BYKdb

Dataset for cluster orphancd of phylum ignavibacteriae

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
A0A1G0RXP0      --------------MEKFNLEKYLHGESKS----IKDYILLIRNNLKYIFIISPIVISLT
A0A3D6B6N8      MMNNNNNGSGNPAGNQNFNIEKYLLSGTKS----AKDYILLFRNNLKNIVIISLLILIIA
A0A1G0RWW2      ------------MAEEIQDDYNVHQTNT------FKDYLRIIRVNWIPVSLITLAGLIVA
A0A3A0BD75      -------MENNP-TGNFINQYQLNNGTEDSGRDTLRDYLVILRMHWVAIALIFAAAMCVT
A0A1G0TD08      -------------MNNNQNNFDLQELEGKS----FKDYLALVQKNLWPFLIISLVILIGT
A0A3N5L0V6      -------MENQPTNRNSLNTIETNIKSSHS----IRFYFNLILRNKVPIILSLVVGIIVS
                                                                            

A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
A0A1G0RXP0      VIYILLAKDIYKSSATIRITKQ-NENVLENTG-QSYDVGYVDRFIANEIRTITDYSIREK
A0A3D6B6N8      AAYAILAKNIYTSAASIRITNP-YKNVLEDGR-QNTDNAFLDRYIVSEIGVIGNYATRKK
A0A1G0RWW2      IIYAANATDIYKSTAALKIARPQGGSVLTSPLLPEFQEWGNDRFIANEIEIMRSFTAREM
A0A3A0BD75      IVYILTATNYYSTTTSIKINKP-QESILSSSIFTDFGGQQADRFIANEIDLMQTYPIRQK
A0A1G0TD08      AFYVLRLTDIYVSETSVKISKS-GGSILQTAPLLGMGDLGNDRMINNEIEILKSFDLRKI
A0A3N5L0V6      YFYAYSQEDIYSSASLMRLAKP-KENVLEGKIFSDIEGELPERFINNEVEILKSFAIREK
                                                                            

A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
A0A1G0RXP0      IAEVLIDSFKSTPSKNLFYLVKSADDRG---NIGHKPVMELAGLLGGAISVEQIQGTDMI
A0A3D6B6N8      IAQALIDSFEVSKHKDMLPLISA--QKG---SSSHKSVNQIAGMLGGIISVEQNQGTDVV
A0A1G0RWW2      VAVSLIDSFYRDTDKSRYSILLDQKPKTGDFENDIKSVDALAISLSD-VAIDQKRGLDII
A0A3A0BD75      AAKFILDTLQTIEDKSALYYLYSDPENI---SQGFRTVESMAKLLSDIVAIDQKRGLDVV
A0A1G0TD08      VANALLDSFAQSKSKDDFKLLYKSESNFGRETKKLLQSPNIEEMLGSIVDIEQKRGLDVI
A0A3N5L0V6      TARSIIDSFKVLKDKQSFALICMNRAN----CMEPKSVNQVASLLTGYIEIAQKRGLDIV
                                                                            

A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
A0A1G0RXP0      TISAESPSPLETAIIVNICALEYQKLNLAMNREKLTNIRKFLEQQREEKFAELKNAEDTL
A0A3D6B6N8      FISAESRSAFETALIANCAALEYQKINTAVSREKLTNLRKFLDDQAQEKLAELRSIEDSL
A0A1G0RWW2      EISALSPSPFEATLIANVYSQQYKTLNLDQNRNQLTLVTNFLDEQRKEKYDDLNSAEETL
A0A3A0BD75      TLVAESPSPIEATIISNLYARAYSEYSLELSRKDLTNTISFLVKEKDRKMRDLNNAEASL
A0A1G0TD08      VIAAQSPSPREAALIAALYAKIYRTYNLEINREQLSFVRDFLDQQRAEKKIQLSQAEDTL
A0A3N5L0V6      SIKAESPSPQEAALIANCYAETYADYSLKFNRGHLTLNREFLEKQVQGKYDDLLKSEDRL
                                                                            

