEGGVDWRRVYSAVMRFKWLICAV-TVLGTVAG-FGLARFVRPQYGA
A0A1Q7E5D3      A--VAES--GFPGLDDGLDWRRVLSALLRFKWLIAAV-TLAGTAAG-VGATRFLTPEYVA
A0A2V7ISE2      G--MTEF--DLAGSDSGLDWRRILSALLRFKWLIAGF-TLVGTVAG-VGATRFLKPEYAA
A0A1Q7J2X5      G--VTEF--DLAGSDSGLDWRRILSALLRFKWLIAGF-TLVGTAAG-FGATRFLKPEYSA
A0A2V7NPD1      G--MTEF--DLAGSDSGLDWRRILSALLRFKWLIAGF-TLVGTVAG-VGATRFLKPEYAA
A0A2V7QPD8      TGADMGFGQGFAAPETGVDWRRVLSAVLRFKWLIAVV-TIVGTVGG-VAATRFIKPQYMV
A0A2V7Q8M6      P--TAGW--GGADSEGGVDWRRVFSAVLRFKWLICAV-TVLGTTAG-FGVARFVRPQYGA
A0A2V7QBC3      P--TTEW--GGADSEGGVDWRRVFSAVLRFKWLICGV-TVLGTTAG-FGVARFVRPQYGA
A0A2V7LMU1      L--STEW--GGAESEGGVDWRRVLSAVLRFKWLICGV-TILGTAAG-FGVARFVRPQYGA
A0A2V7PBY9      AVPGTYA--GFAEPEGGVDWRRVVSAVMRFKWLICGV-TFLGTLAG-FGAARFVKPQYGA
A0A3M2BLV5      RQPDLRPPLDSELLSASPHLSDYIQVVTRRLWLVLLI-FAVTTASAIWAV-SRQKTLWRS
A0A2V7KS68      ALRPE--AAAFPDDEHGPDWRRVGSALLRFKWLVLAA-LLAGLAAAFGAT-KVLRPAYKA
A0A2V7N4L3      GLRRGSPEGPPEGHEAGPDWHRIASALLRFKWVVILA-VLLGLGAAFAAT-RVLRPVYRA
A0A1Q7AZK2      -------------------------MLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRA
A0A1Q7TNP7      -------------------------MLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRA
A0A1Q7KG39      -------------------------MLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRA
A0A1Q7GX75      -------MAGLDDEESGLDWRRIVSALLRFKWLVLLA-VALGLGGGFAAT-RKLPPVYSA
A0A1Q7LL80      -------MAGLDDEESGLDWRRIVSALLRFKWLVLLA-VALGLGGGFAAT-RKLPPVYSA
A0A2V7PFU2      -------PSLPE-AESGPDWRRLASALLRFKWIVLLM-VLLGLGGAVAAT-RLLRPIYRA
A0A2V7MFS9      -------PSLPDGGEPGPDWRRIASALLRFKWLLVLT-LTMGIGAAFAAI-RLLRPVYRA
A0A2V7T933      -------TSLPE-EEAAPDWRRIGSVLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRA
A0A2V7J4D7      ----PTVAGPFEDPNPPPDWWRYVAAIRRFKWLVLGV-TVGATALGVVGTMF-LRPTYAA
A0A2V7LN90      VARYPPPPLRPDS-EPLAEWRRYLMAARRYRWMVLGV-TLFGTAAGVGLSLL-LPPTYLA
A0A2V7LFN9      VAR-PAPALPPDAGDWLADAQRYLRSVRRHKWLVLSL-TLFATAAGIELSVYALPPNYAA
A0A2V7MEK4      VAR-PAPALPPDAGDWLADAQRYLRSVRRHKWLVLSL-TLFATAAGIELSVYALPPNYAA
A0A2V7P8B1      ASGPFAEREEVEASASTVRLEDLFATVRRHIWLVLGV-AAGVVAAAGGVA-YVTGSVYRA
A0A2V7R2W8      ---APLAVTNEPEQPQQPEWLRYLSAVRRFGWLVVAV-TLAVTGLGVVAA-VLMPPSYVA
A0A2V7MS64      HGTRPVSIASAQEPPPLAQWPRYVSAALRYKWLVVGA-TLVATAAGVGAS-FLLAPEYVA
A0A2V7Q7N9      ARNRPPP--PPPDPEPLAEWQRYLLAARRYRWLVFGV-TLLGTAAGIGLS-LLLPPTYLA
A0A2V7IRW6      ARYAPPAAGAPQDGDVLADLRRYLSAVWRYKWAVTGI-TVLGTAAGVAGK-MLLPPNYVA
A0A1Q7DVU6      ARYAPPAAGAPRDADALAELRRYLSAVWRYKWAVAGV-TVLGTAAGVAGK-MLLAPSYVA
A0A1Q7JSV2      ARYAPPAAGAPRDADALAELRRYLSAVWRYKWAVAGV-TVLGTAAGVAGK-MLLAPSYVA
A0A2V7QN41      PAPSTADVASRTGPPGETDWQHYFGAVRRRKWTVIGV-TLLGTALGLFAS-RLLHPPYSA
A0A2V7R603      PALPAGDVVSRAGAPGETDWQHYIGAVRRRKWTVIAI-TLLGTALGLFAS-RLLHPPYSA
A0A2V7LJS2      ASDSVADRGELDAPVSTVRLDDLFAVLRRHIRLVLGV-TAAAMMAAGYVA-YVTGSVYRA
A0A1Q7GLJ7      PSRRLADRADPEAFVHTVGLEELLSTLRRHVWLVLGV-AAVAVAATGFVA-YTTGPVYRA
A0A2V7GRE3      ASSFHGDR-EPEVSVRTVRLEELLAILRRHVRLVVGV-VVATVTAAGVVA-YVTGPAYRA
A0A2V7EU00      ----------ATPDDAAVDWRRYWAAIVRYRWWVVLC-TALGLVGGFVAA-SVLKPQYRA
A0A1Q6WE01      ARVTTAPDPVASPFEQGVDWRRCWGAVRRHRWWILGC-AVLGTAGGVVGA-RMRPPRYQA
A0A2V7S9K3      AGNGLRLDPLAAAGEPFLDWRRSWAAALRYRWWVVGF-MGLGVLGGLAAS-RFLPPRYLA
A0A1Q7DXB9      TRYDQPP---RLLPAVEPDWRRIFGAIRRRRWVVLGV-TLLGTVAGVVAAAKFVGPRYLA
A0A1Q7JD32      TRYDQPP---RLLPAVEPDWRRIFGAIRRRRWVVLGV-TLLGTVAGVVAAAKFVGPRYLA
A0A2V7MVP8      RPYAEPP---RPLAAGEPDWHRILGAIRRRRWLVLAV-TLLGTAAGVVAAVRFVGPRYLA
A0A2V7N0A9      VRRSEAA-------PLPDDWRRVVAAIGTYRWFVVAV-TAAGTLVGAVAA-HFLKPTYQA
A0A1Q7DLS9      ARRRSPP---MVEAAPDVDWGRYRTAIWRFRWWVLLI-TLLGTAAGVGAS-RIVRPVYVA
A0A1Q7JK96      ARRRSPP---MVEAAPDVDWGRYRTAIWRFRWWVLLI-TLLGTAAGVGAS-RIVRPVYVA
A0A2V7KQV7      FQTGFQA---AAAPAPMSDWARVFAAARRYKMLVATV-TVVGSLAGLVIG-KFLKPVYQA
A0A1Q7JGF6      RRDEAPP---------PEDWRRVVTAIRTYRWLVIAV-TGVGTLAGIIGA-RFLKPTYQA
A0A2V7SG67      RRDEAPP---------PEDWRRVVTAIRTYRWLVIAV-TGVGTLAGIIGA-RFLKPTYQA
A0A1Q7GIK9      ARPKGPSVYPAVVPAGPDDWRRVFAAMRTSRWLILAV-TAVGTLAGIVGS-RFLKPTYEA
                                                 :                       :  

A0A2D5ZJF2      TSRIYVEQSGPKVITEFEGVMTQSKNYLYTQAEIFLS-----------TEVLRPVAEAAE
A0A0S8H9P3      TLTLQVGDPRGRMGQLGDIDVTPNMLWTDPVESEVQQ--------------LTTQAVAQY
A0A1E4BBP7      SASIWIAATPG------------PSGRMGPVSAPGLV-----NSDVAWMELARSFSVLDK
A0A3M2G737      TATIALKNKSGNLNPYPVYRDPAKINNELVILKSRRL-------AETIADSLLKRVYIDP
A0A0H4TUX7      RLTVQVSSPKQVFAQLEGMRVDELALQTDPVLSEALI--------------LTTQQLALE
A0A1G0LUG0      QLTVQISSPRGVFSQLNDRTVDELALQTDPVLSEALV--------------LTTQALALQ
A0A1Q7E3T7      IAVIRLSDPRRALTGGVADGPTGDLA---GSSADPLL---------SQVELLTSRRVGGV
A0A1G0L906      SATVQVSSKKQALTPLEAMRVDEMSMQTDPVLSEALV--------------LSTQALALR
A0A1G0LCC0      SATVQVSSKKQALTPLEAMRVDEMSMQTDPVLSEALV--------------LSTQALALR
A0A2D5ZJE2      QTTLLIEPQDAGALSIFDPT---------GFMKQKIL-------INNECELLRSRSLAQQ
A0A3M2G624      TVYLEVDEKETNIRLLPQFSSVRQQSIYWGSPEGKII------------AEVLSTSVIEE
W0RI74          NATIFSSGSGNEKPS--------------MINPAQLT-----G-NAGWRDLFQSFAIIDP
A0A3M2BJA6      ATTIRIEEERANLPVLDILQELSSGS----------------Q-VETEMEVLRSRTLAED
A0A3D4VBZ5      QATILLEQGTG-------VNNGAGRG---PIQAAELL-----Q-ASGWQDLLRSYAIADP
C1A5W1          QATILLEQGTG-------VNNGAGRG---PIQAAELL-----Q-ASGWQDLLRSYAIADP
A0A2V7PX99      RAVLWIEAAGRA--------PGRDGG---SIVDEALV-----Q-TPSWGELVTSGAVLED
A0A2V7ERC7      QATIWIN-----------GARGQQAG---SIGTQQLL-----E-QTSWVELLRSFAVVDA
A0A2V7HBX4      QATVWISTTPS-------SA--LQTG---PIRQQQLL-----T-TGSWVELLRSFAIVDP
A0A2V7JTZ5      QATVWISTTPS-------SA--LQTG---PIRQQQLL-----T-TGSWVELLRSFAIVDP
A0A3D4YTR6      DATIWINTTPN-------GTQQTQTG---PIRQPQLL-----T-SVSWVELLRSFAVVDP
A0A2V7F1M1      TATVRLAYPRRALTVGVEDLPAKDQR------SDPLL---------SLIELLRGRGIVGA
A0A2V7KXK7      KAILWVDVA-----------VGRDRG----VQSDQLL-----D-SRGWEELVVSNAVLDT
A0A2V7QDU7      EAAIRMDDRRQ------------------PIPTLDVLALYRGNELSTEIEMLGSRTLAED
A0A2V7ITT6      QATIWIESHDP---------RTEDRG---PIRGDQLL-----Q-ASSWLQLLRSYVVLDH
A0A2V7NJW1      QATIWIESHDP---------RTEDRG---PIRGDQLL-----Q-ASSWLQLLRSYVVLDH
A0A2V7GFB5      QVTVFIDQPDP---------RGNDRGG--PIRSGQVL-----D-PESWIDLLRSYAVLDR
A0A2V7RQ86      QVTVFIDQPDP---------RGNDRGG--PIRSGQVL-----D-PESWIDLLRSYAVLDR
A0A2V7IWX2      RARLWVGAAEPN--------PNALRGTTPPPGAERLL-----G-VAAWVDFVRSDAVLDT
A0A1Q7KE95      QATIWIQSSEPR--------GGTSRG---PIGANQLF-----E-SYAWGELLKSYVVLDE
A0A1Q7T8X5      QATIWIQSSEPR--------GGTSRG---PIGANQLF-----E-SYAWGELLKSYVVLDE
A0A2V7FK98      QATLWIDQPDQR--------GGQDRG---PIRAGQPL-----E-PEAWLDLLKSYRVLDQ
A0A2V7R3Z8      QATLWIDQPDQR--------GGQERG---PIRAGQPL-----E-PEAWLDLLKSYRVLDQ
A0A2V7J3C0      QATIWIQSSEP---------RGTGRG---PIGANQLF-----E-SYAWVDLLKSYVVLDQ
A0A2V7KWV9      QATIWIQSSEAR--------GTPDRG---PIGANQLL-----A-PTAWGDLLKSYVVLDA
A0A1Q6ZHP2      QAKIWIDVEGR---------RGPERGPT-PIRSGQLL-----D-AESWVDLLESYVVLDQ
A0A1Q7R6Z6      QAKIWIDVEGR---------RGPERGPT-PIRSGQLL-----D-AESWVDLLESYVVLDQ
A0A2V7FYT7      QAKIWIDVEGR---------RGPERGPT-PIRSGQLL-----D-AESWVDLLESYVVLDQ
A0A2V7IGR0      QATIWIDQADR---------RGPDRGPT-PIRSGQLL-----E-PEAWVDLLRSYIVLDQ
A0A2V7MR23      QAKIWIDVEGR---------RSPDRSLA-PIRPGQLL-----D-AESWVDLLRSYVVLDQ
A0A2V7L1V3      QATIWIDATERER-----WGQAQDRG---PIRQGQLL-----D-PQSWVDLLKSYVVLDT
A0A1Q7E5D3      QATVWIDGPDR---------RGPDRG---PIRPGQLL-----D-PEAWVELLKSYVVLDE
A0A2V7ISE2      QAKIWIDVEGR---------RGPDRGPA-PIRPSQLL-----D-AESWVDLLKSYVVLDQ
A0A1Q7J2X5      QAKIWIDVEGR---------RGPDRGPA-PIRPGQLL-----D-AESWVDLLKSYVVLDQ
A0A2V7NPD1      QAKIWIDVEGR---------RGPDRGPA-PIRPSQLL-----D-AESWVDLLKSYVVLDQ
A0A2V7QPD8      QATLWIDQPDQR--------GGQERG---PIRSGQAL-----E-PEAWLDLLKSYRVLDQ
A0A2V7Q8M6      QATIWIDATESER-----WGQGQDRG---PIRQGQLL-----D-PQAWVDLLKSYVVLDQ
A0A2V7QBC3      QSTIWIDATESER-----WGQGQDRG---PIRQGQLL-----D-PQAWVDLLKSYVVLDQ
A0A2V7LMU1      QATIWIDATERER-----WGQGQDRG---PIRQGQLL-----D-PQAWVDLLKSYVVLDQ
A0A2V7PBY9      QATIWIDASERER-------RADDRG---PIRQGQLL-----D-AQAWVDLLKSYVVLDQ
A0A3M2BLV5      EMAVQVTDPLERA-----RSLTSPTR---VSGMDIFV-----DPMQSQIEVLQSRSIAER
A0A2V7KS68      QANVWVDVPGRAEG----DRSADNRG---PIRTAALL-----E-ADDWIELLRSYIVLDQ
A0A2V7N4L3      QANVWVDVPDR-RG----ENPSDARG---PIRQGALL-----D-ADAWVELMRSYVVLDQ
A0A1Q7AZK2      QANVWVDVPDR-RG----NGSSDARG---PIRQGALL-----D-ADAWVELLRSYVVLDQ
A0A1Q7TNP7      QANVWVDVPDR-RG----NGSSDARG---PIRQGALL-----D-ADAWVELLRSYVVLDQ
A0A1Q7KG39      QANVWVDVPDR-RG----NGSSDARG---PIRQGALL-----D-ADAWVELLRSYVVLDQ
A0A1Q7GX75      QANVWVDVLDR-RG----EGGAEARG---PIQQRALL-----D-EDAWVELLRSYIVLDQ
A0A1Q7LL80      QANVWVDVLDR-RG----EGGAEARG---PIQQRALL-----D-EDAWVELLRSYIVLDQ
A0A2V7PFU2      QANVWVDVPDR-RG----DPHADTRG---PIRQGALL-----D-ADAWVELLRSYVVMDQ
A0A2V7MFS9      QANVWVDVPDR-RG----EGPSDARG---PIRQGALL-----D-ADAWVELLRSYIVLDQ
A0A2V7T933      QANVWVDVPDR-RG----NGSSDARG---PIRQGALL-----D-ADAWVELLRSYVVLDQ
A0A2V7J4D7      QATLWIQVPARQ------P---REAG---PIWQAQLP-----I-STGWMDLLQSYAVLDD
A0A2V7LN90      RATVWIQVPSAR------ARDIRDRG---PIWQGQLP-----I-TSGWMDLLQTNVVLED
A0A2V7LFN9      RATVWIQVPAHQ------A---RDEG---PIWSGHLP-----I-SSGWIDLIRTNIVLEE
A0A2V7MEK4      RATVWIQVPAHQ------A---RDEG---PIWSGHLP-----I-SSGWIDLIRTNIVLEE
A0A2V7P8B1      VAVIRLSDPRRAFTGGVVEDPALLAD---GRYADPLL-----S-Q---VELLKSRTVAGG
A0A2V7R2W8      QAIVWIRVP---N-----KEP-RNEG---PIWQGQLP-----I-SSGWMELLQSYAVLDY
A0A2V7MS64      RATVWISIS---A-----HPAPRDQG---PIWSGQLP-----I-STGWTDLLRTNVVLEE
A0A2V7Q7N9      RATVWVQVPSGHA-----RDA-RDRG---PIWQGQLP-----I-SSGWMDLLQTNVVLED
A0A2V7IRW6      RATVWIQVP---A-----RPT-RDEG---PIWSGQLP-----I-SSGWTDLLHTNVVLEE
A0A1Q7DVU6      RATVWIQVP---Q-----RPT-RDEG---PIWSGQLP-----I-SSGWTDLLQTNVVLED
A0A1Q7JSV2      RATVWIQVP---Q-----RPT-RDEG---PIWSGQLP-----I-SSGWTDLLQTNVVLED
A0A2V7QN41      TALLWFETKDRAAAA---RDPRTASE------ADELL-----N-PSGWIDLVESNAVLEE
A0A2V7R603      TALLWFETKDRAAAG---RDPRTASE------ADELL-----N-PSGWIDLVESNAVLEE
A0A2V7LJS2      VAVIRLSDPRRAFTGGVVDDPALLAD---GRYADPLL-----S-Q---VELLKSRTVAGG
A0A1Q7GLJ7      VAVIRLSDPRRALTGGVVEDPGPSAD---ERFADPLL-----S-Q---VELLTSGTVAGA
A0A2V7GRE3      VAVIRMSDARRALTGGVVLDPA-RAD---ERFSDPLL-----S-Q---AELLTSRAVAGA
A0A2V7EU00      QATVWIDVAKERQD----A----TRG---PIRQGQLL-----E-ATAWVDLLQSYAVLDD
A0A1Q6WE01      QATIWIQAGEPR-G----P----DRG---PIGANRLL-----D-ASAWVDLLKSYVVLDD
A0A2V7S9K3      QATIWIQTSEPR-A----T----DRG---PIGANQLL-----E-ASAWVDLLKSYVVLDD
A0A1Q7DXB9      RARLWVGAAEPDPN----AIR--GTT---PAPGAERL-----LGVEAWVDFVRSDAVLDT
A0A1Q7JD32      RARLWVGAAEPDPN----AIR--GTT---PAPGAERL-----LGVEAWVDFVRSDAVLDT
A0A2V7MVP8      RARLWVGAAEPDPN----ALR--GTT---PLPGTDRL-----LGVEAWVDFVRSDAVLDT
A0A2V7N0A9      RATVWVEVPNPAAR----ER---DQG---PIETGQLL-----GTATSWLDLLRSHVVLDD
A0A1Q7DLS9      RATIWIEGANEKQP---------GPG---PAGSGDLL-----G-ATGWVDLVRSYVVVAA
A0A1Q7JK96      RATIWIEGANEKQP---------GPG---PAGSGDLL-----G-ATGWVDLVRSYVVVAA
A0A2V7KQV7      QATIWIQSSEQD-H----DRGRADQG---PIQSAQLL-----GTSGGWLDLIRSHVVLND
A0A1Q7JGF6      RATVWLEIPDQSAH----ER---DQG---PFQSGQLL-----GTATGWLDLLRSHVVLDD
A0A2V7SG67      RATVWLEIPDQSAH----ER---DQG---PFQSGQLL-----GTATGWLDLLRSHVVLDD
A0A1Q7GIK9      RATVWLEIPDEASH----AR---ERG---PIESGELF-----PTATGWLDLLRSHVVLDD
                   :                                                        

A0A2D5ZJF2      DAKTRILSSRT--------------RATKGSTTSVAEESVQEVGQPEQGANGALLQRRQI
A0A0S8H9P3      VADTLQLRARS--------------PDISRDLLLSGVRIDR---EAPSGDYRIRVGSDGS
A0A1E4BBP7      VVSKLALYVYP--------------DVAADTLVVRDLYPSD---SLQPGPYRLTIQGSSY
A0A3M2G737      ETKNEKLHIIH-------------------------------------------------
A0A0H4TUX7      VVRGLALHLEL------------DDPGLRRGDLFAAVAVDS---TTPPGAYRLTVQPTSG
A0A1G0LUG0      VVDALQLQVEL------------TDPRLRRDDVIAAIAVDS---SSTPGRFALVRRGPDG
A0A1Q7E3T7      VVDSMLMLRVR--------------ARNFPTSILAVVQLPS---DVGGDSLRLEFNRDSL
A0A1G0L906      VVDAIGLRLAM------------DDWRLSRTTFLYDAQVDT---LARPDSFVLELKGTGY
A0A1G0LCC0      VVDAIGLRLAM------------DDWRLSRTTFLYDAQVDT---LARPDSFVLELKGTGY
A0A2D5ZJE2      VLD---------------------------------------------------------
A0A3M2G624      VVQMLDLDKAV--------------HSISPNLSFSMTNIQS--HNAPLGTYRVHILDNQH
W0RI74          VVQKLSLYIQP--------------AKASDSLLFATFQIDPVKKQFRPGTYTLKTERGRF
A0A3M2BJA6      VVDSLNLQVEI------------IEPRGVSRAVLLDRLVAE---RWAPEG-EFLIEPGGD
A0A3D4VBZ5      VVIGLGLFVTP--------------AVVADSVLFRTFRVDQ--SRLRPGDYKLTIAGERY
C1A5W1          VVIGLGLFVTP--------------AVVADSVLFRTFRVDQ--SRLRPGDYKLTIAGERY
A0A2V7PX99      VVRELRLYVTP--------------KSPADAPVFAGFGLGK---MVRPGRYELVVDRGAR
A0A2V7ERC7      VVHQLKLNVVY--------------KVPGDSLLFRTFQTGT---TPFYGSYVLQIDRSGR
A0A2V7HBX4      IVRDLKLNVSY--------------KQPSDSVLFRNFEWTP---ATRSGAYLLKIDGAGP
A0A2V7JTZ5      IVRDLKLNVSY--------------KQPSDSVLFRNFEWTP---ATRSGAYLLKIDGAGP
A0A3D4YTR6      VVRDLKLNVSY---------------TPADSALYANFVWTP---ATRSGAYALKIDEHGR
A0A2V7F1M1      VVDSLALRLQPLGSRFGG-------SSRVVRAALRDVRVSP---GAQQDTLRLTFGGDRV
A0A2V7KXK7      VVKERRLFIHP--------------ETPQDSAALTTFDITD---RVAPGDYRVVVDKAGR
A0A2V7QDU7      VVAALGLQLEI-----------TKPRAVLREEVFASVRVTR---DAPAATYRLEPADSDG
A0A2V7ITT6      VVRDLRLYVTP--------------ALPADSDLFQSFEVAA---PFRPGAYRLAVDESGR
A0A2V7NJW1      VVRDLRLYVTP--------------ALPADSDLFQSFEVAA---PFRPGAYRLAVDESGR
A0A2V7GFB5      VARDLRLFLQL--------------PKGPD-PALRSLNVAD---QFRPGAYRLTTD-AAR
A0A2V7RQ86      VARDLRLFLQL--------------PKGPD-PALRSLNVAD---QFRPGAYRLTTD-AAR
A0A2V7IWX2      VVRDVRLYLDP--------------RTPLDGTALLRFGLKD---QVLPGRYRLEVDRDGA
A0A1Q7KE95      VARERRLYLAP--------------Q-HGWAGAFAGFTVSD---TYRPGRYRVVVDGTGR
A0A1Q7T8X5      VARERRLYLAP--------------Q-HGWAGAFAGFTVSD---TYRPGRYRVVVDGTGR
A0A2V7FK98      VVRDQRLFLTP--------------KAREDAPLFETFRVAE---QYRPGVYRLALDGSAR
A0A2V7R3Z8      VVRDQRLFVTP--------------RAREDAPVFEAFRVAE---QYRPGVYRLALDGSGK
A0A2V7J3C0      VARDLKLYLTP--------------ERGANG-AFAGFEVGD---TYRPGRYRIVADRTGR
A0A2V7KWV9      VARERRLYLQA--------------RPR-DLPALAGFAVAD---QFTPGRYHLTIDHDGQ
A0A1Q6ZHP2      VVRDQRLYVSP--------------NAPADAQAVAKLGVAD---QFQAGAYRFTVDHSGQ
A0A1Q7R6Z6      VVRDQRLYVSP--------------NAPADAQAVAKLGVAD---QFQAGAYRFTVDHSGQ
A0A2V7FYT7      VVRDQRLYVSP--------------NAPADAQAVAKLGVAD---QFQAGAYRFTVDHSGQ
A0A2V7IGR0      VVREQRLFLTV--------------RPLADSVALGTFGVAD---QYRPGKYRLTVDSTGQ
A0A2V7MR23      VVHDQRLFVGS--------------AARADTQAIDRIRVAD---QYQPGAYRLSVDRSGQ
A0A2V7L1V3      VVRDQRLFVSP--------------KSRADEDVLASLRVTG---QYRPGTYRLKVDSDRR
A0A1Q7E5D3      VVREQRLFLGL--------------GSPADAHVFDAFRPAE---QYRPGAYRLKVDATGQ
A0A2V7ISE2      VVRDERLFVDP--------------SSPADAQALEGLRVAD---QYRPGAYRFTVDRAGQ
A0A1Q7J2X5      VVRDERLFVAP--------------SSPADAQAVEGLRVAD---QYRPGAYRFTVDRSGQ
A0A2V7NPD1      VVRDERLFVDP--------------SSPADAQALEGLRVAD---QYRPGAYRFTVDHAGQ
A0A2V7QPD8      VVRDQRLFLTT--------------KAREDAPLLETFRVAE---QYRPGAYRLAVDGSGK
A0A2V7Q8M6      VVRDQRLFVSP--------------KSRVDEAVLATLQVTG---QYRPGVYRLKVDSDRR
A0A2V7QBC3      VVRDQRLFVSP--------------KSRADEGVLATLQVTG---QYRPGVYRLKVDSDRR
A0A2V7LMU1      VVRDQRLFVSP--------------ESRADEPLVATLQVTG---QYRPGAYRLKVDSDRR
A0A2V7PBY9      VARDQRMFVSP--------------KSRADARFLTTFQTAG---QYRPGAYRLSLDADRQ
A0A3M2BLV5      VADELGLRLRR------------RGTNTVRSELFSDAVVTD---EAEPGWYELRYSADGA
A0A2V7KS68      VVRDLRLYLTV--------------KRPAERAIFSTFNVAD---DFRPGLYRLRASADGR
A0A2V7N4L3      VVKDQRLYLET--------------KRASDRGNFVAFRVDD---TFRPGDYRLNISDNGR
A0A1Q7AZK2      VVRDLRLYLKV--------------KRTSDRATFDAFRVND---IFRPGDYRLSVSDDGR
A0A1Q7TNP7      VVRDLRLYLKV--------------KRTSDRATFDAFRVND---IFRPGDYRLSVSDDGR
A0A1Q7KG39      VVRDLRLYLKV--------------KRTSDRATFDAFRVND---IFRPGDYRLSVSDDGR
A0A1Q7GX75      VVRDLRLYLAV--------------KRPADQATFVGFRVND---TFRPGQYAFSVSADGR
A0A1Q7LL80      VVRDLRLYLAV--------------KRPADQATFVGFRVND---TFRPGQYAFSVSADGR
A0A2V7PFU2      VVRDLRLYLDV--------------KRLGDRPSFAGFSVSD---DFRPGEYRLNISDNGR
A0A2V7MFS9      VVRDLRLYLEV--------------KRPADRPSFSGFGVAD---AFRPGAYRLSVSDDSK
A0A2V7T933      VVRDLRLYLKV--------------KRTSDRATFDAFRVND---IFRPGDYRLSVSDDGR
A0A2V7J4D7      VVRGQRLYLHA--------------KVPGDSDILATLRIKD---HVAPGKYRLVVEDTGD
A0A2V7LN90      VVRRHRLYLTP--------------RQPGDTDALATFGIKP---HVRPALYRLVVDSIGK
A0A2V7LFN9      VARRERLYLV---------------NVSGDSAALTSFAIKE---RVRPGTYLLAVDTVGT
A0A2V7MEK4      VARRERLYLV---------------NVSGDSAALTSFAIKE---RVRPGTYLLAVDTVGT
A0A2V7P8B1      VVDSMPM-LRVLLRKASPSLLDRVLRRRFSTSLLGSVAVAA---DAPADSIELAFDQDGF
A0A2V7R2W8      AVRSRRLYLHP--------------GLPGDSDVLGTLAIKE---HVLPGEYRLVVDDTAP
A0A2V7MS64      VVRARQLYLTP--------------KEPADSDLFSGFRAAD---RIRPGRYYLVIDATGH
A0A2V7Q7N9      VVRRQRLYVTA--------------RRPGDSDALATFEIKD---RVRPGVYRLVVDTAGN
A0A2V7IRW6      VVRQQRLYVAP--------------QEPRDSDALAGFGIKD---RVRGGTYRLVVNDGGT
A0A1Q7DVU6      VVRQQRLYVTP--------------KEPGDADALTGFGIKD---RVRGGTYRLVVNDAGT
A0A1Q7JSV2      VVRQQRLYVTP--------------KEPGDADALTGFGIKD---RVRGGTYRLVVNDAGT
A0A2V7QN41      VVRQRRLYLRP--------------GNPVDSSVLATLRLDG---TPLPGAYRYSVDREGR
A0A2V7R603      VVRQRRLYLRA--------------RDPADSSGLATLRLDG---TPVPGAYRYTLDREGR
A0A2V7LJS2      VVDSMPM-LRVVLRKSSPSLLDRVLRRRFSPNLLGVVAVRP---DAAADSLSLTFERDGF
A0A1Q7GLJ7      VVDSVPM-LRV------------L-TRKFSPSLLGGVAVAA---DSAAHSFQLTFGRDDF
A0A2V7GRE3      VVDSMPA-LRM------------VTTRDLPLSFLGEVAVPA---AAGPVSLQIAFGRDSF
A0A2V7EU00      VVRQRRLYLTP--------------GARGDSLAFASFDMGE---RFRSGNYRLSVDASGK
A0A1Q6WE01      VVRDRQLYLGV--------------VAR-DTRALTGFAVGD---PVMPGRYRVVLDRSGS
A0A2V7S9K3      VVRELRLYLRV--------------DPR-RSPVFAEFTVSD---EFRPGQYRLVVDQAGR
A0A1Q7DXB9      VVREVRLYLSP--------------KTPIDGTALLGLRLKD---QVLPGRYRLEVDRDGQ
A0A1Q7JD32      VVREVRLYLSP--------------KTPIDGTALLGLRLKD---QVLPGRYRLEVDRDGQ
A0A2V7MVP8      VVRDARLYLFP--------------RTPADSAALVAFGLKA---RVVPGRYRLEVDRQAR
A0A2V7N0A9      VVRQWRLYLKP--------------QSPADTAALATFAVPG---DVRPGRYRLQVDATGH
A0A1Q7DLS9      VVNDRQLYLTP--------------ASPSDSAVFAGFSVAP---RFRPGSYRLEVDQAGR
A0A1Q7JK96      VVNDRQLYLTP--------------ASPSDSAVFAGFSVAP---RFRPGSYRLEVDQAGR
A0A2V7KQV7      VVREARLYLAP--------------KSRADSAALATLTVFG---DVRPGTYRLEVDQTGQ
A0A1Q7JGF6      VVRQWRLYLKP--------------QSAADSAALATLTVTG---DVRPGRYRLQVAAAAN
A0A2V7SG67      VVRQWRLYLKP--------------QSAADSAALATLTVPG---DVRPGRYRLEVAAAAN
A0A1Q7GIK9      VVRRWRLYLKP--------------KSAADSAALATLTVPG---DVRPGHYRLVLDRAGK
                                                                            

A0A2D5ZJF2      ------------LEGVADLLAFFAKTFNDTGGSTAVASDESEEEP---DEGKQVVFYDRL
A0A0S8H9P3      V-----------FIEPGSGAPAVRGQVGEPIEFTAGSLVVRPQ-----IEPGDYRV----
A0A1E4BBP7      V--LARPA----QQRGEQDVVVERGAVGDSIG-RAVGFQWQPSAQLL-AGREQVGF----
A0A3M2G737      ---------------------------------RRV------------ESNGHVDY----
A0A0H4TUX7      F-----------EVRDGFGTVVAQGQPGETVVGPGFTLRLVPS-----PEARTVGF----
A0A1G0LUG0      Y-----------EVQDASGAAVGGGAYSQPVTVSGVTLTVQPT-----TSEDVVPF----
A0A1Q7E3T7      T-----------VLGRSRAIRTSYGTSVELDG-MRFTVVARPTVERG-------TI----
A0A1G0L906      Q-----------LRSVAGGTLVAAGGYDV----PAVGSGFSFRVREYRGDPRSVRI----
A0A1G0LCC0      Q-----------LRSVAGGTLVAAGGYDV----PAVGSGFSFRVREYRGDPRSVRI----
A0A2D5ZJE2      ---------------------------------RAMREGWTPPPESD-------------
A0A3M2G624      Y-----------VVYDTANRELGRGISGVPFQHEFFEFTISNIEG---PPQSEFYF----
W0RI74          S-----------LTDK-VGFTHEVGTVGDSVG-RSAGFAWVPPARLLGTRSREVEF----
A0A3M2BJA6      A-----------FRITDEETLESLGEVSERLPAALAGVTFTLTEAAR-DYPR-IRV----
A0A3D4VBZ5      VLNLQ------------PGVEVEKGVVGDSIG-RPVGFQWQPVAGQF-GRRTEVVF----
C1A5W1          VLNLQ------------PGVEVEKGVVGDSIG-RPVGFQWQPVAGQF-GRRTEVVF----
A0A2V7PX99      ---YE-------LLDQ-NGALVERGAVGDSVG-RSVGFSWAPSSSML-LEGRRITF----
A0A2V7ERC7      G--YT-------LATA-TGRILESGTVGDSVG-RKMGFFWNPDPALL-PPGRLIAF----
A0A2V7HBX4      K--YM-------LSTA-KGVFIESGAIGDSIG-RKAGMNWLPDARFL-GRGRAIEF----
A0A2V7JTZ5      K--YM-------LSTA-KGVFIESGAIGDSIG-RKAGMNWLPDARFL-GRGRAIEF----
A0A3D4YTR6      S--YV-------LSTA-TGTVLERGAVGDSVG-RKIGMSWLPDRRLL-GANSIFKF----
A0A2V7F1M1      T---------------------AQGLQGEAQS----------PYGTP-LAVGSVQF----
A0A2V7KXK7      A--FR--------LELEDGTVVQRGRVGQPVG-ESVGFDWTPTAAML-KPGTTVKF----
A0A2V7QDU7      ---FV-------VRNDSSEAVLGRTVPGKPLTFAGVELEVSPHALGL-GP---VAF----
A0A2V7ITT6      A--FT-------LFTT-AGDSLQHAAVGDSIG-NGLGFRWTARAGAL-LPGRVVDF----
A0A2V7NJW1      A--FT-------LFTT-AGDSLQHAAVGDSIG-NGLGFRWTARAGAL-LPGRVVDF----
A0A2V7GFB5      A--YV-------LAKV-DGAVLERGTVGDSIG-RSIGFLWAPPAESL-PPGHTVEF----
A0A2V7RQ86      A--YV-------LAKV-DGAVLERGTVGDSIG-RSIGFLWAPPAESL-PPGHTVEF----
A0A2V7IWX2      G--FT-------LFSA-QGGVVQHGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF----
A0A1Q7KE95      N--FR-------LAGA-GGEGLQEGAIGDSVG-AALGFRWVPTAAVL-PAGSDLTF----
A0A1Q7T8X5      N--FR-------LAGA-GGEGLQEGAIGDSVG-AALGFRWVPTAAVL-PAGSDLTF----
A0A2V7FK98      T--FT-------LSTD-KGVEVEHGAVGDSIG-ARLGFTWAPPAGTV-PAGRTIEF----
A0A2V7R3Z8      T--FT-------LSTD-KGVEVEHGAAGDSIG-ARLGFVWAPPAGTV-PAGRTIEF----
A0A2V7J3C0      S--FS-------LLGA-KGEELQQGAIGDSIG-AALGFRWAPAAAAL-HAGSDLTF----
A0A2V7KWV9      T--FH-------LQRE-DGTELEQGAVGSPVG-RTLGFIWTPTTAVL-TPGREVRF----
A0A1Q6ZHP2      G--YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF----
A0A1Q7R6Z6      G--YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF----
A0A2V7FYT7      G--YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF----
A0A2V7IGR0      H--YT-------LADG-EGVALEHGVVGDSVG-ARLGFLWVPTRDAL-GAGRTVRF----
A0A2V7MR23      G--YT-------LSTA-DGVELERGSFGDSVG-TRYGLRWAPDASTV-PPGHTVEF----
A0A2V7L1V3      S--YT-------LSTAPENQVVERGTVGDSIG-IKLGFVWAPAAGAL-PADRTIEF----
A0A1Q7E5D3      N--WT-------LATE-DGIDLERGAVGDSIG-GRVGFHWAPGLGVL-TPGRSVGF----
A0A2V7ISE2      G--YT-------LATA-DGIELERGTLGDSVG-TRYGLQWAPDAGTV-APGRTVEF----
A0A1Q7J2X5      G--YT-------LGTA-DGIELERGTLGDSVG-TRYGLQWAPDAGTV-APGRTVEF----
A0A2V7NPD1      G--YT-------LATA-DGIELERGTLGDSVG-TRYGLQWAPDAGSV-APGRTVEF----
A0A2V7QPD8      A--FT-------LSTD-KGVEVEHGAVGDSIG-ARLGFTWAPPAGTI-PAGRTIEF----
A0A2V7Q8M6      S--YA-------LATV-EGQVLERGTVGDSIG-TRLGLAWAPAATTL-PADRAVEF----
A0A2V7QBC3      S--YA-------LATL-EGQVVERGTVGDSIG-TRLGLAWAPAASTL-PTDRAVEF----
A0A2V7LMU1      T--YT-------LATV-EGQVVERGTVGDSIG-TRLGLAWAPAASTL-PTDRAVGF----
A0A2V7PBY9      S--YT-------LATV-EGRVLEQGRVGDSIG-TRLGFAWAPTAATL-PPDRAVEF----
A0A3M2BLV5      S------------------AALVHAPTGDTVG--------TADAGEV-LEAPGLRF----
A0A2V7KS68      S--YT-------LSNKDG-VELERGTVGDSVG-RRLGFLWQPS--SL-PRDHAVEF----
A0A2V7N4L3      T--YT-------LASAEG-KELERGTVGDSVG-NRLGFRWVPAAGSL-PPGRTIEF----
A0A1Q7AZK2      Q--YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF----
A0A1Q7TNP7      Q--YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF----
A0A1Q7KG39      Q--YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF----
A0A1Q7GX75      E--YT-------LDGANG-VELERGMVGDSVG-RRLGFQWVPASGRL-APSRTVEF----
A0A1Q7LL80      E--YT-------LDGANG-VELERGMVGDSVG-RRLGFQWVPASGRL-APSRTVEF----
A0A2V7PFU2      Q--YT-------LTSAAG-LTLERGTVGDSVG-SRFGFRWVPAPGTL-PAGRSVEF----
A0A2V7MFS9      T--YT-------LAAAEG-VDLERGTVGDSVG-RRLGFRWVPGPESL-SPGRTIEF----
A0A2V7T933      Q--YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF----
A0A2V7J4D7      APHFT-------LYNARSKTPVQTGVAGDSVG-PDMGLAWVPPRAVL-AGPREVDF----
A0A2V7LN90      T--FT-------LSDKKHLV-QLHGTVGDSIG-AELGFAWVPPSGTL-TPGRLVDF----
A0A2V7LFN9      G--FT-------LTDDAGAV-LDRGAVGDSIG-AALGFAWVPPEGVL-LAGHVVEF----
A0A2V7MEK4      G--FT-------LTDDAGAV-LDRGAVGDSIG-AALGFAWVPPEGVL-LAGHVVEF----
A0A2V7P8B1      V--VG-------RPPGRR----------------------RAPYGTV-VEVGGVRF----
A0A2V7R2W8      R--FA-------LFAVSSLDPVARGGAGDSVA-PDLGLAWVPPAAAL-APGREVTF----
A0A2V7MS64      R--FA-------LQDKHK-TELQHGATGEPVG-TALGFLWTPPAEKL-TPGRRVEF----
A0A2V7Q7N9      T--FT-------LTDTKH-LVRLHGTVADSVG-PALGFAWVPPSGVL-TPGRTMEF----
A0A2V7IRW6      A--FT-------LEEMKA-GTVQHGVTGDSVG-AALGFAWVPPSAAL-SRGRRVEF----
A0A1Q7DVU6      A--FT-------LEEKKA-GVLQHGAAGDSVG-APLGFVWVPPAAAL-TRGRTVEF----
A0A1Q7JSV2      A--FT-------LEEKKA-GVLQHGAAGDSVG-APLGFVWVPPAAAL-TRGRTVEF----
A0A2V7QN41      T--FS-------LQNGGR--VVQTDSLATTVG-QGLGFSWSPARGLV-APGHAVDF----
A0A2V7R603      T--FT-------LQNGGR--VVQTDSVGTPAG-QGLGFSWSPPRGLV-A-GHSVDF----
A0A2V7LJS2      L--V--------GTGPAR---------------------RRAAYGTV-VEVGGVRF----
A0A1Q7GLJ7      V--VE-------GPAGQQ---------------------RRAAYGRV-VDLGVIRF----
A0A2V7GRE3      V--VR-------GTSG-Q---------------------WSAPYGSA-VESHDIRF----
A0A2V7EU00      N--FTLTAVGGVLMAVGG-VVLQRGTPGEAVG-DAIGFRWTPPAAAL-PAGASIAF----
A0A1Q6WE01      T--FR-------LLGDDG-VELQRGTVGDSIG-QAVGFRWAPAAAVL-PPGSEVTL----
A0A2V7S9K3      T--FR-------LEGRGG-AELQRGAVGDSVG-QALGFRWAPSATLL-APGTELPF----
A0A1Q7DXB9      A--FA-------LFS-AE-GVVQRGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF----
A0A1Q7JD32      A--FA-------LFS-AE-GVVQRGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF----
A0A2V7MVP8      G--FT-------VVAVGG-GVVQRGAVGDSVG-PALGFAWVPGKTVL-NPGRTIDF----
A0A2V7N0A9      S--FR-------LLDVDENAVLEQGAVGSNLG-VGLGFAWLPPAASL-RGGARVEF----
A0A1Q7DLS9      G--FT-------LATHDA-VVLQRGAAGDSVG-GALGFVWLPPAAEL-SPLRRLEF----
A0A1Q7JK96      G--FT-------LATHDA-VVLQRGAAGDSVG-GALGFVWLPPAAEL-SPLRRLDF----
A0A2V7KQV7      H--FT-------LRDVAENAVLQQGSVGDSVG-GLLGLAWVPPAGTL-RPRAVIRF----
A0A1Q7JGF6      R--FR-------LLDVDAKVVLQEGAVGDSVG-AALGFTWVPPAAVL-RPGASVQF----
A0A2V7SG67      R--FR-------LLDVDAKVVLQEGAVGDSVG-ATLGFTWVPPAAVL-RPGASVQF----
A0A1Q7GIK9      R--FR-------LLDADEKQVLQEATPGEAIG-AALGLVWVPPAGTV-QPGGRVDF----
                                                                            

A0A2D5ZJF2      KTFQDVDNIQVFLKKELEVKVGKKD-----------------------------DIISVS
A0A0S8H9P3      -HVISQLAAEAVVTGGLAASTRPET-----------------------------NLIDVT
A0A1E4BBP7      -YVVTPREAAFNLGSQLSVTVGQNS-----------------------------NLMRFQ
A0A3M2G737      -EPLNKRSVVRRLQSSASFSPIPQS-----------------------------DIIQIS
A0A0H4TUX7      -RLVRPEEAAAWVSGGLSYNVREGT-----------------------------NAVDIS
A0A1G0LUG0      -RITRREEAAAWVSGGLSYRVREAT-----------------------------NAVDIT
A0A1Q7E3T7      -SVVSREEAINGLLGGLRVTLRPHT-----------------------------DIFDVA
A0A1G0L906      -SIMPRIAAGNMVRGGIGFAVPPTT-----------------------------SLVNVT
A0A1G0LCC0      -SIMPRIAAGNMVRGGIGFAVPPTT-----------------------------SLVNVT
A0A2D5ZJE2      ----PMADWVEALRSRLSVSPLKDA-----------------------------DVITIK
A0A3M2G624      -TLYPLQRAVNSVRAATHAQATTRAAIQDNVAGGGIAGAASAKRSRKDAAIQDAGIVQVD
W0RI74          -TVLTPREASRDVQKRLAITIKQAS-----------------------------PVIGLT
A0A3M2BJA6      -RVLPFDKAVTKLQKALSVSRPNRD----------------------------AGIVTVR
A0A3D4VBZ5      -NVQTPREASRALIKKLALSLQDGS-----------------------------SFLFLR
C1A5W1          -NVQTPREASRALIKKLALSLQDGS-----------------------------SFLFLR
A0A2V7PX99      -NVSSPYEATQGLVKALRLKQDPGG-----------------------------SFLRIE
A0A2V7ERC7      -SVTTPRNTSLGLLASMRSTLPEDG-----------------------------QFLTIS
A0A2V7HBX4      -GVTSPRNVS--------------------------------------------QFLKIT
A0A2V7JTZ5      -GVTSPRNVSVFLVNAVHASLPEDG-----------------------------QFLKIT
A0A3D4YTR6      -AVSSPRNTSASLVAAVHATLPEDG-----------------------------QFLKIT
A0A2V7F1M1      -TIPSPPSVKAGALAVRSREEVIDDVLKSLAVLRRK----------------STDIVDVT
A0A2V7KXK7      -GVSAITDASASLAKSIKTRLDPDG-----------------------------NFLRLQ
A0A2V7QDU7      -SVVAFDDAVRGLRKALSIKRRNRE----------------------------ANIVDVG
A0A2V7ITT6      -TVGTPRSAAEQLARRLRAKTDEAG-----------------------------NFLSVQ
A0A2V7NJW1      -TVGTPRSAAEQLARRLRAKTDEAG-----------------------------NFLSVQ
A0A2V7GFB5      -RLQTAREAALHLSDALDAHMDYNG-----------------------------NFLKIE
A0A2V7RQ86      -RLQTAREAALHLSDALDAHMDYNG-----------------------------NFLKIE
A0A2V7IWX2      -TLLTPHDAAELLASQLQVTTDPEG-----------------------------TFVTVQ
A0A1Q7KE95      -TVRPLRDAARQLGNALTVTMDQGG-----------------------------NFLRVG
A0A1Q7T8X5      -TVRPLRDAARQLGNALTVTMDQGG-----------------------------NFLRVG
A0A2V7FK98      -SVATVRDSARALSDELEVATDPAG-----------------------------NFLRMH
A0A2V7R3Z8      -SVATVRDSARALSEELEVATDPAG-----------------------------NFLRMH
A0A2V7J3C0      -TVRPLRDAARKLANSLAVTLDPGG-----------------------------NFLRIG
A0A2V7KWV9      -VVSPLRDAAKKLADNLNVTLDLSG-----------------------------NFLRVA
A0A1Q6ZHP2      -TLTTLRDAATSLGEGLDARMDQEG-----------------------------SFLRLE
A0A1Q7R6Z6      -TLTTLRDAATSLGEGLDARMDQEG-----------------------------SFLRLE
A0A2V7FYT7      -TLTTLRDAATSLGEGLDARMDQEG-----------------------------SFLRLE
A0A2V7IGR0      -ALATVRDGARHLDEALDVRAAPDG-----------------------------SFLHIE
A0A2V7MR23      -TLTTLRDAATSLADALDTWMDIDG-----------------------------NFLRIE
A0A2V7L1V3      -RLATFRDAARSLADSMSAQLDPQG-----------------------------NFLRLE
A0A1Q7E5D3      -TVASVRDASRHLAERLDVHMDMNG-----------------------------NFLRVE
A0A2V7ISE2      -TLTTLRDAATGLGEALDVRMDMDG-----------------------------NFLRFE
A0A1Q7J2X5      -TLTTLRDAATGLGEALDTRMDMDG-----------------------------NFLRVE
A0A2V7NPD1      -TLTTLRDAATGLGEALDVRMDMDG-----------------------------NFLRFE
A0A2V7QPD8      -SVATVRDSARALSEGLEVNNDPAG-----------------------------TFLRMH
A0A2V7Q8M6      -ALSTLRDAARSLADSLSAQLDEKG-----------------------------NFLRLE
A0A2V7QBC3      -GLSTLRDAARSLADSLSAQLDEKG-----------------------------NFLRLE
A0A2V7LMU1      -GLSTLRDAARSLADSLSAQLDAEG-----------------------------NFLRLE
A0A2V7PBY9      -ELLTLRDAARSLADSLRTELDLEG-----------------------------NFLRIE
A0A3M2BLV5      -VLKRAPEEFRTYLLEVVPSVAQVASEVRLVGTARE----------------QTNIIDIY
A0A2V7KS68      -SLAAPRDAATGLGNALDVHMDING-----------------------------NFLAVE
A0A2V7N4L3      -SLMTPRDAALRLGEQLDVRMDLNG-----------------------------NFLALE
A0A1Q7AZK2      -SVVPPRDAALRLGEQLDVRMDMNG-----------------------------NFLALE
A0A1Q7TNP7      -SVVPPRDAALRLGEQLDVRMDMNG-----------------------------NFLALE
A0A1Q7KG39      -SVVPPRDAALRLGEQLDVRMDMNG-----------------------------NFLALE
A0A1Q7GX75      -SLVSPRDAALTLGEQLSVRMEMNS-----------------------------NFLALE
A0A1Q7LL80      -SLVSPRDAALTLGEQLSVRMEMNS-----------------------------NFLALE
A0A2V7PFU2      -AVMPPRDAATRLGEELQVQMDMNG-----------------------------NFLALE
A0A2V7MFS9      -SVVQPRDAALRLGEQLDVRMDLNG-----------------------------NFLALQ
A0A2V7T933      -SVVPPRDAALRLGEQLDVRMDMNG-----------------------------NFLALE
A0A2V7J4D7      -TLDPPYEAALGLARNLKVAADLDG-----------------------------NFLRME
A0A2V7LN90      -TVVAPYEAAKLLAKRLKTSADADG-----------------------------NFLRLE
A0A2V7LFN9      -TVTTPAEAATRLRRELKVSSDMDG-----------------------------NFLRLE
A0A2V7MEK4      -TVTTPAEAATRLRRELKVSSDMDG-----------------------------NFLRLE
A0A2V7P8B1      -AVLRRPDAARGLLRVVSRDAAISQLLTELRVRPRV----------------RTDIVDVA
A0A2V7R2W8      -TLDAPYEATLKLADQLKVSADLDG-----------------------------NFLHMQ
A0A2V7MS64      -DVDAPYEAARKLGKHLKTSLDLDG-----------------------------NFLRLE
A0A2V7Q7N9      -TVTAPYEAAKLLTKRLKITADADG-----------------------------NFLRLE
A0A2V7IRW6      -TVSAPYEAARALGKRLKTSLDLDG-----------------------------NFLRLE
A0A1Q7DVU6      -TVSAPYEAARALGKRLKTSLDLDG-----------------------------NFLRLE
A0A1Q7JSV2      -TVSAPYEAARALGKRLKTSLDLDG-----------------------------NFLRLE
A0A2V7QN41      -ALNTPADAARQLKTTLSVTTDVDPAL----MRAGT----------------DANFLRIQ
A0A2V7R603      -ALSTPADAARQLMKTLNVSTDVDPAL----MRAGT----------------DANFLRIQ
A0A2V7LJS2      -AILRRPEVRQGVLRVLSRDAAISALLTELRVRPRM----------------RTDIVDVA
A0A1Q7GLJ7      -AVLHRPSAKQGFLQVLDQESAISYLIAKVRVRPRL----------------RTDIVDVA
A0A2V7GRE3      -AVLHRPDAATARLRVLSREAAISGLLARLRVKPRL----------------NTDIVDVT
A0A2V7EU00      -SVVTPRDAAQRLSARLGVRLDENG-----------------------------NFMRLE
A0A1Q6WE01      -IVSSVRDAAKRLGDELNVTIDPNG-----------------------------NFLRLS
A0A2V7S9K3      -VVTTLRDAAKHLGEALTVAIDPSG-----------------------------NFLGIS
A0A1Q7DXB9      -TLLTPHDAAELLASQLQVTTDREG-----------------------------TFVTVQ
A0A1Q7JD32      -TLLTPHDAAELLASQLQVTTDREG-----------------------------TFVTVQ
A0A2V7MVP8      -TVYTPHDAAELLAGELQVTTDPGG-----------------------------SFVTVQ
A0A2V7N0A9      -TVATTSEAAQKLAEELRVRAAQDG-----------------------------NFIRIE
A0A1Q7DLS9      -VVESPHEAASRLAERLRVKTDLEG-----------------------------NFLRVE
A0A1Q7JK96      -VVESPHEAASRLAERLRVKTDLEG-----------------------------NFLRVE
A0A2V7KQV7      -TMTALSDVALELSQSLRIRATADG-----------------------------YFVRLE
A0A1Q7JGF6      -TVATTSEAAQKLSEELRVRAGTDG-----------------------------NFVRIE
A0A2V7SG67      -TVATTSEAAQKLSEELRVRAGTDG-----------------------------NFVRIE
A0A1Q7GIK9      -TVTTTSEAALQLAEELRIRAAPEG-----------------------------NFVRIA
                                                                        . . 