A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      -----KGGIIALDDQAKELITQLSKFEADLNLGKMELAISEKTLKQYKDELRRQDPQLTA
A0A1G0RXP0      MIFQEKSGIVDLDFQSTGLISQLSQLEAQIEVTKIELSTSDEILKQYKFFLSKQDPQLVD
A0A3D6B6N8      MRFQEKGGIISFDVQSTNIIGQLSNLDAQKEAIKIQLSTSNEVLKQYKFFLKKQDPQLVE
A0A1G0RWW2      RAFQERGGLIALDERASTLISVLSQFEAQKSATQVDLMASNKVLESLRQELKAQNPRMAD
A0A3A0BD75      EDFQKRSGLINLDVQSEQLVNSISELDKAKGYAQVEITGNQTKYNELSAEIKKIDPQLVT
A0A1G0TD08      RAFQEKGGIIALDEQAQTLIQQLSQFEAQMNAAKIELIASTEVLNKYKEELTKQDPKLAD
A0A3N5L0V6      TTFLRSQNIVELNAQANALINTMTSIETQHNGAAIDLQTSGRTVSEIKSELDKIDPKATD
                                                                            

A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ---------------------------------------QAIREYDAKIKELRNKLNSKI
A0A2M7ITQ8      YLENFSSEEYLKNLQTELARLEVNRDVALSSVKDKNVDTQAIREYDAKIKELRNKLNSKI
A0A1G0RXP0      YLENQTSQAYINVLQQQLAELQVNKDLALSLKNPNVDISNKIKEYDQRIEELKQKLNSAI
A0A3D6B6N8      YLEGQTSQAYINALQQQLAELQVNRDIAMSIKSSDVDVSSKVKEYDTRIADIKQKLNSTI
A0A1G0RWW2      YLTSLTSQKYITAIQDEIAKLEVNKQVAVSRKDGLTEESPVIQEYDRKISELRKQLDKEL
A0A3A0BD75      FLEGELSGKYVTDLQAKISELELQKSIELSNTQTQAVRDKIIGDYEQRLQPLRNSLNEKV
A0A1G0TD08      YLASVTSETYITALQNQIAELQLNKDIALAKFESGIDISQKVKEFDLKINDLKGKLDEKI
A0A3N5L0V6      FIASKITDPYVAQLQQEIAKLEIQRDLVISGNEELLKDAKSLSSLNNKIADLKKNLDIKI
                                                                            

A0A2M8FIB1      -------------------------------------------------------SAIEY
A0A2H0Z4Q0      EGFKASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEIVNKYDSKFNQLPKSAIEY
A0A2M7ITQ8      EGFKASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEIVNKYDSKFNQLPKSAIEY
A0A1G0RXP0      SSIKADAFSSNPEQVRELAQKLIEEEIKNNTLSVRLNQLQTITKGYEVNLKRLPKTSTEL
A0A3D6B6N8      STIKAEAYSGNPDQVRDLAQRLIEEEIKNSSLSVQLDQLEKATGKYEGNLRRLPKASTVL
A0A1G0RWW2      EVLKAGIFASSPEEVKELTQKIIAEEVRNQSLETSIKELDKIVQGYEARFMKLPKNAIEL
A0A3A0BD75      MKLEEALYVQTPEERRELIQELLLAGVQRSESKSRLNIISGMLGKYEREFSLLPSQALEL
A0A1G0TD08      KVLKAGILASSPEEVRGISQKIIEAEVKNQSLRSSVASLSALVRKYEERFNKLPKTTLEL
A0A3N5L0V6      EILKTGASANTPDGRRILESKLFDAQLLNDQSKIKERLLKDFKGKYEAQFNKMPEQTIEY
                                                                        :   

A0A2M8FIB1      ARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGT
A0A2H0Z4Q0      ARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGT
A0A2M7ITQ8      ARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGT
A0A1G0RXP0      SQFQRNRETLQQLYLLINEKYQQATINELSQPGNVSIIGEGGIPSAPAKPNRILILLFGL
A0A3D6B6N8      SQYQRERESLQQTYLLLNERYQEAMINEASESGNVVILNPAVIPDSPSKPNRLLILLIGL
A0A1G0RWW2      ARLKRNSEALEKLYLLVEQRYQEAIINEQSQPGNVLIIDEARIPLSPAKPNRKLIVIIGL
A0A3A0BD75      AKIERQRLSSEKLYLLLEEKYQEALINQNARIGNVLITDPARVPSQPSKPKKTIVLLAGV
A0A1G0TD08      ARFQRTRESTEKLFTLIEEKYQEALINEQSQAGNVLIIDNARVPIKPSKPNRLLMMLVGL
A0A3N5L0V6      ANLERERKSDEKLYLMLLEKYQEALINEESQPNNVKIIDYGKTPKEKSKPNRFLIIMIGV
                :. :*   : :: : :: :.**:* **: :  .** * . .  *   :**:. :::: * 