A0A2D5ZJF2      FDSPWPDEAELIVYEVVESYRRYQSTTKQTTAGGVLKILEKARKKADGKWNESYEKL---
A0A0S8H9P3      YSGPDQRLVPRTLNAVAAALRDLGVRRVRQWARGRTRFIRDQLDESGRQLREALQAVQDY
A0A1E4BBP7      LSGSKAGLLATTLNTLAREFVSEAVRLKRENLTVSAEATEEQLQQAAQQLAAAQTALERF
A0A3M2G737      VKSTHPEEAKLIANLFAETYYQWNVERSRTELIGTRKFLEKQLEQKRERLYQAEDSLRKY
A0A0H4TUX7      FAGTDPTLVPQILNAAAVALRLDGVRRAQEIAARKRTYVAEQLAKADSSYRIKLAELQRF
A0A1G0LUG0      FTSTDPLLVPRILNAAGLALQSDGVRRAREVAARRRAYIAEQLAGADAAYKGKLTELQRY
A0A1Q7E3T7      YVASDPQHAQQVVNRVVEVFRAVNAEEAQRQSRLRREFLETQLRVNDSVLADARRALTAF
A0A1G0L906      FTGTDPSLVPEILNEALIALQNYGVDRVRDVASLRLRYINERVDDARTRYLSALSGVQSY
A0A1G0LCC0      FTGTDPSLVPEILNEALIALQNYGVDRVRDVASLRLRYINERVDDARTRYLSALSGVQSY
A0A2D5ZJE2      MTAGDPDEAAYFANLFAEEYRNQNISQNRGELSGVRQFLEEQLHQVETRLAISEEELRSF
A0A3M2G624      VYWQDPETATQIANALADVIRHRELEDKRLEHTKTREYIERQLNTYTQKLKASEEALQTY
W0RI74          LTGTAQQKPAATMNAMLTQFVDVATELKKREMVASTTTLNTQLDEASKGLQAAEQAFEDY
A0A3M2BJA6      YESSDTLLVHEVPNRLAASFISRRQRIQKTEASSTVRFLEDQIDTLARQLAAAEERLVAF
A0A3D4VBZ5      MNGPDAQRSAATLNAWVEQFVTVATQYKKQNVVQVAGILEGQREYAAQELASAEAALEGF
C1A5W1          MNGPDAQRSAATLNAWVEQFVTVATQYKKQNVVQVAGILEGQREYAAQELASAEAALEGF
A0A2V7PX99      LKGTDPALTAATVNAVAGRTVTLAAELKRRKYAELAKILGEQAQQAQQALHASDAALASF
A0A2V7ERC7      LTGTNPQRSARTVNVWAEQFVGAAIELKKRHLLEFKKMLGDQLNVAEHELNTSELLLEQF
A0A2V7HBX4      LSGADPRRTARTVNAWAEQLVNSSGDLKTRHLFEFKKILGDQLALAEAQLRTSENELEHF
A0A2V7JTZ5      LSGADPRRTARTVNAWAEQLVNSSGDLKTRHLFEFKKILGDQLALAEAQLRTSENELEHF
A0A3D4YTR6      LTGSDPRRTARTVNAWAAQLVSSSGDLKKSHLLEFKRILGDQLALAEGQLRSSEDELERF
A0A2V7F1M1      YSDPDPLLAQRVANLLVRVFQARDAGSAQEQARSRAEFLAAQLSATDSELSIAQAELSAF
A0A2V7KXK7      LKSTSAAGAAATLNAISARIVAVESEMKRRKFEELAGVMDEQHQHAKEALDQADEALRNF
A0A2V7QDU7      YRGTDPQLVQAVPNLLATRFIIDRQKTQQTETRSTGAFLRDQTAKLARQLRASEDSLERF
A0A2V7ITT6      LTGNDARHVTAVLNAVVQRYVAVAADLKRDKLTELSKILQQQLQYAEHNLRSAEEVFEDF
A0A2V7NJW1      LTGNDARHVTVVLNAVVQRYVAVAADLKRDKLTELSKILQQQLQYAEHNLRSAEEVFEDF
A0A2V7GFB5      LRGGDPARITRILNAVAERYVEVAAELKRGRLTELTSIIGDQVRTAKQSLDSAEGDLQTF
A0A2V7RQ86      LRGGDPARITRILNAVAERYVEVAAELKRGRLTELTSIIGDQVRTAKQSLDSAEGDLQSF
A0A2V7IWX2      LTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGEQVRHAQASLTAAELALKSF
A0A1Q7KE95      LTGADPAHTAATVNAVAQRSVAVGAELKRAKLNQLGKLLDEQRQSARENLQRAESALEQL
A0A1Q7T8X5      LTGADPAHTAATVNAVAQRSVAVGAELKRAKLNQLGKLLDEQRQSARENLQRAESALEQL
A0A2V7FK98      LKGADAARITSTINGIAERFVQVAADLRRQKLTELTKILDQQLAAAHQNLLDAEQALERF
A0A2V7R3Z8      LKGADAVRITSTINAIAERFVLVAADLRRQKLTELTKILDQQLAAAHQNLLDAEKALERF
A0A2V7J3C0      LTAEDATRGAATANAIAQRFVEVGADLKRAKLHQLGTLLDEQLRAARDNLRRTESALEQF
A0A2V7KWV9      LTSPNGTDAAATVNAVADRYVAVATDLKRVKVTELSRLLNEQLQAAEANLHKAERALEDF
A0A1Q6ZHP2      LRGANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLHGAEASLQRF
A0A1Q7R6Z6      LRGANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLHGAEASLQRF
A0A2V7FYT7      LRGANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLHGAEASLQRF
A0A2V7IGR0      LRGAQPARITAIVNAIAQRYVEVAAELKREKVTELTKILDQQVESARQRLRDAEAGLRSF
A0A2V7MR23      MRGPDPVRITTLVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHSQDNLRSAEAALQRF
A0A2V7L1V3      LRGPDAPRITAVVNAVADRYVLVAADLKRKKLTELTKILGEQLQSAEDKLRGAEAALERF
A0A1Q7E5D3      LTGAYPARITAIVNAVVERYVQVAADLKRQKVTELTKILNDQVESARRNLQDAEVALEAF
A0A2V7ISE2      LRGPYPTRITAIVNAVAQRYVQVYADLKRQKVIELTKILGEQVQHSQENLRNAEAALQRF
A0A1Q7J2X5      LRGVYPTRITAIVNAVAQRYVQVYADLKRQKVMELTKILGEQVQHSQENLRNAEAALQRF
A0A2V7NPD1      LRGPYPTRITAIVNAVAQRYVQVYADLKRQKVIELTKILGEQVQHSQENLRNAEAALQRF
A0A2V7QPD8      LKGADAVRITSTINAIAERFVQVAAELRRQKLTELTKILDQQLAAAHQNLQDAEKALERF
A0A2V7Q8M6      LRGPDAPRITAVVNAVAERYVQVASDLKRKKLTELTKILAEQLRSAQGNLRSAEAGFERF
A0A2V7QBC3      LRGPDAPRITAVVNAVAERYVQVASDLKRKKLTELTKILAEQLQSAQGNLRSAEAAFEGF
A0A2V7LMU1      LRGPDAPRITAVVNAVAERYVQVASDLKRKKLSELTKILAEQFQSAQGNLRSAEAALERF
A0A2V7PBY9      MRGPDAAQITAIVNAVAERYVQVAADLKRTKLSELTKILADQLQRAQGTLRSSEAALERF
A0A3M2BLV5      LTHEDPELAPKMLGAAARALSEFGARQVRERAESDLEFAEAQLDSARNNLQRSFQKIREF
A0A2V7KS68      LSGQNPVLIANILNAVTQRYVDVAAQLKREKLTELTKLLENQLNTARSNLDDAESALQHF
A0A2V7N4L3      LRGANPVLISNILNAVSQRYVAVAAQLKREKLTELTKLLEDQLTTAQRNLDEAETALQRF
A0A1Q7AZK2      LRGPNPVLITSILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLDSAETALQGF
A0A1Q7TNP7      LRGPNPVLITSILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLDSAETALQGF
A0A1Q7KG39      LRGPNPVLITTILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLDSAETALQGF
A0A1Q7GX75      LRGSNPVLIANILNAVSQRYVEVAAQLKREKLTELTKILEDQLRTAQGNLDDAETALERF
A0A1Q7LL80      LRGSNPVLIANILNAVSQRYVEVAAQLKREKLTELTKILEDQLRTAQGNLDDAETALERF
A0A2V7PFU2      LRGTNPMLISKILNAVTQRYVEVAAQLKREKLTELTKILEDQLTTAKRNLDEAEDAQRRF
A0A2V7MFS9      LQGTNPVLISSILNAVSQRYVAVAAQLKREKLSELTKILEDQLTTAQRNLDDAEAAQQRF
A0A2V7T933      LRGPNPVLITTILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLDSAETALQGF
A0A2V7J4D7      LGGHDPAQIAATVNAVAERFVAVAAGLKRDNLTELTRILGDQLAQAQANLRQAEASLKSF
A0A2V7LN90      LGGSDPAEVTAIVNLVAERFVAIAADLKKENLQQLTGILSGQLERARDKLQSAEAGLKRF
A0A2V7LFN9      LTGPDAAGVTGTVNAVASRFVAAAADLKRDNLTQLTGILGAQLEQAQARLRSAETALQRF
A0A2V7MEK4      LTGPDAAGVTGTVNAVASRFVAAAADLKRDNLTQLTGILGAQLEQAQARLRSAETALQRF
A0A2V7P8B1      YAAPDPSRAQQVVNRVVDVFRAASAEAAQGQSRLRREFLEAQLKVNDSVVADAQAALTAL
A0A2V7R2W8      LGGRDPVAIAATVNTVAERFVAVAAGLKRDNLGELTGILGAQLAQGQAALRSAEDALRAF
A0A2V7MS64      LAGDDPVQITDIVNTVGQRFVAAAADLKRQNLTELSRILGDQLDKARTELTSAEQSLKQF
A0A2V7Q7N9      LGGSDPGEVTAVVNMVAERFVSVAADLKKQNLQQLTGILGGQLERARDKLQSAEAELKRF
A0A2V7IRW6      LGGPDAAGITAVVNAVAERFVAAAAELKRQNLTELTRILSGQLERAQANLRDAETALKTF
A0A1Q7DVU6      LGGPDAAGITAVVNAVAERFVAAAADLKRQNLTELTRILNGQLERAQANLRDAETTLKTF
A0A1Q7JSV2      LGGPDAAGITAVVNAVAERFVAAAADLKRQNLTELTRILNGQLERAQANLRDAETTLKTF
A0A2V7QN41      LTGSRPAELAATVNAIADRVVVVAADLKRIKLVELGRILDEQRQHALRGLRDAEAAQRDF
A0A2V7R603      ITGSRPAELAATVNAIADRVVVVAADLKRIKLVELGRILDEQRQHALGSLRAAEAAQRDF
A0A2V7LJS2      YSAPDPARAQEVVNRVVDVFRAASAEAAQGQSRLRREFLEAQLRVNDSLVADAQDALTAF
A0A1Q7GLJ7      YSAPDPARAQEVVNRVVDVFRAASADAAQRQSKLRREFLEAQLKVNDSLLADARQALTEF
A0A2V7GRE3      YSAPDPYVAQHVLNRVVDLFKSASAEDAQQQSTRRREFLESQLKVNDSLLADARQAVTAF
A0A2V7EU00      LDGTDPKSIAATLNAIAQRLVAVAAELKRAKLTELTRILNEQLTTAARNLRDAEGSLESF
A0A1Q6WE01      LSGTDGPTVAATLNAVAQRYVDAALKLKRAKLSELAALLAEQLQSARASLQRAESAYEAF
A0A2V7S9K3      LTDANGTAAAKTVNYVAQRYVLAASGLKRSKLTELARLLDEQLQSARGNLQRAEAALEQF
A0A1Q7DXB9      LTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGQQVQHAQASLTVAELALKNF
A0A1Q7JD32      LTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGQQVQHAQASLTVAELALKNF
A0A2V7MVP8      LTGTDPHLTTAILRGVANRTVAVANELRRHKVAALADMLGQQVQHAQTSLTAAELALKDF
A0A2V7N0A9      RRGPDRRVVTGTVNAVAERFVAAAAELKRQRLTQLTAILKDQLDHAQDNLRAAEAALMAF
A0A1Q7DLS9      LRGQDPRKITVIVNAVAQRFVAVAADLKRQQLTELVRILGEQLNHSQVNLSAAESALRDL
A0A1Q7JK96      LRGQDPRKITVIVNAVAQRFVAVAADLKRQQLTELVRILGEQLNHSQVNLSAAESALRDL
A0A2V7KQV7      RRGHDPVLITTTVNAVADRLVAVAADLKRERRTELSSILHEQRDRAKANLSSAELALTQF
A0A1Q7JGF6      RRGPDAAVVTRTVNAVAERFVAAAADLKRQRLTELTAILKDQLDRAETNLRAAERGLTAF
A0A2V7SG67      RRGPDAAVVTRTVNAVAERFVAAAADLKRQRLTELTAILKDQLDRAETNLRAAERGLTAF
A0A1Q7GIK9      RRGPDPDQATGIANAVAERFVAAAADLKRQRLTELTAILQDQLNHAQANLRTAEAALTVF
                                                                            

A0A2D5ZJF2      --------ILSQKKHPVLSLKDDRGSFLVRGLSTLHEELAAAQSAAIVAKATYEAAEQMQ
A0A0S8H9P3      KGR-----------------------------RGLISLTVEESRVMQRVATLQTEIEQLL
A0A1E4BBP7      KIN-----TITLPSEQMAITPGV---------------STTMNPVFQAYFSDRVNYEQVR
A0A3M2G737      MEA-----------------------------SNVMTDDAGATATIEKIAQLEATRSALE
A0A0H4TUX7      KEG-----------------------------EQITDLSVEEQSVVQSIQALEQQRQQIT
A0A1G0LUG0      KEG-----------------------------QQITDLSAEELSIVQSIQTLEQERQLLA
A0A1Q7E3T7      RRH-----------------------------AGRAGSDQQGPTQQAGIDQLQLQRDQLD
A0A1G0L906      KES-----------------------------ENTTNFTAEEVAIINSIHGFDREKERLQ
A0A1G0LCC0      KES-----------------------------ENTTNFTAEEVAIINSIHGFDREKERLQ
A0A2D5ZJE2      KTK-----------------------------SGLVSLSDEVEWLVRQLAEFESAENAAI
A0A3M2G624      KEQ-----------------------------NRIYELDAIARDVTYKVFDIEAEISQIQ
W0RI74          RVK-----TIAEPSETPTVISSDPKSQN----------MAVGQPIFNAFFTRKTEVDQLK
A0A3M2BJA6      REE-----------------------------GQVVSIEAEANAQVTELARLQADRNAID
A0A3D4VBZ5      RVR-----TVTEPSERQTIQPGI---------------EMTNSPVFENYFRDKILADNYR
C1A5W1          RVR-----TVTEPSERQTIQPGI---------------EMTNSPVFENYFRDKILADNYR
A0A2V7PX99      RVR-----TAGVVQRGAPTVSPTM--------------DGKGDPVYSRAFELRLNIEQLR
A0A2V7ERC7      RAS-----TITLPSGGSPLASSG---------------QTAGDPAFTTYFQQKATLDEVR
A0A2V7HBX4      RVS-----TITLPSGVAASAGPG---------------VTQGDPVVASYFQQKVALDEIR
A0A2V7JTZ5      RVS-----TITLPSGVAASAGPG---------------VTQGDPVVASYFQQKVALDEIR
A0A3D4YTR6      RVN-----TITLPHG-ATPIGPG---------------AGQVDPVVGNYFQQKAALDEVR
A0A2V7F1M1      RRQ-----RMLGSSRDKLAVEQAR------------------------LTALDARLGELE
A0A2V7KXK7      RVR-----TADRPLVTQAPG------------------GGLTVEGSGVVTQLRTDMDQQR
A0A2V7QDU7      RVV---EHIVSLPQQASSGV--------------------------TQFAELQAQRNALD
A0A2V7ITT6      RVQ-----TITLPADRVTPVAPGV--------------ELTRDPGVAAFFNMKVEREQLR
A0A2V7NJW1      RVQ-----TITLPADRVTPVAPGV--------------ELTRDPGVAAFFNMKVEREQLR
A0A2V7GFB5      RRR-----TITLPPDAVAAGG-----------------DTPRDPVLGDFFEQQVQRQQVA
A0A2V7RQ86      RRR-----TITLPPDAVAAGG-----------------DTPRDPVLGDFFEQQVQRQQVA
A0A2V7IWX2      RVR-----AA--------------------GVLPAGVAAPPPSPAFTNAFELRVAVDQLG
A0A1Q7KE95      QVT-----VGPDLGAAPVPP--------------------GGGPPLGTLLGPKLEQEQLR
A0A1Q7T8X5      QVT-----VGPDLGAAPVPP--------------------GGGPPLGTLLGPKLEQEQLR
A0A2V7FK98      QVK-----TITLPS-------TAAGGARAAGGVPTASGASADDPAFASFFRMQVDRQQVQ
A0A2V7R3Z8      QVK-----TITLPS-------TAVGGSRGA-GVPSA-GASADDPAFASFFRMQVDRQQVQ
A0A2V7J3C0      QVG-----TATFTPTVGTAAA-----------------SAGRDAAFGSLFAPRLEEEQLR
A0A2V7KWV9      RVR-----TIMLPAEPVAG-------------------SAARTSPVSEFLTRRVQEDQLR
A0A1Q6ZHP2      REE-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFGSFFDMQISREQAR
A0A1Q7R6Z6      REE-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFGSFFDMQISREQAR
A0A2V7FYT7      REE-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFGSFFDMQISREQAR
A0A2V7IGR0      GVR-----TITLPSGRAAA-------------GVTGT-GADRDPALTSFFDLQIEQQQAH
A0A2V7MR23      REE-----TITLPGERPVTGGASVAGPVVAGAAPGTGPAGARDPLFGSFFEMQISREEAR
A0A2V7L1V3      RER-----TITLPADRPAPVALGAPGGA--GGGSQGQ-VGEADPKFGTFFTMQFDRERIQ
A0A1Q7E5D3      RVR-----TITLPSDRPAPSRAGVAGAT----GAAAG-DVAGDPVFTHFFDTQVEREQVR
A0A2V7ISE2      REE-----TITLPSDRPAAG-ASVAGAG--VGGAGAA-GGARDPVFGGFFETQLTREEAR
A0A1Q7J2X5      REE-----TITLPSDRAAAG-ASVAGAGGVGAGAGAA-GGTRDPVFGGFFDMQLTREEAR
A0A2V7NPD1      REE-----TITLPSDRPAAG-ASVAGAG--VGGAGAA-GGTRDPVFGGFFETQLTREEAR
A0A2V7QPD8      QVS-----VITRPSQVPKAGP-------------------GDDPAFKNFFTMQVDREQAR
A0A2V7Q8M6      RER-----TITLPGDRTPPGALGMAGGA--GGGQGA----ESDPKFGTFFGMQADRDRIQ
A0A2V7QBC3      RER-----TITLPGDRTPPVSLGVPSAA--GGGQGA----ESDPKFGTFFGMQADRDRIQ
A0A2V7LMU1      RER-----TITLPSDRPPPVALGAPGGA--GGGAQGA---ELDPKFGTFFNMQFDRERIQ
A0A2V7PBY9      RVR-----TITLPTDRPPPVALGAPGGA--GGGGGSA-NGEASAQFGTFFNMQFDRERLQ
A0A3M2BLV5      KET---------------EAFTNL--------------TAEEQQLVQRRQDALERLQQLD
A0A2V7KS68      RTR-----TITLPSEQA--GPSAT--------------E-TRDPIRSNYFDMEADRDQLR
A0A2V7N4L3      RTR-----TITLPSERSPSAAVSG--------------D-THDP-RAGFFDIQVERDQVR
A0A1Q7AZK2      RTR-----TITLPSDQAADRKAAA--------------D-TRDPIRTSFFDMAVERDQLR
A0A1Q7TNP7      RTR-----TITLPSDQAADRKAAA--------------D-TRDPIRTSFFDMAVERDQLR
A0A1Q7KG39      RTR-----TITLPSDQAADRKAAA--------------D-TRDPIRTSFFDMAVERDQLR
A0A1Q7GX75      RTR-----TITLPSDQT----TGV--------------E-SRDPRRANFFEMQVDRDQLR
A0A1Q7LL80      RTR-----TITLPSDQT----TGV--------------E-SRDPRRANFFEMQVDRDQLR
A0A2V7PFU2      RTR-----TITLPSDQQR-PGAAA--------------E-TRDPIRASFFDMAVERDQLR
A0A2V7MFS9      RTR-----TITLPSDQQAGQAAAA--------------G-TRDPIRASFFDMQVERDQLR
A0A2V7T933      RTR-----TITLPSDQAADRKAAA--------------D-TRDPIRTSFFDMAVERDQLR
A0A2V7J4D7      RVG-----AVTTVAAGAGSVTESS--------------QYPRDPMFAGLVDLKVNLDEVR
A0A2V7LN90      RVG-----AVTQYADGAAPVTPNM--------------EFPRDPAFAGLLGMKVNREELR
A0A2V7LFN9      RVT-----AVTEYAEGAAPVTPNM--------------QYPQDPVFAGLLDLKVRRGDLL
A0A2V7MEK4      RVT-----AVTEYAEGAAPVTPNM--------------RYPQDPVFAGLLDLKVRRGDLL
A0A2V7P8B1      QRRARSDGWGQSSGREQTEVPGLE--------------LQRQQLLAERRTDEDLLAAL--
A0A2V7R2W8      RVG-----AVTTLAEGAGSVAQNT--------------QYQRDPLFAGLVEMKVSLDEVR
A0A2V7MS64      RMS-----AVTEYTEGTASIAPNM--------------QFPHDPVFAGLFDMKVNREELR
A0A2V7Q7N9      RVG-----AVTQYADGSAPVTPNM--------------EFPRDPVFAGLVGMKVNREELR
A0A2V7IRW6      RVS-----AVTEYADGAAPVTPNM--------------QFPRDPVFAGLLDMKVNREQLR
A0A1Q7DVU6      RVS-----AVTEYADGAAPVTPNM--------------QFPRDPVFAGLLDMKVSREQLR
A0A1Q7JSV2      RVS-----AVTEYADGAAPVTPNM--------------QFPRDPVFAGLLDMKVSREQLR
A0A2V7QN41      RIR-----SAGVLRQGAPPVSATL--------------RGGGDPVFERSFDTKLALDSVQ
A0A2V7R603      RIH-----SAGVLRQGAPPVSASL--------------RGGGDPVFERSFDTKLALDSVQ
A0A2V7LJS2      QRRARSDGSGQTSGREQTELPGLE--------------LQRQQLLAERRTDETLLKAL--
A0A1Q7GLJ7      QRRARPYGSGGSSAREQSELPGLE--------------LERQQLMAERRTDEALLAAL--
A0A2V7GRE3      RQRAGTYGSRDALAREQAGLAGVE--------------LQRQQLEAERRTDESLLAALRD
A0A2V7EU00      RVK-----TITLPSEQSTPVSPGL--------------EATRDPVFRNFFEMRIMREQLR
A0A1Q6WE01      RTR-----TITLPPDPGAAAAAA----------------AGVQSPMSEFFGLRMAYDQMR
A0A2V7S9K3      RTR-----TITLPPDPGATGTAA----------------PPKGSPLGDFFDLQVEQGQLR
A0A1Q7DXB9      RVR-----AAGVLPAGVAAPPP--------------------SPAFTNAFELRVAVDQHG
A0A1Q7JD32      RVR-----AAGVLPAGVAAPPP--------------------SPAFTNAFELRVAVDQHG
A0A2V7MVP8      RIR-----TAGVLPAGVVTPPP--------------------SPAFTNAFELRVTRDQLG
A0A2V7N0A9      RVR-----NAVRPSEGPAQGPDGR--------------RITADPTYAGYMDLQIAASGLA
A0A1Q7DLS9      LSK-----TVSFVADGATPVAPGL--------------QFTHDPGFASYFETKVNLEQVR
A0A1Q7JK96      LSK-----TVSFVADGATPVAPGL--------------QFTHDPGFASYFETKVNLEQVR
A0A2V7KQV7      RVR-----NAVRPSEGPAEGPDGR--------------RITADPTFASYVDLQVAIDGLA
A0A1Q7JGF6      RVR-----NAVRPSEGPAQGPDGR--------------RITADPTFASYVDLQVALGALA
A0A2V7SG67      RVR-----NAVRPSEGPAQGPDGR--------------RITADPTFASYVDLQVALGALA
A0A1Q7GIK9      RVH-----NAVRPSEGPAQGPDGR--------------RITADPTFASYVDVQVTLDGLT
                                                                            

A0A2D5ZJF2      GD----PERLRQLV---------------ESQFGRVGTTPF--NQE--------KVQLHR
A0A0S8H9P3      IEKSLYTSLVDRIG--SVGLRPGD-----VQQFVVLSTEEVNRTVQ------FYYDQLLE
A0A1E4BBP7      RD----REALERIV--EEG--RGRGGKISLEALRSVGSATAS-NTS--------LQAEIA
A0A3M2G737      ID----IQAFAEKIKSYED------KLGSKSNVNVIAEQNDPYITQ--------LQEQIA
A0A0H4TUX7      VQ----IATLREAL--GQP--GDSIGVGTLNRLAAVQDIGQ--NTA--------LGFQIQ
A0A1G0LUG0      VQ----LSTLRGSL--GDS--ATQIDVGTLNRLSAVQGIAQ--NNA--------LGFQIQ
A0A1Q7E3T7      ADRRMYRSILVSLD--SGGGRGNREALRTAASTPAISANAV--VAP--------LFTQLV
A0A1G0L906      VD----LSTLQGIMGPEAQVTLET-----LNRLAALTGIAN--NTA--------MTFQIQ
A0A1G0LCC0      VD----LSTLQGIMGPEAQVTLET-----LNRLAALTGIAN--NTA--------MTFQIQ
A0A2D5ZJE2      TD----QKSLERRLEHLEGELERA-RAGLVEDLDDAAASPL--VIQ--------LREQLV
A0A3M2G624      AE----RERIKLFREKVTS------GLQ-PEDYLLISAIPF--QDEEGYGYWDVLSQLTS
W0RI74          RD----RESLERLL--GQIKAPGS-TLAPEILLTVPTLANDPGAAG--------VKQTVD
A0A3M2BJA6      AERSALQELMDEID--REATTADPAGPSPYRRLLSFPTLLK--NQS--------TSELLR
A0A3D4VBZ5      RD----REALERIL--QSG--RSGTAITREAVLSVPAVNADPAAEN--------LRRALE
C1A5W1          RD----REALERIL--QSG--RSGTAITREAVLSVPAVNADPAAEN--------LRRALE
A0A2V7PX99      RE----RRVIEKAL--ADQ--PKS-GLP-VEALAVLPTVGT--SPE--------LNTALQ
A0A2V7ERC7      ND----RMAIERILSDARGGPINP-----QAFLVLPSILNN--TPQ--------LRTAIE
A0A2V7HBX4      SE----RQALERMVSEAKGGPINP-----QDFLQLPTILNN--APQ--------LRSAIE
A0A2V7JTZ5      SE----RQALERMVSEAKGGPINP-----QDFLQLPTILNN--APQ--------LRSAIE
A0A3D4YTR6      SE----REALERMIADAKGGPIDT-----QGFLQLPTILNN--APQ--------LRSAIE
A0A2V7F1M1      AE----RSVYESFLTKFNTS-NDSLRLDVARDLSYTPELAA--DPV--------VSRISQ
A0A2V7KXK7      RD----RQQILSLA--TRA--QSS-SVP-VQLWNSIPSVQN--DPV--------MKGALD
A0A2V7QDU7      AE----RRALEQLL--SSTASSVA-GSTQSTPIAFPTLLRNEVAAS--------LLSALA
A0A2V7ITT6      RD----REAIELAL--AQA--ADS-AAS-WDALSVIGSVQQ--SPG--------LMQALK
A0A2V7NJW1      RD----REAIELAL--AQA--ADS-AAS-WDALSVIGSVQQ--SPG--------LMQALK
A0A2V7GFB5      RD----RAALTRVL--AQP--ADS-GLA--SALEVIDAVQH--SPE--------LKGALQ
A0A2V7RQ86      RD----RAALTRVL--AQP--ADS-GLA--SALEVIDAVQH--SPE--------LKGALQ
A0A2V7IWX2      RD----RQAIDRVL--AQQ--PDS-GLS-VDALAAIDAVQK--SPE--------LTQALK
A0A1Q7KE95      RD----RDAIEQVL--VQM--RDS-GGS-PDGLAFIGAVQR--SPD--------VSQALR
A0A1Q7T8X5      RD----RDAIEQVL--VQM--RDS-GGS-PDGLAFIGAVQR--SPD--------VSQALR
A0A2V7FK98      QD----RDALERVL--KQA--GDS-GVS-PEALAIVGSVQQ--NVQ--------LKQALD
A0A2V7R3Z8      QD----RDALERVLAQAQA--SDS-GVS-PEALAIVGSVQQ--NVQ--------LKQALD
A0A2V7J3C0      RD----RSAIQQVL--ARM--RDS-GGS-PEGLAFIGAVQR--TAD--------VSQALR
A0A2V7KWV9      RD----QDALAQVL--AQG--PDSLGFS--ERLAAIGAVQG--SAD--------LTRALT
A0A1Q6ZHP2      RD----RDALDRLL--AQA--GDS-GLS-AEALSVVGLVQA--NPE--------LTQALT
A0A1Q7R6Z6      RD----RDALDRLL--AQA--GDS-GLS-AEALSVVGLVQA--NPE--------LTQALT
A0A2V7FYT7      RD----RDALDRLL--AQA--GDS-GLS-AEALSVVGLVQA--NPE--------LTQALT
A0A2V7IGR0      QD----RKAILQAL--AQA--RDS-GLS-ATALEAIGAVQH--NAD--------LAQALK
A0A2V7MR23      RD----RDALQRLL--AQQ--GDS-GLS-VEALSVVGLVQQ--NPE--------LSQALT
A0A2V7L1V3      QD----REALQRLL--QAR--DSA-GLS-ADALAVVGSVQG--NPD--------LAAALT
A0A1Q7E5D3      RD----RETLERVL--AQA--GDS-GSS-ADALSVIGSVQR--HAE--------LSQALK
A0A2V7ISE2      RD----REALGRLL--AQA--GDS-GLS-PEALSVVGSVQQ--NPE--------LSEALK
A0A1Q7J2X5      RD----REALGRLL--AQA--GDS-GLS-AEALSVVGSVQQ--NPE--------LSEALK
A0A2V7NPD1      RD----REALGRLL--AQA--GDS-GLS-AEALSVVGSVQQ--NPE--------LSEALK
A0A2V7QPD8      RD----REALERVL--AQA--GDS-GVS-PEALAIVGSVQQ--NAD--------LKQALA
A0A2V7Q8M6      QD----REALQRLL--APA--SDSSGLS-ADALAVVGSVQG--NPD--------LAAALT
A0A2V7QBC3      QD----REALQRLL--APT--SDSSGLS-ADALAVVGSVQG--NPD--------LAAALT
A0A2V7LMU1      QD----REALQRLL--AQV--RDSTGIS-PDELAVVGSVQA--NPD--------LAAALT
A0A2V7PBY9      QD----REALERVL--AQA--GDTAGLS-PDALAVVGSVQS--NPD--------LVGALG
A0A3M2BLV5      DQ----RQALQNLM--VDI--QAA-GVEGVDIVAFLAALPQGVNPQ--------ITAIAE
A0A2V7KS68      RD----REAIEGLL--PAGG-G---PLP-ADALSAIESVQH--APE--------LANALK
A0A2V7N4L3      RD----REAIDNLL--AQ-G-WDS-GVP-TAALSAIGSVQH--APE--------LSSALK
A0A1Q7AZK2      RD----GDAIDRLL--AQGG-GGD-GLP-TEALSAIGSVQH--APE--------LSNALK
A0A1Q7TNP7      RD----GAAIDRLL--AQGG-GGD-GLP-TEALSAIGSVQH--APE--------LSNALK
A0A1Q7KG39      RD----GDAIDRLL--AQGG-GGD-GLP-TEALSAIGSVQH--APE--------LSNALK
A0A1Q7GX75      RD----RDAIDRLL--AEAG-GAS-GLP-TAALSAIESVQH--APE--------LSNALK
A0A1Q7LL80      RD----RDAIDRLL--AEAG-GAS-GLP-TAALSAIESVQH--APE--------LSNALK
A0A2V7PFU2      RD----RDALERLL--TQAG-----GLQ-TDALSAIKSAQD--APE--------LSNALK
A0A2V7MFS9      RD----RDALQRLL--TQ-G-GDS-GLP-TDALSAIESAQR--APE--------LSNALK
A0A2V7T933      RD----GDAIDRLL--AQGG-GGD-GLP-TEALSAIGSVQH--APE--------LSNALK
A0A2V7J4D7      RD----RTAIERLL--APSTDPTV-EVP-VDALSMVGSVQR--STE--------LVQGLR
A0A2V7LN90      RD----RDAIGRIL--AQR--PDS-GLA-VDALATIGAVQK--STE--------LSQALH
A0A2V7LFN9      RD----RAAIKRIL--AQG--PES-GLM-VDALATLASVER--STE--------LSQALR
A0A2V7MEK4      RD----RAAIKRIL--AQG--PES-GLM-VDALATLASVER--STE--------LSQALR
A0A2V7P8B1      QDSSTSRKAIQTAL--STP--G-------------VAPNPA--VVQ--------LNTQLL
A0A2V7R2W8      RD----RAAIDRLL--RQG--IDS-GVS-VDALAMVGAVQR--STE--------LVQALR
A0A2V7MS64      RD----RAAIDRIL--AQG--SDA-DLA-VDALTMIGSVQK--STE--------LAQALR
A0A2V7Q7N9      RD----REAIGRIL--ARG--PDS-ALA-VDALATIGSVQK--STE--------LSQALH
A0A2V7IRW6      RD----REAIARIL--AQG--RDS-GLA-VDALAMIGSVEK--STE--------LSQALR
A0A1Q7DVU6      RD----REAIARIL--AQG--RDS-GLA-VDALAMIGSVEK--STA--------LIQALR
A0A1Q7JSV2      RD----REAIARIL--AQG--RDS-GLA-VDALAMIGSVEK--STA--------LIQALR
A0A2V7QN41      RD----RQALQRAL--AQT--GDS-GPP-IEALQAIGAVQK--SAE--------LSLALQ
A0A2V7R603      RD----RQALQRAL--AQT--GDS-GPP-IEALQAIGAVQK--SAE--------LSLALQ
A0A2V7LJS2      QDSSTSRRAIQTAL--STP--G-------------VAPSPA--VVQ--------LNTQLF
A0A1Q7GLJ7      RDSSTSRKAIQTAL--AAP--G-------------MGASPA--LSQ--------LSAQLF
A0A2V7GRE3      RDSSVSRKALQTAL--ATP--G-------------VAASPS--VMQ--------LSTQLY
A0A2V7EU00      RD----REAVLRVL--AQA--PES-GLA-VAGLEVIGTVHN--SSD--------LVEALK
A0A1Q6WE01      RD----QLAVAHVL--TQA--HDS-AAS-IDALAAIGAVQQ--SLD--------LKQALS
A0A2V7S9K3      RD----QQAITQAL--DQM--RDS-GAS-VEGLGFIGAVQR--SPE--------LSDALR
A0A1Q7DXB9      RD----RQAIDRVL--AQP--PDS-GLS-VDALAAIDAVQK--SPE--------LTQALK
A0A1Q7JD32      RD----RQAIDRVL--AQP--PDS-GLS-VDALAAIDAVQK--SPE--------LTQALK
A0A2V7MVP8      HD----RQAIDRFL--AQ---PDS-GLS-ADALVVIDAVQK--SPE--------LMQALK
A0A2V7N0A9      RD----REAIAQML--VHA--PDS-GIA-VDQLAMIGAVQR--SSE--------LIAALK
A0A1Q7DLS9      RD----RAAIERLL--AQV--RDS-GLP-VDALAAIGAVDR--STE--------LVAALR
A0A1Q7JK96      RD----RAAIERLL--AQV--RDS-GLP-VDALAAIGAVDR--STE--------LVAALR
A0A2V7KQV7      RD----REAITQVV--ARA--RDG-SVP-VDELSMIGAVQR--SSA--------LAAALK
A0A1Q7JGF6      HD----REAIARVV--AHA--ADS-GVA-VDQLAMISAVQH--ASE--------LTAALK
A0A2V7SG67      HD----REAIARVV--AHA--ADS-GVA-VDQLAMISAVQH--ASE--------LTAALK
A0A1Q7GIK9      RD----RAAIAQVL--THA--ADS-GVA-VDQLAMIGAVQR--SSE--------LTAALK
                 :                                                          

A0A2D5ZJF2      DASQLQ------------------------LELADL--QRQVTSDHPAVESLESKIARIK
A0A0S8H9P3      LLEERS------------------------SQLGPL----GKDPSHPVIM-------ALD
A0A1E4BBP7      NLNQAR------------------------GQLVNL--QKTYTDEYRMVK-------DLK
A0A3M2G737      NLEVQRDVTITQNPALAGQEAYIEKMAEINAQIEAL--RSKLQQRTEEYR-------KSI
A0A0H4TUX7      NLLTLY------------------------DQRRTL------TAGALGLR-------ERN
A0A1G0LUG0      SLLTQY------------------------EERRKL------TAGALGLR-------ERS
A0A1Q7E3T7      QYENTR------------------------DSLTAR------STTHPDVP-------RLN
A0A1G0L906      NLLKLH------------------------DDRRTL------VAGSLGLR-------ESN
A0A1G0LCC0      NLLKLH------------------------DDRRTL------VAGSLGLR-------ESN
A0A2D5ZJE2      ALQIEH------------------------TSLLVR----GASEDSPQII-------DLE
A0A3M2G624      QLMELE------------------------IQLPLK--LEEMTENHPDII-------ALK
W0RI74          ELTHAT------------------------VDLRVK--LQTLTDSNPLVV-------DAR
A0A3M2BJA6      SLTEVE------------------------NQRSVL--LQRRTMADDDVQ-------QFT
A0A3D4VBZ5      ERAARE------------------------LELRRL--RETYTDEYQRVK-------DAQ
C1A5W1          ERAARE------------------------LELRRL--RETYTDEYQRVK-------DAQ
A0A2V7PX99      EINQKE------------------------ADLRAL--RTRYTDASAPVQ-------QAR
A0A2V7ERC7      ELSSRQ------------------------AALRTE--QQYLTNANPRIK-------QLG
A0A2V7HBX4      ELSLRQ------------------------ATLRTE--QQFLTDANPRIR-------QLA
A0A2V7JTZ5      ELSLRQ------------------------ATLRTE--QQFLTDANPRIR-------QLA
A0A3D4YTR6      ELSLRK------------------------ATLRTE--QQFLTDANPRIK-------QLA
A0A2V7F1M1      QVLVYR------------------------TRLDSL---TTGPLPAAPTN-------PDV
A0A2V7KXK7      ELGLKQ------------------------AQLRQL--RLQYTDSAAPVR-------QLQ
A0A2V7QDU7      QTEDRR------------------------SEL-----LSRRSPQDADVQ-------VLT
A0A2V7ITT6      ELTDKQ------------------------AEQRAL--GYRYTADFSRVG-------YVR
A0A2V7NJW1      ELTDKQ------------------------AEQRAL--GYRYTADFSRVG-------YVR
A0A2V7GFB5      ELTTKQ------------------------ADLRNL--RYHYTEAYPPLA-------RKA
A0A2V7RQ86      ELTTKQ------------------------ADLRNL--RYHYTEAYPPLA-------RKA
A0A2V7IWX2      ELTDKQ------------------------AELRAL--RYTYTDQHFPVQ-------QLA
A0A1Q7KE95      ELTTKQ------------------------AERRAL--ASKYTDDHPAVQ-------RLI
A0A1Q7T8X5      ELTTKQ------------------------AERRAL--ASKYTDDHPAVQ-------RLI
A0A2V7FK98      ELTTKQ------------------------AELRAL--RYKYSDEYPLVQ-------RRL
A0A2V7R3Z8      ELTTKQ------------------------AELRAL--RYKYNDAYPLVQ-------RRL
A0A2V7J3C0      DLTVKQ------------------------ADERAL--RARYTPEHHAVQ-------QLR
A0A2V7KWV9      ELTTKR------------------------AERRAL--LYRYTDDHPAVQ-------RVT
A0A1Q6ZHP2      ELMTKQ------------------------AELRAL--RYKYSDAYPPVQ-------RLL
A0A1Q7R6Z6      ELMTKQ------------------------AELRAL--RYKYSDAYPPVQ-------RLL
A0A2V7FYT7      ELMTKQ------------------------AELRAL--RYKYSDAYPPVQ-------RLL
A0A2V7IGR0      ELVTKQ------------------------ADLRVL--RYQYTDAYPRVQ-------RLT
A0A2V7MR23      ELNNKQ------------------------AELRSL--RYKYTDEYMPVQ-------RLL
A0A2V7L1V3      ELTSKR------------------------ANLRAL--RYRYSDQYPPVQ-------RLV
A0A1Q7E5D3      ELTAKQ------------------------AELRAL--RYRYSDAYPPVQ-------RLL
A0A2V7ISE2      ELTDKQ------------------------ALLRTY--RYKYSDEYPPVQ-------RLL
A0A1Q7J2X5      ELTDKQ------------------------AQLRAY--RYKYSDEYPPVQ-------RLL
A0A2V7NPD1      ELTDKQ------------------------AQLRAY--RYKYSDEYPPVQ-------RLL
A0A2V7QPD8      ELTTKQ------------------------AELRAL--RYKYSDQYPLVQ-------RRL
A0A2V7Q8M6      ELTSKR------------------------ASLRAL--RYRYSDQYPPVQ-------RLV
A0A2V7QBC3      ELTSKR------------------------ASLRAL--RYRYSDQYPPVQ-------RLV
A0A2V7LMU1      ELTSKR------------------------ANLRAL--QYRYSDQYPPVQ-------HLT
A0A2V7PBY9      ELTSKR------------------------ASLRAL--RYKYSDQYPPVQ-------RLI
A0A3M2BLV5      DIRDKQ------------------------DEIQRLLTEERVTPDHPRVQ-------AIR
A0A2V7KS68      ELGDKR------------------------AELRTL--RYHYSDAYPPLQ-------RLA
A0A2V7N4L3      ELGDKE------------------------AEVRTY--RYHYSDAYPPLQ-------RLL
A0A1Q7AZK2      ELSDKQ------------------------AQLRTY--RYHYSEAYPPVQ-------RLA
A0A1Q7TNP7      ELSDKQ------------------------AQLRTY--RYHYSEAYPPVQ-------RLA
A0A1Q7KG39      ELSDKQ------------------------AQLRTY--RYHYSEAYPPVQ-------RLA
A0A1Q7GX75      ELSDKE------------------------AQLRAL--RYHYSDAYPPVQ-------RLA
A0A1Q7LL80      ELSDKE------------------------AQLRAL--RYHYSDAYPPVQ-------RLA
A0A2V7PFU2      ELSDKQ------------------------AQARTY--RYHYSEAYPPLQ-------HLA
A0A2V7MFS9      ELSDKQ------------------------AQLRAY--RYHYSEAYPPLQ-------RLV
A0A2V7T933      ELSDKQ------------------------AQLRTY--RYHYSEAYPPVQ-------RLA
A0A2V7J4D7      DLTSKQ------------------------AELRAL--RAHYTDANPPVR-------RLA
A0A2V7LN90      DLTVKQ------------------------AELRAL--RTRYADANPAVR-------RVA
A0A2V7LFN9      DLTAKQ------------------------AVLRAL--RVRYTAEAPAVR-------RVA
A0A2V7MEK4      DLTAKQ------------------------AVLRAL--RVRYTAEAPAVR-------RVA
A0A2V7P8B1      HYEMAR------------------------DSLVSL--SPTHPDLR--------------
A0A2V7R2W8      DLTAKQ------------------------AELRAL--RGHYTDDNPPVR-------RAA
A0A2V7MS64      DLTSKQ------------------------AELRAI--RSRYTDASPAVQ-------RIA
A0A2V7Q7N9      DLTTKQ------------------------AELRAL--RTRYADANPAVR-------RVA
A0A2V7IRW6      DLTGKV------------------------AELRAL--RGRYTDANVAVR-------RVS
A0A1Q7DVU6      DLTGKV------------------------AELRAL--RGRYTDANVAVR-------RVS
A0A1Q7JSV2      DLTGKV------------------------AELRAL--RGRYTDANVAVR-------RVS
A0A2V7QN41      EVTQRQ------------------------ATLRAL--RYRYTDASDPVQ-------RVR
A0A2V7R603      EVTQRQ------------------------ATLRAL--RYRYTDASDPVQ-------RVR
A0A2V7LJS2      QYEIAR------------------------DSLASL--SPSHPDLP--------------
A0A1Q7GLJ7      QYEMAR------------------------DSLASR--SARHPDLP--------------
A0A2V7GRE3      QYERAR------------------------DSLASR--STSHPDLP--------------
A0A2V7EU00      ELTAKQ------------------------AELRAL--RYRYTDEHPPVK-------RLQ
A0A1Q6WE01      ELTTKR------------------------AELRAL--RYRYTEDHPAVR-------RLT
A0A2V7S9K3      EVTTKR------------------------AELRAL--RYRYTDDHPTVR-------RLA
A0A1Q7DXB9      ELTDKQ------------------------AELRAL--RYTYTDQHFPVQ-------QLA
A0A1Q7JD32      ELTDKQ------------------------AELRAL--RYTYTDQHFPVQ-------QLA
A0A2V7MVP8      ELTDKQ------------------------AELRAL--RYTYTDQNFPVQ-------QLA
A0A2V7N0A9      ELTDRQ------------------------AELRAL--RFRYADTHPPVR-------RLA
A0A1Q7DLS9      ELTAKR------------------------AELRAL--QQRYTEEHGTVR-------RLA
A0A1Q7JK96      ELTAKR------------------------AELRAL--QQRYTEEHGTVR-------RLA
A0A2V7KQV7      DLADRQ------------------------AELRVL--RFRYADTHPPVR-------RLA
A0A1Q7JGF6      ELSDRQ------------------------AELRVM--RFRYADTHPPVR-------RLA
A0A2V7SG67      ELSDRQ------------------------AELRVM--RFRYADTHPPVR-------RLA
A0A1Q7GIK9      ELTDRQ------------------------ADLRAL--RFRYADTHPPVR-------RLA
                                                                            

A0A2D5ZJF2      GELEALDRTTGEAYLE-----------------------LARQQWLVARERETELDQRYR
A0A0S8H9P3      QRISETQDQLVAAAEN------------------------AAVAL---DTRIGALTGRLS
A0A1E4BBP7      QQIEVMESQSIPTLVA-----------------------SSLQEL---RSREAEMKRRID
A0A3M2G737      LKDENLTASDILELRT--------------------SIFAAQMEMQTLKTKKEILDSTIA
A0A0H4TUX7      PQVDALSERIRQGYQA--------------------LRGAVSAALESLESRTEALDQRVA
A0A1G0LUG0      PQISALDDRIQQGHQA--------------------LRTAVGAALESIEARRQALDLRVQ
A0A1Q7E3T7      QLLVATEGKLLRAVQS-----------------------ALKGLIASLDVRIATLDDLRV
A0A1G0L906      PQVQAIDQRITQAAAA-----------------LREAANATVRGI---QANIASLDQNVA
A0A1G0LCC0      PQVQAIDQRITQAAAA-----------------LREAANATVRGI---QANIASLDQNVA
A0A2D5ZJE2      SKVKQAKTRLAAETQKIVDRDLLPGDPLLYSQGLVEKVLELRTELETARSRAAELNRFVA
A0A3M2G624      NQIQQVRLR----LQQ-----------------------QVDARLTMLDSREESLRLQLL
W0RI74          RNIAELHDRVLPQRLT-----------------------DYIATL---RTRESQYGQELQ
A0A3M2BJA6      QRIRELEAQ-LRTVAT-----------------------TYLQGL---TNQVQSYDQTLE
A0A3D4VBZ5      AALVALRDTVVPRSLD-----------------------AYLGEL---RLREQTLNSTIE
C1A5W1          AALVALRDTVVPRSLD-----------------------AYLGEL---RLREQTLNSTIE
A0A2V7PX99      SDLDALEQRTVPALAR-----------------------KLAADL---SAREAALTPQVD
A0A2V7ERC7      EAIRVLEIETIPRIAQ-----------------------SVLESL---RSRENQLTGRID
A0A2V7HBX4      EAVRVLERETIPQITV-----------------------AVLNSL---KAREPELDTRIS
A0A2V7JTZ5      EAVRVLERETIPQITV-----------------------AVLNSL---KAREPELDTRIS
A0A3D4YTR6      EAVRVLETETIPQITQ-----------------------AVLNSL---KAREPELGARID
A0A2V7F1M1      LGLKALIRSTQEELVR-----------------------AVRAHLTSIGAQSQALAALRS
A0A2V7KXK7      SDLTTLEHQQIPSLAR-----------------------ILAGTL---GEVVATTKPRAD
A0A2V7QDU7      RRIEDL-RAQLRGIAA-----------------------TYLQGL---SNQVVAIDLTLA
A0A2V7ITT6      EQVDTLERKTIPGLAR-----------------------ALIREL---AMRESVGDARIR
A0A2V7NJW1      EQVDTLERKTIPGLAR-----------------------ALIREL---AIRESVGDARIR
A0A2V7GFB5      AEVATLERQTIPTLVR-----------------------SLIDEL---GTRMAELDRRIG
A0A2V7RQ86      AEVATLERQTIPTLVR-----------------------SLIDEL---GTRMAELDRRIG
A0A2V7IWX2      DAVATLDRRTIPGMLR-----------------------ALRNNL---AARERDLGQRVD
A0A1Q7KE95      GEIELLERGTVPTLAQ-----------------------SLIDEL---TARERVLAPQVA
A0A1Q7T8X5      GEIELLERGTVPTLAQ-----------------------SLIDEL---TARERVLAPQVA
A0A2V7FK98      SEVATLERQTIPTLAR-----------------------QLMAEL---SGREAELGRRVT
A0A2V7R3Z8      SEVATLQRQTIPTLAR-----------------------QLMAEL---SGRDAELGRRVA
A0A2V7J3C0      AEIAALEQRTIPALAE-----------------------SLSAEL---LARERVLAPQIA
A0A2V7KWV9      TDLEQLEHQTIPGLIR-----------------------GLVAEL---ATQRRALASQLE
A0A1Q6ZHP2      GEIATLQRQTIPTLAR-----------------------QLAGQL---AAKETELGRRVD
A0A1Q7R6Z6      GEIATLQRQTIPTLAR-----------------------QLAGQL---AAKETELGRRVD
A0A2V7FYT7      GEIATLQRQTIPTLAR-----------------------QLAGQL---AAKETELGRRVD
A0A2V7IGR0      AEIATLQRQTIPALAQ-----------------------ALAGEL---AAREAELGRRVE
A0A2V7MR23      GEIRTLQRQTIPTLAR-----------------------TLAGQL---AAKEAELGRRTD
A0A2V7L1V3      GEIGTLERQTIPALAR-----------------------VLLDQL---AAREAELGRRLG
A0A1Q7E5D3      AEIATLKRQAIPVLAR-----------------------ALVGEL---ASRETELGRRVD
A0A2V7ISE2      GEIATLQRQTIPTLAR-----------------------ALAGQL---AGKEAELGRRVD
A0A1Q7J2X5      GEIATLQRQTIPGLAR-----------------------ALAGQL---AGKESELGRRVD
A0A2V7NPD1      GEIATLQRQTIPTLAR-----------------------ALAGQL---AGKEAELGRRVD
A0A2V7QPD8      SDVATLERQTIPTLAR-----------------------RLLAEL---SGREAELGRRVA
A0A2V7Q8M6      AEIATLEHQTIPALAR-----------------------GLMDQL---AARETELGRRLG
A0A2V7QBC3      AEIATLERQTIPALAR-----------------------GLMDQL---AAREMELGRRLG
A0A2V7LMU1      GEIATLERQTIPALAR-----------------------GLLDQL---TARDAELGRRLG
A0A2V7PBY9      EEITTLQRQTIPTLAR-----------------------GLLAQL---TAREADLGRRLG
A0A3M2BLV5      TQLARDEGSLRDAVDR-----------------------HL-QGI---DREMAEVRTELD
A0A2V7KS68      GQVAQLEQQTIPTLAR-----------------------GLAAQL---AARESEIGRQVD
A0A2V7N4L3      AQVGELQQRTIPSLAR-----------------------ALSSQL---AARATELGRQVD
A0A1Q7AZK2      REISELQQRTIPTLAR-----------------------ALSAQL---ATRESELGRQVG
A0A1Q7TNP7      REISELQQRTIPTLAR-----------------------ALSAQL---ATRESELGRQVG
A0A1Q7KG39      REISELQQRTIPTLAR-----------------------ALSAQL---ATRESELGRQVG
A0A1Q7GX75      AEIAELQQRTIPTLAR-----------------------ALSVQL---AARESELGRHVD
A0A1Q7LL80      AEIAELQQRTIPTLAR-----------------------ALSVQL---AARESELGRHVD
A0A2V7PFU2      AEITELQERTIPTLAR-----------------------ALASQL---ADRESELERQVN
A0A2V7MFS9      SEIAQLQQRTIPTLAR-----------------------TLASQL---ASRESELGRQVD
A0A2V7T933      REISELQQRTIPTLAR-----------------------ALSAQL---ATRESELGRQVG
A0A2V7J4D7      SEVDELAHRTVPALAA-----------------------SLVAEL---RVRESELVQRVD
A0A2V7LN90      AEVAELERRAIPGLAT-----------------------SLTREM---AFREAELAQRVD
A0A2V7LFN9      AEAATLERQTIPQLAT-----------------------GLAREL---ERRAAELGQRAD
A0A2V7MEK4      AEAATLERQTIPQLAT-----------------------GLAREL---ERRAAELGQRAD
A0A2V7P8B1      -RLSLLIPPTEAKLLR-----------------------AVQAGV---QGAIASLDGRIA
A0A2V7R2W8      AEAEALGRRTIPALAS-----------------------SLAAEL---RVRETELAERVA
A0A2V7MS64      LDVKTLQRQTIPSLAT-----------------------QLASEL---GLRETELAQRIN
A0A2V7Q7N9      VEVQDLERRTIPDLAA-----------------------SLTREM---QFREVELAQRVD
A0A2V7IRW6      DEVAVLEQQTIPALAT-----------------------KLTQEM---AVQEAGLAQRVD
A0A1Q7DVU6      DEVAVLEQQTIPALAT-----------------------KLTQEM---AVQERVLAQRVD
A0A1Q7JSV2      DEVAVLEQQTIPALAT-----------------------KLTQEM---AVQERVLAQRVD
A0A2V7QN41      GEVRTLLQTTIPTLAR-----------------------GLDADL---AAREEALSRRAD
A0A2V7R603      GEVRTLLQTTIPTLAR-----------------------LLDADL---AAREEALSHRAD
A0A2V7LJS2      -RLNLLISSTEAKLLR-----------------------AVQAGV---QGAIASLDGRIA
A0A1Q7GLJ7      -RLNLLVSSTEAKLLR-----------------------AVQAGV---QGSIASLDGRIA
A0A2V7GRE3      -RLNQLVSSTEADLLH-----------------------AVQGGV---QSAIASLEGRIT
A0A2V7EU00      ASIETLERHTIPALAG-----------------------ALLEEV---GTRERVLDSLVQ
A0A1Q6WE01      TDIDVLQRQAIPGLAR-----------------------ALHAEL---GARAQTLATEIS
A0A2V7S9K3      AEIDVLEHQTIPVLVR-----------------------TLLTEL---GTRQRLLASEVA
A0A1Q7DXB9      DAVATLERRTIPGMLR-----------------------ALRNNL---AAREHDLGQRVD
A0A1Q7JD32      DAVATLERRTIPGMLR-----------------------ALRNNL---AAREHDLGQRVD
A0A2V7MVP8      DAVATLEHRTIPALLR-----------------------AVRDNL---AVRERDLGQRVD
A0A2V7N0A9      AQVDTLARRVIPGLGR-----------------------ALIAGL---AARERELRQRAD
A0A1Q7DLS9      GEVQALEGRTIPALAR-----------------------VLVSEL---AARDAELTQRVR
A0A1Q7JK96      GEVQALEGRTIPALAR-----------------------VLVSEL---AARDAELTQRVR
A0A2V7KQV7      QQVDTLARYVIPELGG-----------------------ALVAAL---AAREHELQQRID
A0A1Q7JGF6      QQVDTLARRVIPELGR-----------------------AVVAGL---AAREHELQQRID
A0A2V7SG67      QQVDTLARRVIPELGR-----------------------AVVAGL---AAREHELQQRID
A0A1Q7GIK9      LQVDTLAQRVIPGLAR-----------------------TLMDGL---AARARELASRRD
                                                                            

A0A2D5ZJF2      TQLVEAQELGA-------KATELAKLESEVSKTEKMLDILDDRIKEVDVTEKADVLNINI
A0A0S8H9P3      NLQAELRQLPA-------VESELTRLQNEVEIHSDMYKYLLSRYQESQIAEAEISPYVEV
A0A1E4BBP7      GASQELKQIPA-------RTVEEMRLNRELQIAQTMYVDLQQRAMSARLSERNALPDVSI
A0A3M2G737      DYERKIKTLPQ-------KSIDYARLVRQRSSAEKLYLLVEQHYNEASIAEQSEFGNVEI
A0A0H4TUX7      SARARLRTFPG-------KESRIAQLQLEASILNDTYRYLLTEYESARLTEATIGPYINL
A0A1G0LUG0      ELRGTLGTFPG-------KQSRIAQLQLETSIHNDTYRYLLGQLEAARLQENTIAPYINL
A0A1Q7E3T7      RRVANVEQRSS-------TDAEEARLEERVENGRKIADELRIEYQRARIAEAVEVGHVEI
A0A1G0L906      NLRQRLGTYPG-------KETRFAQLALDIELQNGIYKYLLSELESARISAATISPYIQI
A0A1G0LCC0      NLRQRLGTYPG-------KETRFAQLALDIELQNGIYKYLLSELESARISAATISPYIQI
A0A2D5ZJE2      DYATKLHSLPD-------KELALARKTREYTVNENTYLMMKEKYEEVRISEAGEIGNVRI
A0A3M2G624      PYQQQLETFPL-------KEVELARLEREFRLNEEIYSLLTRQHEQTRLAEAAIVNDIQV
W0RI74          TATHELQGIPE-------RTIQTGVLARERDVRAEIYTKLRTASAQAQLAQQSAVPDVKI
A0A3M2BJA6      QFAAQLEVIPQ-------KQVQLARLEREEKVLSELFTLLQTRLKEAQIAQAVEDASIRV
A0A3D4VBZ5      QSSKDLKGIPS-------RTIEEQRLKRQVEVAARVYESLNMKAAEAKLAEASTIPDVSI
C1A5W1          QSSKDLKGIPS-------RTIEEQRLKRQVEVAARVYESLNMKAAEAKLAEASTIPDVSI
A0A2V7PX99      SAFGYMRTVPP-------LALEEDQLKRAVAGAEAFSATVNQRYEAARLGLISSSPDVRL
A0A2V7ERC7      TQERVLRQIPS-------RSIEEMRLVRRVSASETMYNSLKARYEEVSLAEAQTTPDLSI
A0A2V7HBX4      VGSQELRGIPA-------RATEEARLVRQVAATENLYNSLKARYEEVSLAEVQTAPDLSV
A0A2V7JTZ5      VGSQELRGIPA-------RATEEARLVRQVAATENLYNSLKARYEEVSLAEVQTAPDLSV
A0A3D4YTR6      VGSQELRAIPA-------RATEEMRLARRVVASESLYNTLKARYEELSIAEAQTTPDLAV
A0A2V7F1M1      RTGASFQRLPA-------TEAEGGRLERLVEDLRSTGDRIRQDYKNARMAEAISAGDARV
A0A2V7KXK7      TAIGQLRAAPS-------IALEGSRLEREQRLAEEQFNNVDGEYQKAKLGLISALPDVRV
A0A2V7QDU7      KSNAQLQTIPA-------KEIRLAQLERNVSGLAQIYTQLESRLKESEIAAAAEDPSVRL
A0A2V7ITT6      LASQDLRQIPP-------RAIQEGRLRREVAVAENLFTTLQQRYEEARLAEASSIPDVRV
A0A2V7NJW1      LASQDLRQIPP-------RAIQEGRLRREVAVAENLFTTLQQRYEEARLAEASSIPDVRV
A0A2V7GFB5      SASQELRRIPA-------RSVEEARLRRSVTIADNLYTSLQQNYEAAKLAEASSIPDIRI
A0A2V7RQ86      SASQELRRIPA-------RSVEEARLRRSVTIADNLYTSLQQNYEAAKLAEASSIPDIRI
A0A2V7IWX2      STVRYLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQRYDEARVAEASALPDVRI
A0A1Q7KE95      AADRDLRRIPQ-------RAIEEARRRRDVDLATNLYTSVQQRYDEARLAEASSVADVRI
A0A1Q7T8X5      AADRDLRRIPQ-------RAIEEARRRRDVDLATNLYTSVQQRYDEARLAEASSVADVRI
A0A2V7FK98      ADARSIQAVPP-------RAIDEARLQRQVTLAENLFTSLQKNYDEARLAEESAVPDARI
A0A2V7R3Z8      ADTRSIQLVPP-------RAIDEARLQRQVTLAENLFTNLQKNYDEARLAEESAVPDARI
A0A2V7J3C0      AGEHELRGIPQ-------RAIDEARLRRDLELATNLFTGVQQRYDEARLAEASSIADVRI
A0A2V7KWV9      TGGRELQGIPQ-------RAIEDARLRRDVSIAENLFTSVQQRYSEARLAEASSIADVRV
A0A1Q6ZHP2      ADSRTLKQIPA-------RAIEEARLRRDAALAENLYLSLQGKYDEARLAEASTLSDVRV
A0A1Q7R6Z6      ADSRTLKQIPA-------RAIEEARLRRDAALAENLYLSLQGKYDEARLAEASTLSDVRV
A0A2V7FYT7      ADSRTLKQIPA-------RAIEEARLRRDAALAENLYLSLQGKYDEARLAEASTLSDVRV
A0A2V7IGR0      TGSQNLRQIPP-------RAIDEARLRRDMTLAENLYATLQQRYEEARLAEASTIPDVRI
A0A2V7MR23      ADSRTLRQIPA-------RAIEEARLRRDAGLAENLYTGLQAKYDEARLAEVSSLSDVRV
A0A2V7L1V3      ADSRSLQQIRA-------RAIEEARLRRTKTMSENLYTMLKERYEEARLAEASTIPDVRI
A0A1Q7E5D3      ADSRTLRQIPP-------RLIEEARLRRADTLAANLYTTLQQRYEEARLAQASTVPDVRI
A0A2V7ISE2      ADSRSLRQIPA-------RTIEEARLRRDASLAENLYTSLQQKYDEARLAEASTLADVRV
A0A1Q7J2X5      ADSRSLRQIPG-------RTIEEARLRRDASLAENLYTSLQQKYDEARLAEASTLADVRV
A0A2V7NPD1      ADSRSLRQIPG-------RTIEEARLRRDASLAENLYTSLQQKYDEARLAEASTLADVRV
A0A2V7QPD8      EDTRSIQAVPP-------RAIDEARLQRQVTLAENLFTSLQKNYDEARLAEESAVPDARI
A0A2V7Q8M6      TDSRSLRQIPA-------RAIEEARLRRTLSMAEDLYTLLQKRYEEARLAEASTIPDVRI
A0A2V7QBC3      ADSRSLRQIPA-------RAIEEARLRRTLSMAEDLYTLLQKRYEEARLAEASTIPDVRI
A0A2V7LMU1      ADSKSLRQIPA-------RAVEEARLRRSVTMAENIYTMLQQRYEEARLAEASTIPDVRI
A0A2V7PBY9      TDSRTLRDIPA-------RAIEEARLRRDVSLSENLFTMLQQRYEEARLAEASTIPDVRI
A0A3M2BLV5      RIQEAQRRFPQ-----LQNRYDELDLQRSIDREMVLYLQ-SQLYQAQILAQGAGDGFIDV
A0A2V7KS68      AASTDLRQIPA-------RTIEEVRLRRNADLKEQTYTSLQQRFDQARLAAESTVPDVRV
A0A2V7N4L3      AASPGLRQIPG-------RTIEEARLTRNAQLKEQTYTQLQQRFDQARLAAEATVPDVRI
A0A1Q7AZK2      AASRDLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRI
A0A1Q7TNP7      AASRDLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRI
A0A1Q7KG39      AASRDLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRI
A0A1Q7GX75      AASSDLRQIPA-------RTIEEARLNRNVQLKEQTYTALQQRFDQARLAAEATVPDVRI
A0A1Q7LL80      AASSDLRQIPA-------RTIEEARLNRNVQLKEQTYTALQQRFDQARLAAEATVPDVRI
A0A2V7PFU2      SASNDLRQIPG-------RAIEEVRLNRNVELKEQTYTQLQQRYDQARLSAEATVPDVRV
A0A2V7MFS9      AASHDLRQIPG-------RAIEEVRLNRNAQLKEQTYTALQQRYDQARLAAEATVPDVRI
A0A2V7T933      AASRDLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRI
A0A2V7J4D7      AASSSIQKIPP-------LAVEESRLQRGVTLAEQTVTNLQARYEEARLAEISAIADVRL
A0A2V7LN90      SAATDLRRIPP-------LAVEETRLEREVTRGEQAVASLQTLYEEARLAEVSAIPDVRL
A0A2V7LFN9      SVARDLRRIPP-------LAVEETRLQRDVTQSAQTVANLQQHYEEARLAEASSIPDVRF
A0A2V7MEK4      SVARDLRRIPP-------LAVEETRLQRDVTQSAQTVANLQQHYEEARLAEASSIPDVRF
A0A2V7P8B1      A----INDLRARRAGNLQHDADEARLTERLDNARKVADALRTEYQKAGIAEAVTVGQVEI
A0A2V7R2W8      TASTGLQQVPP-------LAVEEARLQRNVTLAEQAVTNLQQRYEEARLAEVSSIPDVRL
A0A2V7MS64      AASTGLRRIPP-------LAVEEERLVREVTLRDQAVSNLTARYQEARLAEVSAIPDVRL
A0A2V7Q7N9      SAASNLRRIPP-------LAVEETRLEREVTRGEQAVASLQTLYDEARLAEVSAIPDVRL
A0A2V7IRW6      SAAGGLRRIPP-------LAVEETQLQRSVTLAEQVVTNLQQRYEEARLAEVSAIPDVRL
A0A1Q7DVU6      SAAGGLRRIPP-------LAVAETQLQRDVTLAEQVVTNLQRRYEEARLAEVSAIPDVRL
A0A1Q7JSV2      SAAGGLRRIPP-------LAVAETQLQRDVTLAEQVVTNLQRRYEEARLAEVSAIPDVRL
A0A2V7QN41      AAFGYLHDLPP-------LALEEARLQRDVAIAEQLFTTVQQSYNQTQLAAVSTLPDVRI
A0A2V7R603      AAFGYLHDLPP-------LALEEARLQRDVAIAEQLFTTVQQSYNQTQLAAVSTLPDVRI
A0A2V7LJS2      A----INDLRARRAGNLQHVAQEARLTERVENARKVADELRTEYQKAGIAEAVTVGQVEI
A0A1Q7GLJ7      A----IDDLRAHWAGGLQQDAEEARLKERVDNARKVADELRVEYQKAGIAEAITVGQVEI
A0A2V7GRE3      A----MNDLRARQQQLSTSEEEEARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEI
A0A2V7EU00      SGGRELQQIPL-------RAVEEARLRREVTIAENLYTTLQQRYEEARLAEASTIPDVRV
A0A1Q6WE01      AGGRELQAIPQ-------RSIEEGRLRRDVSIAENLYASVQQRYNEARLGEASTVADVQV
A0A2V7S9K3      AGGRALQAIPQ-------RAVEEARLRRDVAIAENLYSSVQQRYDEARLAEASTVADVRI
A0A1Q7DXB9      STVRYLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQHYDEARVAEASALPDVRI
A0A1Q7JD32      STVRYLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQHYDEARVAEASALPDVRI
A0A2V7MVP8      STVRYLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQHHDEARVAEASAVPDVRI
A0A2V7N0A9      SITGVLRRAPP-------AALEEVRLARDQANAEQLFSDLQHRYQEARLAEVSTLPDVRI
A0A1Q7DLS9      AASAELRQIPS-------LAIEDARLRREVANAERLFTSIQQRYDEARLAEVSTIPEVSV
A0A1Q7JK96      AASAELRQIPS-------LAIEDARLRREVANAERLFTSIQQRYDEARLAEVSTIPEVSV
A0A2V7KQV7      SIARALRGAPP-------VALEEIRLARDQANATELFSNLEQRYNEARLAEVSTLPDVRI
A0A1Q7JGF6      SISRDLRSAPP-------VALEEVRLARDQANAEQLFSNLQQRYQEARLAEVSTLPDVRI
A0A2V7SG67      SISRDLRSAPP-------VALEEVRLARDQANAEQLFSNLQQRYQEARLAEVSTLPDVRI
A0A1Q7GIK9      SIARDLQSAPP-------VALTEIRLARDQTNAEQLFSNLQQRYQEARLAEVSTLPDVRI
                                                                :          .

A0A2D5ZJF2      LEYAEVEDEPSKP--EKARIMGAALVAGLILGAGLALLVDWKDHRFRSADEITAIL-GVP
A0A0S8H9P3      LDPA-SWARPVSG--GRRINIIFGGLLGLLLGLGAAFFLEYLDRSLKSTSDVETSL-GVP
A0A1E4BBP7      LDTAVAPRFPSSD--TTLSIILVAIAASIGLGLALAILLDRLDKRFRYPEQATHEL-GLD
A0A3M2G737      IESAETPTKPINP-PKPLRTVFLGGFLGLGLGLGIVFVREFFNTQIRTPEDIKKR--GYT
A0A0H4TUX7      LDPA-SPAFRVGT--TLRQKIVLGMLVGLLLGLGGAFFLEYLDQTIKNAGDVERVI-GVP
A0A1G0LUG0      LDPA-SPAFRIGR--TPWQTAMLGLLVGLLLGFGAAFLLEYLDQTIKSAADVERAL-GVP
A0A1Q7E3T7      VDLAVPPTAPLGI--GFAERLALGLLFGLVLGGGSAWLTEHLRSSIARPNEIV-EL-GLP
A0A1G0L906      VETATVAARIGVG---TRQKVTIGLLVGLFLGIVAAFFLEYLDQTIKTAADVERAL-EIP
A0A1G0LCC0      VETATVAARIGVG---TRQKVTIGLLVGLFLGIVAAFFLEYLDQTIKTAADVERAL-EIP
A0A2D5ZJE2      IDAALPFLDPVRP--NRRMNALLGLVVGLGLALSLAFFFEYLDTSLRTIDEVEQKL-DTV
A0A3M2G624      LDYASIPTAPIGGGPNRQKAILLGALLGIGVGLGVAFLLEFLDNTIRETDEIERHI-QLP
W0RI74          LDTAITPLAPSSN--TAPTFIGGGLFAGLVIGIGLAFLLDLLDNRFRYPEQARVDL-GLE
A0A3M2BJA6      VDPAILPSEPIKP--KTVLNIALGLILGMMLGVGLAFTREHMDDTVHTREDLVEATGGAP
A0A3D4VBZ5      LDAAVPPLSPTRN--TAPMIILGAVGAALALGLLLAIVLDQLDKRFRYPEQATDDL-GLF
C1A5W1          LDAAVPPLSPTRN--TAPMIILGAVGAALALGLLLAIVLDQLDKRFRYPEQATDDL-GLF
A0A2V7PX99      LDSAVQPGKPSLD--LGPLLIALSFLTSLGLGMVGAVVLDRADPRVRTPEQVTRGM-RLP
A0A2V7ERC7      LDYAIPPVHPTSN--GARRLLILAVLASIALACAIALIRDRFDRLFRYPKEATHEL-GLI
A0A2V7HBX4      LDTAVAPTLPTSN--DAPRLLLLAVVASMGLAVGIALIRDRLDRRFRYPEQATREL-GLS
A0A2V7JTZ5      LDTAVAPTLPTSN--DAPRLLLLAVVASMGLAVGIALIRDRLDRRFRYPEQATREL-GLS
A0A3D4YTR6      LDTAVGPNFPTSN--DAPRLLLLAVAASIGLAFGIALILDRLDPRFRYPEQATHDL-GLS
A0A2V7F1M1      IDWAPLPYKAAGI--PPWAKLGLGLLLGLLLGCGAAGLAESGNSLLMRPEELERAL-NVR
A0A2V7KXK7      LDPAQEPRRPAAD--FGPLLILLAAMASFGLAVMGVTLRDKMDPKVRYPEQITGRM-QLP
A0A2V7QDU7      VDAALLPREPVSP--RRAFSIVLALLGGLTLGLGAALTREHLDRAVHTRHDLLAVT-GRP
A0A2V7ITT6      LDVATPPLVPVRN--TAPGVILGAFLGSMALGLVGVVRRDRADPRVRCPEQVTHDI-GLP
A0A2V7NJW1      LDVATPPLVPVRN--TAPGVILGAFLGSMALGLVGVVRRDRADPRVRCPEQVTHDI-GLP
A0A2V7GFB5      FDKAVVPLQPVKN--TAPRLLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDL-GLP
A0A2V7RQ86      FDKAVVPLQPVKN--TAPRLLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDL-GLP
A0A2V7IWX2      LDAPVQPYQPIGS--VAPFLVIMAFLASAGLGVLGAVVIDTLDPRFRDPGHVTQGL-GLR
A0A1Q7KE95      LDAAVPPQESLGN--STLRFIVLGLAAGLGLGLVGAVVGDRLDPRMRYPEQVTRQM-GLP
A0A1Q7T8X5      LDAAVPPQESLGN--STLRFIVLGLAAGLGLGLVGAVVGDRLDPRMRYPEQVTRQM-GLP
A0A2V7FK98      LDHAVVPQDPVRN--TAPRVVFLGFAASLALGLCGAVVLDRIDPKVRYPDQVSRGL-GIP
A0A2V7R3Z8      LDHAVVPQDPVRN--TAPRVIFLGFAASLALGLCGAVVLDRIDPKVRYPDQVSRGL-GIP
A0A2V7J3C0      LDVAVPPQEPLKD--TASRLLVLGFIAGLGLGLVGAVVADRVDPRMRYPDQVTRQM-GLP
A0A2V7KWV9      LDAAVAPETPVKN--TAARLLILGLFAGLGLGVVGAVVVDRFDPRVRYPAQVTTDM-GLR
A0A1Q6ZHP2      LDSAVVPRRPVKN--TRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLT
A0A1Q7R6Z6      LDSAVVPRRPVKN--TRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLT
A0A2V7FYT7      LDSAVVPRRPVKN--TRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLT
A0A2V7IGR0      LDSAVSPQRPVKN--TAPRIVLFALFASLGLAVAGAVLLDRVDPRVRYPEQVSRGM-GLT
A0A2V7MR23      LDSAVVPRRPVKN--TAPRVILLAFFGSFALAVLGAVLIDRIDPRVRYPDQVSREM-GLT
A0A2V7L1V3      LDAAVVSREPVSA--MGGRLILLGFCGSFGLAVVGAVLLDRVDPRVRYPDQVSREM-GLA
A0A1Q7E5D3      LDSAVVPQRPVKN--RAPRVILLAFFASFGLAVMGAVFIDRVDPRVRYYDQVSREM-GLT
A0A2V7ISE2      LDSAVVPRRPVKN--TAPRVILMAFFGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLT
A0A1Q7J2X5      LDSAVVPRRPVKN--TAPRVILMAFVGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLT
A0A2V7NPD1      LDSAVVPRRPVKN--TAPRVILMAFFGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLT
A0A2V7QPD8      LDHAVVPQDPVRN--TAPRVVFLGFAASLALGLCGAVVLDRIDPKLRYPDQVSRGL-GIP
A0A2V7Q8M6      LDAAVVSREPVSS--AGGRMILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLA
A0A2V7QBC3      LDAAVVSREPVSS--AGGRLILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLA
A0A2V7LMU1      LDAAVVSRQPVRD--LAGRMILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLT
A0A2V7PBY9      LDAAVVSRRPVQD--LAGRLIVMGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLA
A0A3M2BLV5      VDPPGAPIE-VTP--RGKINLMLGALLGLILGVGAAFFLEYLDRTVRTSADVETLL-GIP
A0A2V7KS68      LDPAVVPQRPVKN--TTPRLLLLGLIAGLGLGMVGAVVLDRVDPKVRYPEQVSREL-GLP
A0A2V7N4L3      LDPAIVPQRPFKN--TAPRLLLMGLIAGLGLGIVAALVLDRADPRVRYPQQVSRDL-GLP
A0A1Q7AZK2      LDPAVVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLP
A0A1Q7TNP7      LDPAVVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLP
A0A1Q7KG39      LDPAVVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLP
A0A1Q7GX75      LDSAIVPQRPVKN--TASRILLMGLLAGLGLGIVGAVLLDRIDPSVRYPQQVSRDL-GLP
A0A1Q7LL80      LDSAIVPQRPVKN--TASRILLMGLLAGLGLGIVGAVLLDRIDPSVRYPQQVSRDL-GLP
A0A2V7PFU2      LDPAVVPQRPVKN--TAPRLLLMGLVAGLGLGVLGAIVLDRADPRVRYPEQVSRDL-GVP
A0A2V7MFS9      LDPAIVPQRPIKN--TAPRLLLMGLLAGLGLGVVGAILLDRVDPKVRYPEQVSREL-GLS
A0A2V7T933      LDPAVVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLP
A0A2V7J4D7      LDRAVEPQVPVGH--MRAILIFLAFWGGLGVGVAGAVLLDRTDRKVHYPEHVTRAM-GLS
A0A2V7LN90      VDPAVQPEEPAEN--WRPLLIALAFLASLGAGVTGAAVLDHTDGRVHYPQQVTGAM-GLP
A0A2V7LFN9      VDPALEPQEPTEN--WAPVLVLFTLITGLGAGVGSAVALDHRDRRVHDPEDITRTM-GLT
A0A2V7MEK4      VDPALEPQEPTEN--WAPVLVLFTLITGLGAGVGSAVALDHRDRRVHDPEDITRTM-GLT
A0A2V7P8B1      VDHATLPTKPAGI--GLVEQLVLGLLVGLMLGAAGAFVADRMASAIARRVQVEH-L-GLS
A0A2V7R2W8      LDRAIAPHRPVGH--IGAILIALAMVGGLGLGMTGAVVLDSTDRRVRHPDDVTRAM-GLA
A0A2V7MS64      IDPAVQPEDPAAS--WTKILIALALLGGLSAGIAGAVVLDQNDKRVQYPEEVTGAL-GLT
A0A2V7Q7N9      VDPAVQPEEPTEN--WRPVLIALAFLASLGAGVAGAAVLDHTDRSVRYPQQVTGAM-GLP
A0A2V7IRW6      IDPAIEPQQPAAS--WAVLLVVLAFLGSLGAGVAGAVVRDRTDRRVHYPEHVTGTM-GLA
A0A1Q7DVU6      IDPAIEPQQPAAS--WSVLLVALAFLGSLGAGVAGAVLRDRTDRHVHYPEHVTGTM-GLA
A0A1Q7JSV2      IDPAIEPQQPAAS--WSVLLVALAFLGSLGAGVAGAVLRDRTDRHVHYPEHVTGTM-GLA
A0A2V7QN41      LDRATAPDRPDRD--LTPLLVCASFVVSLGLAVFGVVMLDELDHKVRYPEHVTHQM-RLS
A0A2V7R603      LDRATAPDRPDRN--LTPLLACASFVLSLGLAVFGVVMLDGLDHKVRYPEHVTHQM-RLS
A0A2V7LJS2      VDHATLPMKPAGI--GLAEQLALGLLVGLILGAGGAFVAERVGSSIARRVEVEH-L-GLS
A0A1Q7GLJ7      VDHAALPAKPAGI--GLPEQIALGLLVGLMLGSAGAFLAERLGSTIAQRVQVER-L-GMS
A0A2V7GRE3      VDHAALPAKPAGI--GLPEQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVEQ-L-GMS
A0A2V7EU00      LDAAVVPHQPIKN--TAPRLILVGLFGGLGLSLLGAVMMDRLDRHFRYPQQVTREM-GLA
A0A1Q6WE01      LDAAVSPQEAAKN--TASRLVAFGFVVGLSLGMVAAVVVDRLDPRVHHPDQVTEQM-GLS
A0A2V7S9K3      LDAAVAPQDPVKD--MTRRLIVLGLVAGFGLALVGAVVADRLDPRVRYPDQVTNQM-GLP
A0A1Q7DXB9      LDAPVQPYQPIGS--VAPFLVIMAFLASGGLGVLGAVLIDTLDPRFRDPGHVTQGL-GLR
A0A1Q7JD32      LDAPVQPYQPIGS--VAPFLVIMAFLASGGLGVLGAVLIDTLDPRFRDPGHVTQGL-GLR
A0A2V7MVP8      LDAPDQPYRPLGS--LAPFVLIMSFLASAGLGVLGAVVVDSLDPRFRDPGHVTRDL-GLR
A0A2V7N0A9      LERAVQPTRPATN--TAPLLVVVACLTSFGAGVLGAALRDRADPKVRSPEEVTRTM-GLL
A0A1Q7DLS9      LDAAVEPEEPLLD--PTPFLVLVSFLGSLGLAALGAVVLERADRKVRYPDQVTRTM-GLP
A0A1Q7JK96      LDAAVEPEEPLLD--PTPFLVLVSFLGSLGLAALGAVVLERADRKVRYPDQVTRTM-GLP
A0A2V7KQV7      LERASRPARPVVN--ATPLVLLLALVVSLGTGVGGAALLDRADPKIRDPEQVTRAM-GLS
A0A1Q7JGF6      LEPAVRPTRPVSD--TAPLVIIVACIMSLGAGVLGAVLLERADPKVRYPDEVTRAI-GLP
A0A2V7SG67      LEPAVRPTRPVSD--TAPLVIIVACIMSLGAGVLGAVLLERADPKVRYPDEVTRAI-GLP
A0A1Q7GIK9      LERAVRPTRPASR--TAPLLIIAAFLTSFGAGVAGAVVRERADPKVRYPDQVTSAM-GLP
                .: .                       .   .   .   :     .              

A0A2D5ZJF2      VLGVVP------------------S--MSRKASRPDHGQQVSRA--------SSSMIAEA
A0A0S8H9P3      VLGWIP------------------K--ITGDGQRRISLVAAHD---------PEGVAAEA
A0A1E4BBP7      IVGAIP------------------T--YRNPTSAAARLE-------------EASQLIES
A0A3M2G737      LLSVIP------------------SMSLDNANRKKRKSKSVAENPQLLTFANPRSTVAES
A0A0H4TUX7      VLGLIP------------------HDPALRRSGNGKPPITIVAREG------MDQPAAEA
A0A1G0LUG0      VLGQIP------------------DDQRLARGNSHRGTVGIITQLP------HDEPSAEA
A0A1Q7E3T7      LLGAVP------------------R--CQDGRNGSSVK--------------AVGAVIEA
A0A1G0L906      VLGLIP-------------------LDPRGPHDGPQRNGRRRASISLISHAAPDDPTSEA
A0A1G0LCC0      VLGLIP-------------------LDPRGPHDGPQRNGRRRASISLISHAAPDDPTSEA
A0A2D5ZJE2      VLGAVA------------------A--LEEAAEAEDESARLVTLHE------PQSPMAEA
A0A3M2G624      VYGMIP------------------Q--IESIKNGRRTHKAKARFETLVTHLAPKSIPSEA
W0RI74          VLGVVP---------------------VVDQSGRQSPE--------------QIAQIVEA
A0A3M2BJA6      IMGMIP---------------RIRQRGLRPSKTSAAANGASHLGERLVAGRDPRNPVSEA
A0A3D4VBZ5      VLGVVP---------------------VIGGKGRRNAD--------------QAAQVVES
C1A5W1          VLGVVP---------------------VIGGKGRRNAD--------------QAAQVVES
A0A2V7PX99      ILAALP------------------HVSLRQAPGASL----------------RSAEVIEA
A0A2V7ERC7      IAGTVP------------------R--FKPNRRGDFQLL-------------TLSQAVES
A0A2V7HBX4      VAGTVP------------------K--FKANHRGEFQIA-------------MMSQAVES
A0A2V7JTZ5      VAGTVP------------------K--FKANHRGEFQIA-------------MMSQAVES
A0A3D4YTR6      ITGTVP------------------R--IKANGRGDIKLE-------------LMSQTVEA
A0A2V7F1M1      DLGVIPPLLETSASRPLRRLPIPLF--ISASRRPEAASRGEQATWEVVADSAPLSSAAEA
A0A2V7KXK7      ILGAVP------------------HVSWRLGANGD-----------------GPAQVIEA
A0A2V7QDU7      VLGIIP------------------HADGEMWSARLARGKGPGRARRRPIGAGSRAELAEA
A0A2V7ITT6      ILGVLP------------------H--VKVRGAGPEDE--------------HVAQVIEA
A0A2V7NJW1      ILGVLP------------------H--VKVRGAGPEDE--------------HVAQVIEA
A0A2V7GFB5      ILGAVP------------------H--LKARTG-------GQLTRE------QRVQLVEA
A0A2V7RQ86      ILGAVP------------------H--LKARTG-------GQLTRE------QRVQLVEA
A0A2V7IWX2      ILGALP------------------H--LS-----------RAGNGE------GTAQAIEA
A0A1Q7KE95      ILGVLP------------------H--VKDRG--------AGPNDE------HVIHVIEA
A0A1Q7T8X5      ILGVLP------------------H--VKDRG--------AGPNDE------HVIHVIEA
A0A2V7FK98      ILGAVP------------------H--LRNLPRGGRGN--GARVPD------DVNEVVEA
A0A2V7R3Z8      ILGAVP------------------H--LRNLPRGGRGG--GARVPD------DVNEVVEA
A0A2V7J3C0      ILGVLP------------------H--VKDRA--------AGPDDE------EVAQVIEA
A0A2V7KWV9      ILGALP------------------H--VKKRA--------GASDDE------SGPLVIET
A0A1Q6ZHP2      ILGAVP------------------H--IRAGARPERSG-RRVRPPE------DVAVVVEA
A0A1Q7R6Z6      ILGAVP------------------H--IRAGARPERSG-RRVRPPE------DVAVVVEA
A0A2V7FYT7      ILGAVP------------------H--IRAGARPERSG-RRVRPPE------DVAVVVEA
A0A2V7IGR0      ILGAVP------------------H--LRKSEAQRQGT-GPL--SE------NVAEVLEA
A0A2V7MR23      ILGAVP------------------H--IRPGARP-ERSGRRVRPPE------DVAVVVEA
A0A2V7L1V3      ILGAVP------------------H--LRTLPHAGRHG--RARVPE------DVNQVVEA
A0A1Q7E5D3      ILGAVP------------------H--LRPRAGLGRSGG--AHPPE------DIAVVVEA
A0A2V7ISE2      ILGAVP------------------H--VRPGARPTPRNGRRVRPPE------DVAVVVEA
A0A1Q7J2X5      ILGAVP------------------H--VRPGARPTPRNGRRVRPPE------DVAVVVEA
A0A2V7NPD1      ILGAVP------------------H--VRLGARPTPRNGRRVRPPE------DVAVVVEA
A0A2V7QPD8      ILGAVP------------------H--LRNLPRGGRGG--GARVPD------DVNEVVEA
A0A2V7Q8M6      ILGAVP------------------H--LRTLPHAGRHG--KGRVPE------DVNQVVEA
A0A2V7QBC3      ILGAVP------------------H--LRTLPHAGRHG--KGRVPE------DVNQVVEA
A0A2V7LMU1      ILGAVP------------------H--LRTLPH-GRHG--RGRVPE------DVNQVVEA
A0A2V7PBY9      ILGAVP------------------H--MRTLAH-GR-G--RGRIPE------DVNQVVEA
A0A3M2BLV5      VLGIIP------------------R--LRKVDEEDDRRAGLPLIVALD----PLDPAAEA
A0A2V7KS68      ILGVLP------------------H--LRTK---------------------EPAEVVEA
A0A2V7N4L3      ILGAVP------------------H--LRAK---------------------EPAEVIEA
A0A1Q7AZK2      IIGAVP------------------H--LRAK---------------------EPAEVVEA
A0A1Q7TNP7      IIGAVP------------------H--LRAK---------------------EPAEVVEA
A0A1Q7KG39      IIGAVP------------------H--LRAK---------------------EPAEVVEA
A0A1Q7GX75      ILGALP------------------H--LRAK---------------------EPAEVVEA
A0A1Q7LL80      ILGALP------------------H--LRAK---------------------EPAEVVEA
A0A2V7PFU2      ILGAVP------------------H--LRAK---------------------EPVEVIEA
A0A2V7MFS9      ILGAVP------------------H--LRAK---------------------DPVEVVEA
A0A2V7T933      IIGAVP------------------H--LRAK---------------------EPAEVVEA
A0A2V7J4D7      ILGAVP------------------H--VDWRNGNRDA---------------AATQVIES
A0A2V7LN90      ILGAVP------------------H--LARNGGTRKPD--------------GVMQVVEA
A0A2V7LFN9      ILGVVP------------------H--LERKRRAKQPE--------------DGLPVLEA
A0A2V7MEK4      ILGVVP------------------H--LERKRRAKQPE--------------DGLPVLEA
A0A2V7P8B1      VLGVVP------------------R--WGRLGNKKGPK--------------SAEATVEA
A0A2V7R2W8      ILGAVP------------------H--VDW-RNGKRDA--------------AVAQVIEA
A0A2V7MS64      ILGAVP------------------H--LERNGNGRAKA--------------GALEAVEA
A0A2V7Q7N9      ILGAVP------------------H--LNRNGGRRKPD--------------GVMQVVEA
A0A2V7IRW6      ILGAVP------------------H--LERGRNGKKAG--------------AVLQVVEA
A0A1Q7DVU6      ILGAVP------------------H--LERGRNGKKSG--------------AVLQVVEA
A0A1Q7JSV2      ILGAVP------------------H--LERGRNGKKSG--------------AVLQVVEA
A0A2V7QN41      ILGAVP------------------RFDWRQLGNGKTAE--------------AAAPVVEA
A0A2V7R603      ILGAVP------------------RFDWRHLGNGKTAE--------------AAAPVVEA
A0A2V7LJS2      VLGIVP------------------R--WGRETDKKGPG--------------SADAAVEA
A0A1Q7GLJ7      VFGVIT------------------H--WDRDAREKGVK--------------NPDAVVEA
A0A2V7GRE3      VIGVIT------------------H--LDRDGAETGMK--------------SPDAVVEA
A0A2V7EU00      ILGAVP------------------R--IKRGGNGVDPE--------------EARQVIEA
A0A1Q6WE01      IIGVLP------------------H--VRDRRAGPDDQ--------------QVAHAIEA
A0A2V7S9K3      ILGVLP------------------H--VRNRAAGPDDE--------------HVAHAIEA
A0A1Q7DXB9      ILGALP------------------H--LSRAGNGEGTA-----------------QAIEA
A0A1Q7JD32      ILGALP------------------H--LSRAGNGEGTA-----------------QAIEA
A0A2V7MVP8      ILGALP------------------H--LSRAKNGEATT-----------------QAIEA
A0A2V7N0A9      ILGAVP------------------H--VHRGKDMGDDG----------------VKAVEA
A0A1Q7DLS9      ILGAVP------------------H--VSWHDGANGDG---------------VSRVIEA
A0A1Q7JK96      ILGAVP------------------H--VSWHDGANGDG---------------VSRVIEA
A0A2V7KQV7      ILGAVP------------------H--VHRNGNGNGNGNGRAH------AETDDTGALEA
A0A1Q7JGF6      ILGAVP------------------H--VQRGNGKRRAG-----------GEDDIAKAVEA
A0A2V7SG67      ILGAVP------------------H--VQRGNGKRRAG-----------GEDDIAKAVEA
A0A1Q7GIK9      ILGAVP------------------H--VRQTAPSRRPAEVRATWRAPEVDAEDGAKAVEA
                  . :.                                                    *:

A0A2D5ZJF2      YRTIRTAVYFGAP---NGEAR-TILVTSPSPGDGKSTTASNLAIAMAQAGQRTLLMDSDF
A0A0S8H9P3      YRVLRTNIAFSTA---RERPLSSLAFTSPGPDEGKSTSVANLAAVLADRGDRTLLVDADL
A0A1E4BBP7      FRTIALSVRSAFE---GLGPV-QLAVSSPGPGDGKSFVSANLASALADSGYRTVIVDGDI
A0A3M2G737      YRQLRTYVQFSKT----DTPVKTIMVSSANPSEGKTTTASNMAVAFATMGKKVLLIDCDM
A0A0H4TUX7      FRALRTNVTFVGA----EKPLQFMSVTSPGPGEGKSTTAVNLAVALAQGGQRTLLIDGDL
A0A1G0LUG0      FRALRTNVTFVGA----ERPLQLISVTSPGPGEGKSTTAANLAVALAQSGQRTLLVDADL
A0A1Q7E3T7      FRGLRLNLAYAYG---AAGPV-LLVLSSPRSREGKSFIAANLALAFAQANYRTLLIDGDT
A0A1G0L906      YRALRTNVTFVSA---EQHALQLICVTSPGPGEGKSTTAANLAITLAQQGARTLLVDADL
A0A1G0LCC0      YRALRTNVTFVSA---EQHALQLICVTSPGPGEGKSTTAANLAITLAQQGARTLLVDADL
A0A2D5ZJE2      YRTIRTNVGFAA----VGAPLRSIAITSSGPQEGKSTTASNLAITIAQSGKRTLLLDADL
A0A3M2G624      FRSLRTNIQFFDL---SRQSE-AILITSAVSEEGKSTTCANLAITTAQVGRKTLLIDGDL
W0RI74          FRSLRMNVRYAAG-AGSQRSV-VFGITSPGPGDGKSLVASNLALSFAEGGWRTVLIDADT
A0A3M2BJA6      YRSLRTNITFSNP---DRPPK-TIVFTSPLPQDGKSTSAANLAITLAQQGTRVLLVDADL
A0A3D4VBZ5      FRTIRMNVRYAAD---PTRPL-TMTITSPGPNDGKSLISSNLALSFAESGLRTLLIDGDI
C1A5W1          FRTIRMNVRYAAD---PTRPL-TMTITSPGPNDGKSLISSNLALSFAESGLRTLLIDGDI
A0A2V7PX99      LRGLRVRVLHSQG---VEGPL-LLTVTSPSVGDGKSFLSVNLALSFAYAGYRTLLIDGDV
A0A2V7ERC7      FRTLHLAVRYDFP---GGGPI-SLSVASPGPGDGKSLVSSNLAIAFASAGYRTLLIDGDV
A0A2V7HBX4      FRTLRLALRYDFP---TDAPI-VVGVSSPAAGDGKSLVSSNLALAFASAGSRTLLIDGDV
A0A2V7JTZ5      FRTLRLALRYDFP---TDAPI-VVGVSSPAAGDGKSLVSSNLALAFASAGSRTLLIDGDV
A0A3D4YTR6      FRTIRLALRYDFP---DGLPI-VLGVTSPARGDGKSLVASNLGLAFASAGSRTLLIDGDV
A0A2V7F1M1      FRLLYSGLLFGWG----EGQR-TILVTSAAPQEGKTVIAANLAVTFAREGVRVLLVDCDL
A0A2V7KXK7      LRGLRLRVLHAHA---GEGPL-TLTITSPGIGDGKSFVSLNLALSFADAGYRTLLVDGDT
A0A2V7QDU7      FVRLATNVSFAGP---NGPPQ-VVTVTSALRGEGKTTSAVNLALASAN-GRRVLLIDADL
A0A2V7ITT6      MRSVRLSLSQTHG---GGGPM-LVTVSSPGIGDGKSFVSANLALAYSGAGQRTLLIDGDV
A0A2V7NJW1      MRSVRLSLSQTHG---GGGPM-LVTVSSPGIGDGKSFVSANLALAYSGAGQRTLLIDGDV
A0A2V7GFB5      MRGVCLGVSYTYG---AAGPV-VVAVSSPGPGDGKSFITANLAVTFADAGRRTLLVDGDL
A0A2V7RQ86      MRGVCLGVSYTYG---AAGPV-VVAVSSPGPGDGKSFITANLAVTFADAGRRTLLVDGDL
A0A2V7IWX2      MRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFAYAGLRTVVIDGDI
A0A1Q7KE95      MRSVRLSLIHFYG---GNGPV-VVTVTSPGIGDGKSFLSANLALACAEAGQPTLLIDGDA
A0A1Q7T8X5      MRSVRLSLIHFYG---GNGPV-VVTVTSPGIGDGKSFLSANLALACAEAGQPTLLIDGDA
A0A2V7FK98      LRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFADGGHRTLLIDADI
A0A2V7R3Z8      LRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFADGGHRTLLIDADI
A0A2V7J3C0      MRSVRLSLMHFYG---GNGPV-VVTVTSPGAGDGKSFVSANLALACAESGKATLLIDGDS
A0A2V7KWV9      MRGVRLSLIHAYG---TAGPL-VVTITSPAPGDGKSFVSANLALACAQAGQRTLLIDGDT
A0A1Q6ZHP2      LRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDL
A0A1Q7R6Z6      LRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDL
A0A2V7FYT7      LRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDL
A0A2V7IGR0      LRGVCLNLEHAYG---TAGPL-IAAVTSPGPGEGKSFIAANLAYTFAESGHRVLLVDADI
A0A2V7MR23      LRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDL
A0A2V7L1V3      LRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLGHTFADGGHRTLLIDADI
A0A1Q7E5D3      LRGACLNLVYAHG---AEGPL-LVTITSPGAGDGKSFLAANLARTFVEGGHRTLLVDGDN
A0A2V7ISE2      LRGVCLNLVYTHG---AASPM-LVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDI
A0A1Q7J2X5      LRGVCLNLVYTHG---AESPM-LVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDL
A0A2V7NPD1      LRGVCLNLVYTHG---AASPM-LVTVTSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDL
A0A2V7QPD8      LRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFADGGHRTLLIDADI
A0A2V7Q8M6      LRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLAHTFADGGHRTLLIDADI
A0A2V7QBC3      LRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLAHTFADGGHRTLLIDADI
A0A2V7LMU1      LRAVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFLAANLAHTFADGGHRTLLIDADI
A0A2V7PBY9      LRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFIAANLAHTFADGGHRTLLIDADI
A0A3M2BLV5      YRNLRMNLMFMST---EDEPIRTILFSSPGPHEGKSTTAVNFAVMLAQQGQRVLLIDADL
A0A2V7KS68      LRGLRLNVIHEYGTAEAAQPL-IFTVTSPGPGDGKTFLSSNLALAFAEGGHRTVLVDADI
A0A2V7N4L3      LRGIRLSVLHEHG---PG-PL-VVTITSPEQGDGKSFMSANLAMSFADAGHKTLLVDGDI
A0A1Q7AZK2      LRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFADAGHRTLLVDGDV
A0A1Q7TNP7      LRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFADAGHRTLLVDGDV
A0A1Q7KG39      LRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFADAGHRTLLVDGDV
A0A1Q7GX75      LRGVRLNLLHEYG---PG-PV-VLTISSPGSGDGKSFLSANLGLTFADGGHKTLLIDGDI
A0A1Q7LL80      LRGVRLNLLHEYG---PG-PV-VLTISSPGSGDGKSFLSANLGLTFADGGHKTLLIDGDI
A0A2V7PFU2      LRGLRLNVLNEYG---AETPV-LFTVTSPGPGDGKSFLSANLALAFADGGHRTLLVDGDI
A0A2V7MFS9      LRGVRLNLMNEHG---PG-PL-LVTVTSPGPGDGKSFLSANLALAFADGGHRTVLVDGDI
A0A2V7T933      LRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFADAGHRTLLVDGDV
A0A2V7J4D7      LRGVRLNVVHRHG---TAGPV-RLTVTSPGKSDGKSFVASNLALAFADAGYRTLLVDGDV
A0A2V7LN90      VRGIRLNVQHAHG---T-GPV-VVTVTSAGRSDGKSFLASNLALAFADAGSRTLLVDGDI
A0A2V7LFN9      MRGICLNVLHSHG---V-GPV-IVTVTSPGRADGKSFVASNLAVAFADAGYRTLLVDGDV
A0A2V7MEK4      MRGICLNVLHSHG---V-GPV-IVTVTSPGRADGKSFVASNLAVAFADAGYRTLLVDGDV
A0A2V7P8B1      FRGIRLNVLNAHG---ATGPV-VVGVTSPGSGDGKSFVSSNLALAFAYGNHRTLLIDADL
A0A2V7R2W8      LRGIRLNVVHRHG---SAGPV-RLTITSPGKSDGKSFVASNLALAFADTGLRTLLVDGDV
A0A2V7MS64      LRAIRLNLLHAHG----AGPT-VVTVTSPGHSDGKSFVASNVAVAFADAGFRTLLIDGDV
A0A2V7Q7N9      VRGIRLNVLHAHG----TGPI-VVTVTSPGRSDGKSFLASNLALAFADAGSRTLLVDGDI
A0A2V7IRW6      VRGIRLNVLHAHG----AGPA-VLTVTSPGRSDGKSFVASNLALAFADAGYRTLLVDGDV
A0A1Q7DVU6      VRGIRLNVLHAHG----AGPA-VLTVTSPGRSDGKSFLASNLALAFADAGYRTLLVDGDV
A0A1Q7JSV2      VRGIRLNVLHAHG----AGPA-VLTVTSPGRSDGKSFLASNLALAFADAGYRTLLVDGDV
A0A2V7QN41      LRGLRLRLSHA-G---GSGPL-LVTVTSPGVGEGKSFLSCNLALAFADAGFRTLLIDGDV
A0A2V7R603      LRGLRLRLSHA-G---GSGPL-LVTVTSPGVGEGKSFLSCNLALAFADAGFRTLLIDGDV
A0A2V7LJS2      FRGIRLNVLNAHG---AAGPA-VVAVTSPGSGDGKSFVSSNLALAFAYANHRTLLVDADL
A0A1Q7GLJ7      FRGLRLTLVNEYG---APGPI-VVTVTSPGSGDGKSFVSSNLALAFAYAKQRTLLVDADL
A0A2V7GRE3      FRGLRLSLVNEYG---APGPL-VITVTSPGSGDGKSFVSSNLSLAFAYAKQRTLLVDADL
A0A2V7EU00      LRTVRLNLTHAYG---SAGPL-LVTITSPGPGDGKSFVSGNLARAFADAGQRTLLIDGDS
A0A1Q6WE01      MRSIRLSLTHAHG---AAGPM-LVTISSPGVGDGKSFVSANLALAFAEAGRRTLLIDGDV
A0A2V7S9K3      MRSVRLSVSHAYG---AAGPM-VLTVSSPGAGDGKSFVAANLALAFAEGGRRTLLIDGDV
A0A1Q7DXB9      MRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFAYAGLRTIVIDGDI
A0A1Q7JD32      MRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFAYAGLRTIVIDGDI
A0A2V7MVP8      MRTVRVKLQHACN---GGSPL-LLTVTSPGVGEGKSLVSANLALAFAYAGLRTIVIDGDI
A0A2V7N0A9      LRGIRLNVQYAYG---AAGPL-VLTVSSPGRGEGKSFVTSNLAQAFADVGCRTLLIDGDV
A0A1Q7DLS9      LRGIRLNVLHAYG---TAGPL-LVTVTSPGRSDGKSFLTSNLAVAFVDAGYSTLLIDGDI
A0A1Q7JK96      LRGIRLNVLHAYG---TAGPL-LVTVTSPGRSDGKSFLTSNLAVAFVDAGYSTLLIDGDI
A0A2V7KQV7      LRGIRLNVQHAYG---AAGPL-LITVTSPGRGDGKSFVTCNLALAFAQVGYRTLLIDGDV
A0A1Q7JGF6      LRGIRLNLQHAYG---AAGPL-LITVSSPGRGEGKSFVTSNLAQAFADVGYRTLLIDGDV
A0A2V7SG67      LRGIRLNLQHAYG---AAGPL-LITVSSPGRGEGKSFVTSNLAQAFADVGYRTLLIDGDV
A0A1Q7GIK9      LRGIRLNVHHASG---AVGPL-LATITSPGRGEGKSFVSANLAYAFSAVGYRTLLIDGDV
                       :                 .:*.   :**:    *..         .:::* * 

A0A2D5ZJF2      RKPVQHVIFE-MDDKQGLSSVLSGQATL--DE---VL-RPSEVAGLDVLRCGPLPPNPSE
A0A0S8H9P3      RRGTLHEDFD-LLRSPGLSDLLVGELDP--RE---AI-RPAVRPALDLLPAGKRPPNPSE
A0A1E4BBP7      RRGTLHDIFAPCAQAPGLVDYLAGEATL--DE---VLRPTQQHINLSIVPCGKRRRHGPE
A0A3M2G737      RKPQLHNRFS-LDREPGLSNIFFYTAAV--EK---IC-HKTSVDNLDVICSGIIPPNPAE
A0A0H4TUX7      RRPLIHRAFA-LVQEPGLTDVLVGRATA--RE---AV-RPDAAPGLDVLPSGSIPPNPSE
A0A1G0LUG0      RRPQVHRAFS-LVQEPGLTDVLIGRVPA--RE---AI-RPEVQPQLDVLPSGPAPPNPSE
A0A1Q7E3T7      RRGALHKVLA-VARKPGLTDFLGGDVSW--GE---II-QVTRHGTLHFIGCGMRRPDSPE
A0A1G0L906      RRPVVHRAFN-LVQEHGLTDILVGTATL--RE---TV-RPNLIPKLDILTSGSLPPNPSE
A0A1G0LCC0      RRPVVHRAFN-LVQEHGLTDILVGTATL--RE---TV-RPNLIPKLDILTSGSLPPNPSE
A0A2D5ZJE2      RRPVLHKLFS-LKRQKGVTDHLAGNATL--EE---VI-QKTEIEGLHVITSGSLPPNPSE
A0A3M2G624      RKPVIHHLFE-APSEPGLTDVLLGRYTW--QE---VI-HSTSVPGLDIICSGTQPPNPSE
W0RI74          RRGQLNATFD-TPAVPGLVEYLEGTSLF--GE---VC-YPTRHDNLTIIPSGTRHRRAPE
A0A3M2BJA6      RRGVLNNVFD-LPREPGLSDVITGQAKL--SEALRVV-DLGESGRMHFLPTGTLPPNPAE
A0A3D4VBZ5      RRGELAKTFK-IHSRPGLVEYLEGSALL--AE---VLNPIASHANLTIMPAGVRRKRAPE
C1A5W1          RRGELAKTFK-IHSRPGLVEYLEGSALL--AE---VLNPIASHANLTIMPAGVRRKRAPE
A0A2V7PX99      RRGTQHRVVD-AASEPGLTDVLAGQAAA--EA---AV-QQTGYPNLSILSCGTRMYRSPE
A0A2V7ERC7      RCGTQHSTFS-VSPTPGLVDYLRSATGV--EG---AI-RTTSFSNLFLLPAGTRKNRAPE
A0A2V7HBX4      RCGGLHNTFE-IPVTPGLVDYLNGHAAV--DS---IV-RSTTSENLFLIPRGTRGNRAPE
A0A2V7JTZ5      RCGGLHNTFE-IPVTPGLVDYLNGHAAV--DS---IV-RSTTSENLFLIPRGTRGNRAPE
A0A3D4YTR6      RCGGLHNTFG-IPVTPGLVDYLHGLASV--ES---IV-RSTASKNLFLIPRGTRRNRAPE
A0A2V7F1M1      RRPRLHRVFG-VAPAPGLIELLKADRATLADSPGGPLRRPTKIAGLWLLPCGALPRRTSE
A0A2V7KXK7      RRGVQHKALK-TPSTPGLTDVVAGRVAL--DA---AL-RLTSYPGLTFLSSGTRMQRAPE
A0A2V7QDU7      RCGTIHALFR-LSRTPGLAEVLAGWMPLENAV---RRMDTGDGTHVDVLPAGSAVNNASQ
A0A2V7ITT6      RRGSLHRAML-TQRTPGLTDVLAKRAPL--ER---VT-QATSYTALEFISAGTHFRDAPE
A0A2V7NJW1      RRGSLHRAML-TQRTPGLTDVLAKRAPL--ER---VT-QATSYTALEFISAGTHFRDAPE
A0A2V7GFB5      RRGAQHRLFG-ADRRPGLTDVLRGDVPL--EA---GL-RPTGYDALTLLPCGVRTSDAPE
A0A2V7RQ86      RRGAQHRLFG-ADRRPGLTDVLRGDVPL--EA---GL-RPTGYDALTLLPCGVRTSDAPE
A0A2V7IWX2      RRGALHRLLR-GSRRPGLTDHLTGRAPL--EK---VL-QTTPYKCLSFIGCGSRMHNSPE
A0A1Q7KE95      RRGGLHRALR-RPRKPGLTDCLAGAAPL--EG---VT-QTTMYPCLDFIGAGSRFRDSPE
A0A1Q7T8X5      RRGGLHRALR-RPRKPGLTDCLAGAAPL--EG---VT-QTTMYPCLDFIGAGSRFRDSPE
A0A2V7FK98      RRGVLHRRLS-VRRRPGLSDFLRGEAQL--DA---IV-QATQFPALSLIGCGTRAYNAPE
A0A2V7R3Z8      RRGVLHRRLS-VRRRPGLSDFLRGEAQL--DA---IV-QATQFPALSLIGCGTRAYNAPE
A0A2V7J3C0      RRGGLHRILH-RPRKLGLTDHLAGAASL--EA---VT-QSTPFAALDFIAAGSRYRDSPE
A0A2V7KWV9      RRGALHRVLG-GVRRPGLTDFLAGNVSF--EA---LI-QTPNFGSLQFIGAGSRIRESPE
A0A1Q6ZHP2      RRGVLHRRLG-ARRRPGVSDFLRGEVPI--EA---IV-QTTPYPSFSLIGCGTRAYNAPE
A0A1Q7R6Z6      RRGVLHRRLG-ARRRPGVSDFLRGEVPI--EA---IV-QTTPYPSFSLIGCGTRAYNAPE
A0A2V7FYT7      RRGVLHRRLG-ARRRPGVSDFLRGEVPI--EA---IV-QTTPYPSFSLIGCGTRAYNAPE
A0A2V7IGR0      RRGVLHRRLG-RPRRPGLCDFLRSEAPL--EA---IV-QSTTHPSLALVSCGTRAHHAPE
A0A2V7MR23      RRGVLHRRLG-ARRRPGVSDFLRGEVPL--EA---IV-QATPYPSFSLIGCGTRAYNAPE
A0A2V7L1V3      RRGVLHRRLS-ARRRPGLSDFLRGETPL--DA---VV-QATPYPSLSLIACGTRAYNAPE
A0A1Q7E5D3      RRGVLHRRLA-ARRRPGLTDLLRGDVTF--EA---IA-QPTPYPGCTLVGCGTRAHNAPE
A0A2V7ISE2      RRGVLHRRLG-ARRRPGLTDFLRGEVPL--EA---IV-QATPYPSFSLIGCGTRAYNAPE
A0A1Q7J2X5      RRGVLHRRLG-ARRRPGLTDFLRGEVPL--EA---IV-QATPYPSFSLIGCGTRAYNAPE
A0A2V7NPD1      RRGVLHRRLG-ARRRPGLTDFLRGEVPL--EA---IV-QATPYPSFSLIGCGTRAYNAPE
A0A2V7QPD8      RRGVLHRRLS-VRRRPGLSDFLRGEAQL--DA---IV-QATQFQALSLIGCGTRAYNAPE
A0A2V7Q8M6      RRGVLHRRLS-ARRRPGLSDFLRGETPL--DA---IV-QATPYPSLSLIACGTRAYNAPE
A0A2V7QBC3      RRGVLHRRLS-ARRRPGLSDFLRGETPL--DA---IV-QATPYPSLSLIACGTRAYNAPE
A0A2V7LMU1      RRGVLHRRLS-AHRRPGLSDLLRGETPL--DA---IV-QATPYPSLSLIACGTRAYNAPE
A0A2V7PBY9      RRGVLHRRLS-ARRRPGLSDFLRGEAPL--DA---VV-QATPYPALSLIGCGTRAYNAPE
A0A3M2BLV5      RRPSLHRAMD-LLREPGLTNLLVGDAEA--RE---AI-RPNVLPNLDMLPSGPFPPNPSE
A0A2V7KS68      RRGLLHRRLK-ANRQPGLADYLLGETTA--DE---IV-QQTAYPRLSLIACGTRTQRAPE
A0A2V7N4L3      RRGVLHRRFK-LSRQPGLVDFLLDEIGK--DQ---IV-QKTAYPHLALIGCGTRTSRAPE
A0A1Q7AZK2      RRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLAFIGCGTRTQRAPE
A0A1Q7TNP7      RRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLAFIGCGTRTQRAPE
A0A1Q7KG39      RRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLAFIGCGTRTQRAPE
A0A1Q7GX75      RRGVLHRRFK-GNRQPGLVDYLLGDAGH--DA---IV-QKTAYPRLSLIGCGTRTQRAPE
A0A1Q7LL80      RRGVLHRRFK-GNRQPGLVDYLLGDAGH--DA---IV-QKTAYPRLSLIGCGTRTQRAPE
A0A2V7PFU2      RRGTLHRRFK-ANRRPGLVDYLRGEAGIGREL---IV-QQTPYPQLAFIGCGTRTQRAPE
A0A2V7MFS9      RRGVLHRRFK-ANRQPGLVDFLNGEVGH--DQ---IV-QPTPYPRLALIGGGTRTQRAPE
A0A2V7T933      RRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLAFIGCGTRTQRAPE
A0A2V7J4D7      RRGRLHHTLS-AARRPGLTELLEGSAPQ--DA---AV-QATRYKNLSFISCGLRSHAGPA
A0A2V7LN90      RCGRLHRVLK-LARKPGLTDLLAGDATP--EQ---VL-QGTAYRTLTLLAAGTRTHAGPA
A0A2V7LFN9      RCGRLHRTLK-LPRRPGLTDLLQGRASK--EQ---AV-QLSAYGMLSFLGCGTRTHDGPA
A0A2V7MEK4      RCGRLHRTLK-LPRRPGLTDLLQGRASK--EQ---AV-QLSAYGMLSFLGCGTRTHDGPA
A0A2V7P8B1      RRGALHRTLK-LPRQPGLMDLLVGHATP--EQ---VV-HRTAYQSLDFVASGSRRRDAPE
A0A2V7R2W8      RRGRLHRTLG-AARRPGLTDLLEGSVGW--DQ---VV-QATPYKNLSFISCGLRSQAGPA
A0A2V7MS64      RKGVLHRTLK-APRLPGLVDVLMGKVPV--AQ---AI-QSTTYRTLSFLPSGTRTQIAPV
A0A2V7Q7N9      RCGRLHRVLQ-LARKPGLTDLLGGEAAE--EQ---VL-QATAYRTLTFLGSGTRTHAGPT
A0A2V7IRW6      RCGTLHRALK-LARKPGLVDVLGGKAST--EL---VV-QATSYRALSFIGSGTRTHTGPS
A0A1Q7DVU6      RCGTLHRALK-LARKPGLVDVLGGKAST--EL---VV-QATSYRALSFIGSGTRTHTGPS
A0A1Q7JSV2      RCGTLHRALK-LARKPGLVDVLGGKAST--EL---VV-QATSYRALSFIGSGTRTHTGPS
A0A2V7QN41      RRGGQHRMLG-LHREPGLVDFLAGDLPF--ET---VV-QATRHPGLSFIGCGARRPSAPE
A0A2V7R603      RRGGQHRMLG-LHREPGLVDFLAGDLPF--ET---VV-QATRHPNLSFIGCGARRPSAPE
A0A2V7LJS2      RRGALHRALQ-LRREPGLTDLLAAAASP--EQ---VV-KATSHPSLDFLASGSRRGDAPE
A0A1Q7GLJ7      RRGALHRLLN-LRRQPGLTDFLIGDVSR--AP---AL-QTTAYPFLDFLPSGTRRRDAPE
A0A2V7GRE3      RRGALHRVLN-LRRQPGLTDFLAGDVSR--AP---VV-QTTSHPCLDFIASGTRRRDAPE
A0A2V7EU00      RRGVLHRLFK-GLRKPGLTDYLAGVVPL--DA---VV-QRTDHPALWFIGSGSRTPDAPE
A0A1Q6WE01      RRGSLHRAVR-ARRQPGLTDFLAGRAPF--EA---TV-QGTPYPDLQFIGAGTRFRDSPE
A0A2V7S9K3      RRGGLHRALR-AHRRPGLTDFLAGRVPL--EE---TI-VATSYADLQFIGAGTRFRDSPE
A0A1Q7DXB9      RRGALHRLLR-GSRRPGLTDHLTGRAPL--EK---VL-QPTPYKGLSFIGCGSRMHNSPE
A0A1Q7JD32      RRGALHRLLR-GSRRPGLTDHLTGRAPL--EK---VL-QPTPYKGLSFIGCGSRMHNSPE
A0A2V7MVP8      RRGALHRLLR-ASRRPGLTDHLTGRAPL--EQ---VL-QATPYKDLSFIGCGSRMHNSPE
A0A2V7N0A9      RLGALHRALR-RARRPGLTDALAGRVTA--DQ---TL-QATDHAFLSFIGAGSRMHRGPE
A0A1Q7DLS9      RRGGLHRVLD-AARTPGLTDLLAGTAAV--QQ---VIQQAKSYPSLAFIACGSRTRSGPE
A0A1Q7JK96      RRGGLHRVLD-AARTPGLTDLLAGTAAV--QQ---VIQQAKSYPSLAFIACGSRTRSGPE
A0A2V7KQV7      RCGALHRLLK-AARRPGLTDVLANEVTP--DQ---VV-QSTPYAHLSFIGGGSRLHRGPE
A0A1Q7JGF6      RLGVLHRALR-GTRRPGLTDLLASRATV--DQ---VV-QGTPHPLLSFIGAGSRMHRGPE
A0A2V7SG67      RLGVLHRALR-GTRRPGLTDLLASRATV--DQ---VV-QGTPHQLLSFIGAGSRMHRGPE
A0A1Q7GIK9      RLGALHRTLR-AARRPGLTDVLAGHVEY--AA---VL-QSTPHTRLSFLGAGSRMHRGPE
                *       .       *: . .                         .:  *      . 

A0A2D5ZJF2      FINSDAFREMLEELAVKYDRVVIDSPPVMAVSDARILAAGCDITLLVLRAEKSTRKASEQ
A0A0S8H9P3      LLGSQAMAKLLASWREEYRWVLFDTPPVLAVTDASVLAALVDGAVLVVKAGETDRRAGWQ
A0A1E4BBP7      LLASERMTTLIRDLRTQFDAIIVDTAPLGAGIDPFAIGTATGSMVLVLRAGETDRKLAQA
A0A3M2G737      ILSSTRMIEFVKEMRDQYDLIIFDTPPILRVADPSIVSTLVDGVILVVASGKTPAGGLNF
A0A0H4TUX7      LLGSAAMHSLISALRRDYHYIIIDTPPTLPVTDASVVASGADAAILVLRSGDTQETAAQR
A0A1G0LUG0      LLGSHAMHALIGELRRSYDYIVMDTPPTLPVTDAAVVASAADGAILVLKSGDTEEVPAQR
A0A1Q7E3T7      LLSSPRMSDLFAQLRANFAVIIVDSPPLGAGVDAFALATITGHLVMVLRPGTTNREVIEA
A0A1G0L906      LLGSEAMHRLLEEVRSHYDNIIFDTPPALAVTDAAVLGAGSDAVILILRAGKTEEVAAQR
A0A1G0LCC0      LLGSEAMHRLLEEVRSHYDNIIFDTPPALAVTDAAVLGAGSDAVILILRAGKTEEVAAQR
A0A2D5ZJE2      LLGSDAMARFIEEVGREFDQIIVDTPPVMAVTDALLLSALLDGVIIIVEAGETLEQVAKR
A0A3M2G624      LLSSPELKSLITTLKEHYDMILFDSPPVIPVADSVALSTNVDGVLLVVSAGKTDRHALQR
W0RI74          LLATPRMQQLVASLAAEFDVVIIDTPPLGAGTDAYAIGTACGQLAVVLRSNRTNLKMAKA
A0A3M2BJA6      LLGSERMKTLLRHLEEQFDAIILDSAPLTVVTDAAVLGTNAEGVLLVARANVTERGAIRY
A0A3D4VBZ5      LLATPRLTQLISQMAGEYDVVVVDSPPLGAGYDAFALATATGNMALVMRAGVTDRKMAEA
C1A5W1          LLATPRLTQLISQMAGEYDVVVVDSPPLGAGYDAFALATATGNMALVMRAGVTDRKMAEA
A0A2V7PX99      LLLLPTLRETIARLRTTYQIIIVDSPPLVAGIDPLVLATVTGNLLVVLRSEATDLELAAA
A0A2V7ERC7      LLVSDRMTALLLAARQEFEVIIIDSPPFIAGVDAYALGAAAGSMLVVLRPGVSDRKLAAA
A0A2V7HBX4      LLVSELMSALVHAMRLQFDVVIIDSPPLVAGMDAYALGAAAGSMLIVLRPAVTDRKLASA
A0A2V7JTZ5      LLVSELMSALVHAMRLQFDVVIIDSPPLVAGMDAYALGAAAGSMLIVLRPAVTDRKLASA
A0A3D4YTR6      LLVSDLMNSLVHAMRLQFDVVIIDSPPLVAGIDAYALGAAAGSMLIVLRPARTDRKLAAA
A0A2V7F1M1      VLQPHQLRRLLDDLSGHFDVIILDTPPVLVSADAALLAPLADGAILVVRAGQTNRSSAER
A0A2V7KXK7      RLLSQNMRDLMSKLRSMFDVVIVDSPPLGAGADPLVLGTLTENLLLVLRTGQSDINLAST
A0A2V7QDU7      LLWRADLDGLLVRLRAAYDLIVIDSPPMNVVADATLLAPQSDAVIVVARAGRTAPEALNF
A0A2V7ITT6      LLGSDAMVELVTRLRGSYGVILVDSPPLASGVDPYTLGMVTGSLLLVLRTGATSLELART
A0A2V7NJW1      LLGSDAMVELVTRLRGSYGVILVDSPPLASGVDPYTLGMVTGSLLLVLRTGATSLELART
A0A2V7GFB5      LLGSAKMPELLARLRGDYDTILVDSPPLGAGIDPFVLGTLTGNLLLVLRTGVSHREVMAA
A0A2V7RQ86      LLGSAKMPELLARLRGDYDTILVDSPPLGAGIDPFVLGTLTGNLLLVLRTGVSHREVMAA
A0A2V7IWX2      LLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMVLRAGVTDLELAQA
A0A1Q7KE95      LLGSPAMVELLERVRSQYRVVLVDSPPLGSGVDPYTLGTLTGNLLLVLRTGTTNLALART
A0A1Q7T8X5      LLGSPAMVELLERVRSQYRVVLVDSPPLGSGVDPYTLGTLTGNLLLVLRTGTTNLALART
A0A2V7FK98      LLGSPAMTSLVNGLRGGYDVVLIDSPPLAAGVDPLILSTLTGTLALVLRTGYSHRDVAAA
A0A2V7R3Z8      LLGSPAMTSLVNGLRGGYDVVLIDSPPLAAGVDPLILSTLTGTLALVLRTGYSHRDVAAA
A0A2V7J3C0      LLGYPAMVELLEHARAHYAVVIVDSSPLGSGVDPYTLGTLTGSLLLVLRTGTTNLALART
A0A2V7KWV9      LLGSPRMVELLVRLRAMYPVIIVDSPPLGAGVDPYTLGTMTGAMMLVLRTGATNLDLART
A0A1Q6ZHP2      LLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDMASA
A0A1Q7R6Z6      LLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDMASA
A0A2V7FYT7      LLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDMASA
A0A2V7IGR0      LLGSPAMGQFVAGLRTHYDVILFDNPPLAAGVDPLIVGTLTGNLLLVLRTGQSDREMTAA
A0A2V7MR23      LLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDVASA
A0A2V7L1V3      LLGSPAMSELVTGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLALVLRTGYSHRDVAAA
A0A1Q7E5D3      LLGSEAMSQLIRHARRSYDVVVFDSPPLGAGVDPLILGTLTGSLVLVLRTGYSDRDVAAA
A0A2V7ISE2      LLGSQTMSQLVTALRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVVLRTGYSHRDVAAA
A0A1Q7J2X5      LLGSQTMSQLVTALRPSYDVILVDSPPLGAGVDPLILGTLTGHLVVVLRTGYSHRDVAAA
A0A2V7NPD1      LLGSQTMSQLVTALRPSYDVILVDSPPLGAGVDPLILGTLTGHLVVVLRTGYSHRDVAAA
A0A2V7QPD8      LLGSPAMTSLVNGLRGSYDVILIDSPPLAAGVDPLILSTLTGTLTLVLRTGYSHRDVAAA
A0A2V7Q8M6      LLGSPPMSELVNGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLALVLRTGYSHRDVAAA
A0A2V7QBC3      LLGSPPMSELVNGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLALVLRTGYSHRDVAAA
A0A2V7LMU1      MLASPAMSQLVNGMRSGYDVILIDSPPLGAGVDPLILGTLTGTLALVLRTGYSHRDVATA
A0A2V7PBY9      LLGSPRMSELVTGMRSGYDVILFDSPPLAAGVDPLIVGTLTGTLALVLRTGYSHRDVAAA
A0A3M2BLV5      LLNSKAMQRLLEELQGKYSHIIVDSPPVLAVTDAALLGAHTDGVVLVLRSGETEQRAAER
A0A2V7KS68      LLDSDAMVTLLTRLRGEYDVVLIDSPPLTAGVDPFVLGTLTGALVLVLRTGHSNRNITGA
A0A2V7N4L3      VLGSTAMNDLLTEMRGQYDVIVVDSPPLAAGVDSFVLGTVTGTLLVVLRTGHSHRDITGA
A0A1Q7AZK2      VLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLVLRTGHSHRDITGA
A0A1Q7TNP7      VLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLVLRTGHSHRDITGA
A0A1Q7KG39      VLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLVLRTGHSHRDITGA
A0A1Q7GX75      VLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLLLVLRTGHSHRDITGA
A0A1Q7LL80      VLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLLLVLRTGHSHRDITGA
A0A2V7PFU2      VLGSPAMAQLLAELREQYDVIVVDSPPLTAGVDPFILGTATGSLLLVLRTGHSHRDVTGA
A0A2V7MFS9      VLGSQAMTELIAELRGQYDVILVDSPPLTAGVDPFILGTVTGSLLVVLRTGHSHREIAGA
A0A2V7T933      VLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLVLRTGHSHRDITGA
A0A2V7J4D7      LLSSVAMARLLDALRASYEAIIVDSPPLAAGADGLALATVTGSLVLVLRTGVSDRELTET
A0A2V7LN90      LIGSAALPRALAALRPGYDVIIVDSSPLAAGADAFALATATGSMLLVLRTGVSDRELAQA
A0A2V7LFN9      LVSSAALPRVLAGLRSSYHAIIIDSSPLAAGADAFALGTGTGTLLLVLRTGVSDGGLALA
A0A2V7MEK4      LVSSAALPRVLAGLRSSYHAIIIDSSPLAAGADAFALGTGTGTLLLVLRTGVSDGGLALA
A0A2V7P8B1      LIGSARMTEFMSGLRSRYGVIVVDSPPLGAGVDALLVASLAGSLLMVLRLGRTDRELAEA
A0A2V7R2W8      LLSSATMARLLDGVRTSYDAVVVDSPPLAAGADGLALATVTGSLVLVLRAGVSDRELTET
A0A2V7MS64      LVSSAPLPRLLAELRPNYDAVIVDSPPLAAGVDALALGTATGAMVLVLRTGYSDREMAQN
A0A2V7Q7N9      LISSAALPRALAALRPGYDVIIVDSSPLAAGADAFALGTATGSMLLVLRTGVSDRELVQA
A0A2V7IRW6      LVSSAALPRLLAALRPSYDAIIVDSPPLAAGADAFAIGTATGSMVLVLRTGVSDRELAQT
A0A1Q7DVU6      LVSSAALPRLLATLRPGYDAIIVDSPPLAAGADAFAIGTATGSMVLVLRTGVSDRELAQT
A0A1Q7JSV2      LVSSAALPRLLATLRPGYDAIIVDSPPLAAGADAFAIGTATGSMVLVLRTGVSDRELAQT
A0A2V7QN41      LLSSDVMTELIDRVREECGVVLVDSPPLAVGVDPYVLATRTGNVLIVLRAGVSDLDLAAA
A0A2V7R603      LLSSDVMTDLIDRVREECGVVLVDSPPLAVGVDPYVLATRTGNVLIVLRAGVSDLDLAAA
A0A2V7LJS2      LLGSARMADFMTKLRSSYGVIVVDTPPLGAGVDAFVLASLAGSLLLVLRLGRTDRELAEA
A0A1Q7GLJ7      LMGSAAMVDLVTSLRSTYDVIVLDTAPLGAGVDALALAKLAGNLLMVLRLGRTDRELAEA
A0A2V7GRE3      LLGSAAMTDLVTSLRSTYEVIVVDTAPLGAGVDALVLAKLARNLLMVLRLGRTDRVLAEA
A0A2V7EU00      LLGAPPMARLLASVRTSYQVILIDSSPLGAGVDPFLLGTLTGSLLIVLRSGTTDRELAQA
A0A1Q6WE01      LLGSGAMSELLARLRASWSVILVDSPPLGSGVDPYTLGTLTSNMLLVLRTDATDLSLART
A0A2V7S9K3      LLGSVAMVELLTCVRSSYGVILLDSPPLGSGVDPYTLATLTGSLLLVLRTGATNLDLART
A0A1Q7DXB9      LLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMVLRAGVTDLELAQA
A0A1Q7JD32      LLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMVLRAGVTDLELAQA
A0A2V7MVP8      LLSATTMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASHTKNLLVVLRAGVTDLELAQA
A0A2V7N0A9      LLCSATVPQLITALRPGYDVILVDSAPLAAGVDPYALGVATGNMLLVVRPDVTDRAIAEA
A0A1Q7DLS9      LLSSTAMAGFVTSLRSRYAVILIDSPPLAAGVDACALGTMTGSLVLVLRTGVSDRELVEA
A0A1Q7JK96      LLSSTAMAGFVTSLRSRYAVILIDSPPLAAGVDACALGTMTGSLVLVLRTGVSDRELVEA
A0A2V7KQV7      LLCSEALPRLITAMRPHYDAILVDSPPLAAGVDASALGAVTGSLLVVLRTGVTDRMIAEA
A0A1Q7JGF6      LLCSVAMPRLITVMRPSYDVILVDSAPLAAGVDPYALGTATGSMLLVLRTGVTDRTLAEA
A0A2V7SG67      LLCSVAMPRLITVMRPSYDVILVDSAPLAAGVDPYALGTATGSMLLVLRTGVTDRTLAEA
A0A1Q7GIK9      LLGSAGMPRLLTALRSAYDVILVDSAPLAAGVDPYALGAATGNVLLVLRTGVTDRSLAEA
                 :    .   .         ::.*..*     *   :.       ::     :       

A0A2D5ZJF2      ARDGLLAVGGHLLGVVVNDAHHRREGYG---YGYYGGYGQYGGYYGRDRAEGRREGGRGS
A0A0S8H9P3      AIQQLRRVGARVVGAVLNEI-VLQRGAD---RYYFDYY--YSRSSS--------------
A0A1E4BBP7      KLTVLDRMPIRLVGAILNDI------GELPQFKYY-YY--LEGYRALEGAEEGNAALLGS
A0A3M2G737      AVETLVKVKANLLGIVLNDFDPKKAYGGYYYGNYYKYY--YYSSYYGSDRDKKKQRSIKL
A0A0H4TUX7      ALEQLRRVHARIAGAVLNGV---SSRHD----RYYTYY--SYRREPARRGLLTAGSPRAG
A0A1G0LUG0      ALEQLRRVHARVAGAVLNGV---NQQKD----QYYTYY--ASRE-----------APRRS
A0A1Q7E3T7      KLDLLHRLPVRVLGAVLNDV---QDGPE---YTGYSYY--LEGYEATAEGVREHHTVLRS
A0A1G0L906      ALAQLSRVQARVAGSVLNGVQKMRDR-----YYYYYYY--RKDPRTTRGLLSALREQIAH
A0A1G0LCC0      ALAQLSRVQARVAGSVLNGVQKMRDR-----YYYYYYY--RKDPRTTRGLLSALREQIAH
A0A2D5ZJE2      TKTLVETAARRCLGVVLNNV---DVGGGYGRYGGYHYH--YHYHEDADNKTNSRATSIWR
A0A3M2G624      TRDLLHNVNARIMGAVLNNV---RINEIYGYQKHYYYY--DTKKPVKV------------
W0RI74          KLAVLAQLPVTLLGAVLNEV---RTDSG--MYQYYSYD---PDYVLPEETPALSAGGGGG
A0A3M2BJA6      SVDQLKHVRAPILGVVLNDIDFRRDSRYSSSYGRYGYY--YQYYYGDNGKKKK-------
A0A3D4VBZ5      KMATVDTLPIRVMGAILNGI---KMTGA---YQYYSYY---QDYAAEDEQPERLSAGSGS
C1A5W1          KMATVDTLPIRVMGAILNGI---KMTGA---YQYYSYY---QDYAAEDEQPERLSAGSGS
A0A2V7PX99      KLSVADTLPVRTIGAVLNCV---RGHGA---FRYYTYD--LADYAEPDPAVAATRRDGWR
A0A2V7ERC7      KLDIVDRLPIRVLGAVLNGV---PGGGA---YRYYG-----TNYYYGDTRAKEHVGNLAT
A0A2V7HBX4      KLEVLDRLPIRILGAVLNAV---PDGGA---YRYYG-----ADYSYKDEVLKEPIADIAT
A0A2V7JTZ5      KLEVLDRLPIRILGAVLNAV---PDGGA---YRYYG-----ADYSYKDEVLKEPIADIAT
A0A3D4YTR6      KLDVLDRLPIRILGAVLNAV---PGGGA---YRYYG-----ADYEYKGDSSTEPIADLAT
A0A2V7F1M1      ACQYLIAAGAHFLGAVLNDP---AGELARYGKYYYSY-----GYPTPSD-----------
A0A2V7KXK7      KLEVLNALPVRVIGAVLNDV---RSSGV---YRYYMYS--SAEYELVDDEGQTREALPSI
A0A2V7QDU7      TLEQLRSVHA-LVWTVLNDI---D-------YRRDRVY--GRAYGQRASYLETE------
A0A2V7ITT6      KLRVLDRLPIRLLGVVVNDV---RPRGV---YRYHSY---LSGYGTADEAEYAMGPPRVR
A0A2V7NJW1      KLRVLDRLPIRLLGVVVNDV---RPRGV---YRYHSY---LSGYGTADEAEYAMGPPRVR
A0A2V7GFB5      KLEVLRRLPVRLLGAVLNDV---PPGAA---YQYYSYY--TPGYEATDEKPARLTPSVG-
A0A2V7RQ86      KLEVLRRLPVRLLGAVLNDV---PPGAA---YQYYSYY--TPGYEATDEKPARLTPSVG-
A0A2V7IWX2      KLESFEDLPVRVVGTVLNDV---QPKGA---YRYYAYY--VPGYETKEE----ADLGPEK
A0A1Q7KE95      KLTVLDHLPIRLLGVVLNDV---RPGGM---YRYYS-Y--LSGYATTNEREGYAVAGRQA
A0A1Q7T8X5      KLTVLDHLPIRLLGVVLNDV---RPGGM---YRYYS-Y--LSGYATTNEREGYAVAGRQA
A0A2V7FK98      KLEVLQRLPVRMLGAVLNDV---PAGGA---YRYYSYY--LPGYEAMDE----NSGSPRV
A0A2V7R3Z8      KLEVLQRLPVRMLGAVLNDV---PAGGA---YRYYSYY--LPGYEAMDE----NSGSPRV
A0A2V7J3C0      KLAVLDHLPIRLLGAVLNDV---RSDDL---YRHYS-Y--LSGYATVDEQEGYAIAGRKA
A0A2V7KWV9      KVAMLENLPIRVLGAVLNDV---RLGQM---YGEYYGY--MAGYGTTTEDGGTRIARRRL
A0A1Q6ZHP2      KLEVLQRLPVRLLGAILNAV---PAGEA---YRYYSYY--LPGYEAVDEEAERASGGKGQ
A0A1Q7R6Z6      KLEVLQRLPVRLLGAILNAV---PAGEA---YRYYSYY--LPGYEAVDEEAERASGGKGQ
A0A2V7FYT7      KLEVLQRLPVRLLGAILNAV---PAGEA---YRYYSYY--LPGYEAVDEEAERASGGKGQ
A0A2V7IGR0      KLEVLQRLPVRLLGAVLNDV---PAGAT---YRYYSYY--LPGYEAVDEEAQ------AQ
A0A2V7MR23      KLEVLQRLPVRLLGAILNAV---PAGDA---YRYYSYY--LPGYEAVDEEAEQASGGKGQ
A0A2V7L1V3      KLEMLQRLPVRMLGAILNDV---PAGGA---YRYYSYY--LPGYEAADE----NSGSRRV
A0A1Q7E5D3      KLEMLQRLPIRLLGAILNDV---PAGAA---YRYYSYY--LPGYEAVD-EGERNSGPKVR
A0A2V7ISE2      KLEVLQRLPVRLLGAILNAV---PAGAA---YRYYSYY--LPGYEAVDEEAERTSGGNKQ
A0A1Q7J2X5      KLEVLQRLPVRLLGAILNAV---PAGAA---YRYYSYY--LPGYEAVDEEAERTSGGNKQ
A0A2V7NPD1      KLEVLQRLPVRLLGAILNAV---PAGAA---YRYYSYY--LPGYEAVDEEAERTSGGNKQ
A0A2V7QPD8      KLEVLQRLPVRMLGAVLNDV---PAGGA---YRYYSYY--LPGYEAMDE----NSGTPRV
A0A2V7Q8M6      KLEMLHRLPVRLLGAILNDV---PAGGA---YRYYSYY--LPGYEAADE----NSGSR--
A0A2V7QBC3      KLETLQRLPVRLLGAILNDV---PAGGA---YRYYSYY--LPGYEAADE----NSGSRRV
A0A2V7LMU1      KLEMLQRLPVRLLGAIMNDV---PAGGA---YRSYSYY--LPGYEAMDE----ERGSGRV
A0A2V7PBY9      KLEVLQRLPIRLLGAILNDV---PAGGA---YRYYSYY--LPGYEAADE----EAGSRRV
A0A3M2BLV5      AVEQLRRVGVRVFGAVLNEV---STSNA--EESYYLQY--YYGYHPREETGWQRLRSGLS
A0A2V7KS68      KLDMLQRLPVRLLGAVLNDV---PRGGAYGYYAYYSYY--LPGYEAVEERD-GARQTGPV
A0A2V7N4L3      KLEMLDRLPIRLLGAVLNDV---PRGAAYGYYAYYSYY--LPGYEAVDESKHGRRTPAPT
A0A1Q7AZK2      KLEVLDRLPIRLLGAVLNDV---PHGAAYGYYSYYSYY--LPGYEAVDEGD--RQASGAR
A0A1Q7TNP7      KLEVLDRLPIRLLGAVLNDV---PHGAAYGYYSYYSYY--LPGYEAVDEGD--RQASGAR
A0A1Q7KG39      KLEVLDRLPIRLLGAVLNDV---PHGAAYGYYSYYSYY--LPGYEAVDEGD--RQASGAR
A0A1Q7GX75      KLEVLDRLPIRLLGAVLNDV---PRGAAYGYYAYYSYY--LPGYEAVEESS--GQASAPR
A0A1Q7LL80      KLEVLDRLPIRLLGAVLNDV---PRGAAYGYYAYYSYY--LPGYEAVEESS--GQASAPR
A0A2V7PFU2      KLEMLDRLPIRLLGAVLNDI---PREAAYGYYAYYSYY--LPGYEAVDEGA--GRTSGPR
A0A2V7MFS9      KLEVLERLPIRLLGAVLNDV---PRGAAYGYYAYYSYY--LPGYEAVDEGD-GRRTSGPQ
A0A2V7T933      KLEVLDRLPIRLLGAVLNDV---PHGAAYGYYSYYSYY--LPGYEAVDEGD--RQASGAR
A0A2V7J4D7      KLGALHHLPVRVLGAVLNDV---RPGGA---YRYYSYY--LEGYEVHDEPAAADVHVLRG
A0A2V7LN90      KLEVLQYLPIRVLGAVLNDV---RLGGV---YRYYSYY--LEGYEATDEPAGAEGEVLRG
A0A2V7LFN9      KLEVMSRLPIRVLGAVLNDV---RGGSL---YRDYSYY--LEGYETQDEPDEARGQVLRA
A0A2V7MEK4      KLEVMSRLPIRVLGAVLNDV---RGGSL---YRDYSYY--LEGYETQDEPDEARGQVLRA
A0A2V7P8B1      KLELLRAQPIRVLGAVLNDV---REGSE---YHAYSYY--LDGYELGDEPLFEPLV-SRP
A0A2V7R2W8      KLGVLTHLPVRVLGAVLNDV---RPGGA---YRYYSYY--LEGYEAHDEPDAAQAR-VLR
A0A2V7MS64      KLQALTHLPIRVLGAVLNDV---R-GSR---YKYYSYY--LEGYEARDE--QPASR-LMR
A0A2V7Q7N9      KLEVLQYLPIRVLGAVLNDV---RPGGV---YRYYSYY--LEGYEAKDEPAEAAGQ-VLQ
A0A2V7IRW6      KLEVLAHLPIRMLGAVLNDV---R-GGL---YRYYSYY--LEGYEVKEEP-EPAWQ-LVR
A0A1Q7DVU6      KLEVLAHLPIRMLGAVLNDV---R-GGL---YRYYSYY--LEGYEVKEEP-EPAWQ-LVR
A0A1Q7JSV2      KLEVLAHLPIRMLGAVLNDV---R-GGL---YRYYSYY--LEGYEVKEEP-EPAWQ-LVR
A0A2V7QN41      KLDVLDTLPVRVLGAVLNDV---RPYGA---YRYYTYD--AAAYAEANGAASQRRG----
A0A2V7R603      KLDVLDTLPVRVLGAVLNDV---RPYGA---YRYYTYD--AAAYAEGNGAIGQRRP----
A0A2V7LJS2      KIDLLRQSSTRVLGVVLNDV---REGSE---YRAYSYY--MDGYEFTGEPLFQPLGDATK
A0A1Q7GLJ7      KLEILRRLPLRLLGAVLNDV---RDESE---YRAYAYY--MDGYALTNEPPFRPLG-G-K
A0A2V7GRE3      KLEILRRLPLRLLGAVLNDV---RDESE---YRAYAYY--MDGYALTNEPLFRPLA-GNK
A0A2V7EU00      NLDGLLRLPIRVLGAVLNDI---EPRGA---YRYYSY---LSGYAAEDEPTAPPQQWAVA
A0A1Q6WE01      KLSVLDQLPIRLLGVVVNDV---RPGGV---YRYYSY---FAGYGTRDEGVA-----IAT
A0A2V7S9K3      KLGMLDHLPIRLLGVVVNDV---QPGGA---YRYYSY---LSGYATADEGTA-----SAA
A0A1Q7DXB9      KLESFEDLPVRVVGTVLNDV---QPKGA---YRYYAYY--VPGYETKEEADLGPEKPVLG
A0A1Q7JD32      KLESFEDLPVRVVGTVLNDV---QPKGA---YRYYAYY--VPGYETKEEADLGPEKPVLG
A0A2V7MVP8      KLESFDDMPVRVVGSVLNDV---RPKGA---YRYYAYY--VPGYETKEEADLGPEKPVLG
A0A2V7N0A9      KVEVLQRLPVRLLGAVLNDV---RPGLA---YNHYSYS--LAGYEMQEEDSGREAGPILL
A0A1Q7DLS9      KLDVLERLPIRILGAVLNDV---RPGGA---YRSYAYS--LSGYDLHDEEEPPKR---IL
A0A1Q7JK96      KLDVLERLPIRILGAVLNDV---RPGGA---YRSYAYS--LSGYDLHDEEEPPKR---IL
A0A2V7KQV7      KVELLRTLPIRMLGVVLNDV---RPGVA---YSYYAYS--LEGYSVREEDPDGRAGT-LL
A0A1Q7JGF6      KVEVLHRLPIRVLGAVLNDV---RPGAA---YTYYSYS--LAGSEVQEEDPGGVTSEILL
A0A2V7SG67      KVEVLHRLPIRVLGAVLNDV---RPGAA---YTYYSYS--LAGSEVQEEDPGGVTSEILL
A0A1Q7GIK9      KVEVLHRLPLRVLGAILNDV---RPGSA---YSYYSYS--LEGYEVRDEDPEGKAGKMLL
                               ::*                                          

A0A2D5ZJF2      SGTEKGSSTG---------------------------------------------
A0A0S8H9P3      -------------------------------------------------------
A0A1E4BBP7      GSGGNGRG-----------------------------------------------
A0A3M2G737      KS-----------------------------------------------------
A0A0H4TUX7      GCSPFGRSSAIPSENQ---------------------------------------
A0A1G0LUG0      RTSLFTR------------------------------------------------
A0A1Q7E3T7      SG-----------------------------------------------------
A0A1G0L906      LF-----------------------------------------------------
A0A1G0LCC0      LF-----------------------------------------------------
A0A2D5ZJE2      AARGVAIVATFFAIAAAMWHQRRPTLAEADTVESRMVPNTEDGRIAGLEEGVVGR
A0A3M2G624      -------------------------------------------------------
W0RI74          TSVAVREG-----------------------------------------------
A0A3M2BJA6      -------------------------------------------------------
A0A3D4VBZ5      SRPVALSGGVSDA------------------------------------------
C1A5W1          SRPVALSGGVSDA------------------------------------------
A0A2V7PX99      HILGGRSS-----------------------------------------------
A0A2V7ERC7      PKGLLLNA-----------------------------------------------
A0A2V7HBX4      PKGLLVRS-----------------------------------------------
A0A2V7JTZ5      PKGLLVRS-----------------------------------------------
A0A3D4YTR6      PQGLVLRA-----------------------------------------------
A0A2V7F1M1      -------------------------------------------------------
A0A2V7KXK7      LGGRT--------------------------------------------------
A0A2V7QDU7      -------------------------------------------------------
A0A2V7ITT6      GVL----------------------------------------------------
A0A2V7NJW1      GVL----------------------------------------------------
A0A2V7GFB5      -------------------------------------------------------
A0A2V7RQ86      -------------------------------------------------------
A0A2V7IWX2      PVLGVPSV-----------------------------------------------
A0A1Q7KE95      RGVL---------------------------------------------------
A0A1Q7T8X5      RGVL---------------------------------------------------
A0A2V7FK98      PV-----------------------------------------------------
A0A2V7R3Z8      PV-----------------------------------------------------
A0A2V7J3C0      HGVL---------------------------------------------------
A0A2V7KWV9      QGAL---------------------------------------------------
A0A1Q6ZHP2      PFVI---------------------------------------------------
A0A1Q7R6Z6      PFVI---------------------------------------------------
A0A2V7FYT7      PFVI---------------------------------------------------
A0A2V7IGR0      PLVT---------------------------------------------------
A0A2V7MR23      PFVI---------------------------------------------------
A0A2V7L1V3      PV-----------------------------------------------------
A0A1Q7E5D3      SLVI---------------------------------------------------
A0A2V7ISE2      PFVI---------------------------------------------------
A0A1Q7J2X5      PFVI---------------------------------------------------
A0A2V7NPD1      PFVI---------------------------------------------------
A0A2V7QPD8      PV-----------------------------------------------------
A0A2V7Q8M6      -------------------------------------------------------
A0A2V7QBC3      PV-----------------------------------------------------
A0A2V7LMU1      PV-----------------------------------------------------
A0A2V7PBY9      PV-----------------------------------------------------
A0A3M2BLV5      RARFW--------------------------------------------------
A0A2V7KS68      VVTE---------------------------------------------------
A0A2V7N4L3      VV-----------------------------------------------------
A0A1Q7AZK2      VV-----------------------------------------------------
A0A1Q7TNP7      VV-----------------------------------------------------
A0A1Q7KG39      VV-----------------------------------------------------
A0A1Q7GX75      VV-----------------------------------------------------
A0A1Q7LL80      VV-----------------------------------------------------
A0A2V7PFU2      VV-----------------------------------------------------
A0A2V7MFS9      VV-----------------------------------------------------
A0A2V7T933      VV-----------------------------------------------------
A0A2V7J4D7      PER----------------------------------------------------
A0A2V7LN90      PE-----------------------------------------------------
A0A2V7LFN9      PEYP---------------------------------------------------
A0A2V7MEK4      PEYP---------------------------------------------------
A0A2V7P8B1      RGTTPVAGR----------------------------------------------
A0A2V7R2W8      GPVEEPVTR----------------------------------------------
A0A2V7MS64      APE----------------------------------------------------
A0A2V7Q7N9      APEQVLPAPE---------------------------------------------
A0A2V7IRW6      APE----------------------------------------------------
A0A1Q7DVU6      APE----------------------------------------------------
A0A1Q7JSV2      APE----------------------------------------------------
A0A2V7QN41      GSAGVLWGQS---------------------------------------------
A0A2V7R603      GSAGVLWGRS---------------------------------------------
A0A2V7LJS2      RGRPPVTARQ---------------------------------------------
A0A1Q7GLJ7      QGASSHAAG----------------------------------------------
A0A2V7GRE3      QGVGSRPAR----------------------------------------------
A0A2V7EU00      RRLPGASSPDA--------------------------------------------
A0A1Q6WE01      HRVRGVL------------------------------------------------
A0A2V7S9K3      HRLRGVL------------------------------------------------
A0A1Q7DXB9      VPSV---------------------------------------------------
A0A1Q7JD32      VPSV---------------------------------------------------
A0A2V7MVP8      VPGD---------------------------------------------------
A0A2V7N0A9      PDSP---------------------------------------------------
A0A1Q7DLS9      RSVE---------------------------------------------------
A0A1Q7JK96      RSVE---------------------------------------------------
A0A2V7KQV7      PRRS---------------------------------------------------
A0A1Q7JGF6      PDRS---------------------------------------------------
A0A2V7SG67      PDRS---------------------------------------------------
A0A1Q7GIK9      PDPA---------------------------------------------------
                                                                       

© 1998-2019