A0A2M8FIB1      ILGLGFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPKIQSLDKSISKD----LEFII
A0A2H0Z4Q0      ILGLGFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPQIQSLDKSISED----LEFII
A0A2M7ITQ8      ILGLGFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPKIQSLDKSISKD----LEFIX
A0A1G0RXP0      MLGPGLAVGLIIIKDYFDNTVKTPEDIEKNNISFLSWVPQFKTNGESKDFN----QDLVT
A0A3D6B6N8      ILGPIIAFALILIKDHFDDTVKTPDDIEKEEIKFLTWIPHLKSNVKDNGFS----PGLVV
A0A1G0RWW2      LLGAGLAAGYVFVKNYFDDTVKSPDDIEKRKINVLAWIPPFESIMAGDHS-----VQFIV
A0A3A0BD75      LIGLGLGFGYAFGRNYLDRSIKNPEEIEKKGVTILAWIPSIDTLKEFKGGSP---DELVV
A0A1G0TD08      LIGFGLAFGYVLIRDYFDDKINTPEDIEKKNIHVLAWIPKINELNGINLNG----KDFII
A0A3N5L0V6      LVGLSIGYGFALFRNILDVSVKSPEELENIGISLIGWVPTFMRISRNGSRNAPSEQELIL
                ::*  :. .  : .: :* .::.*::::.  : .: *:* :                :: 

A0A2M8FIB1      YNKPDSVPSEAFRALRTRVQFSKVDQGNMKVIHITSSTPGEGKTLISSNLAGSFAQANHK
A0A2H0Z4Q0      YNKPDSVPSEAFRALRTRVQFSKVDQGNMKVIHVTSSTPGEGKTLISSNLAGSFAQANHK
A0A2M7ITQ8      XXKPDSVPSEAFRALRTRVQFSKVDQGNMKVIHITSSTPGEGKTLISSNLAGSFAQANHK
A0A1G0RXP0      LNKQDSPISESFRAIRARIQHSRIEEEFPKLILVTSAAESEGKTFISTNLAGSYVQSGKK
A0A3D6B6N8      LDENDSPVSESFRVIKARIQQSSVDPDLSKIILVTSPAEGEGKSFVSANLAGSFALSNKK
A0A1G0RWW2      DKLPDSIPSEAFRALRTRIQFSRINTESLKTILITSSAPQEGKTTIAVNLAGSFAHSKKK
A0A3A0BD75      LNKSTSTAAESFKALRTRVQFSKLEEKPLKSILVTSSIPGEGKTFVSSNLASSFAIDNKK
A0A1G0TD08      ENNPTSIPSESIRALRTRVQFSKLRKDALKTILVTSPAPQEGKSTIALNLAGSFAHSKRK
A0A3N5L0V6      SYNTDSAPAESFRTLRTRLQFSKLEPEPIKTILITSSIPREGKTIISANLAASFALSN-K
                     *  :*::..:.:*:* * :     * * :**.   ***: :: ***.*:.    *

A0A2M8FIB1      TLLLDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPA
A0A2H0Z4Q0      TLLLDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPA
A0A2M7ITQ8      TLLLDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPA
A0A1G0RXP0      TLLIDCDLRRPRIHKIMNVNKKPGLADYLANKAKLDEIIRNTKTNNLFYITSGTIPSNPA
A0A3D6B6N8      TLLIDCDLRRPTIHTKMGVDKKPGLVDYLSRKVALETIIR-SKTNTLSFITAGTNLSNPA
A0A1G0RWW2      VLLIDCDLRKPSVHKLFNRDKVPGLIDYLVGSAKLEEVLIKAEIPNLSFILSGTIPPNPA
A0A3A0BD75      VLLLDCDLRKPRLHNVFAADRFPGLSDYLFSHVELEDIIRDSQNENLKFITAGTIPPNPS
A0A1G0TD08      TLLIDADLRKPRLHSVFKKEKEPGLVNYLFGELSYEKLINATDTKNLFLITAGTIVPNPS
A0A3N5L0V6      VLLLDCDFRKPRIHNIFNQKRYPGLCDFLFGTVGFEEIIRDTQFDNLSLITCGTIPTNPA
                .**:*.*:*.* :*. :  .. *** ::*        ::  :.  .*  *  **  .**:

A0A2M8FIB1      EMLGSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLE
A0A2H0Z4Q0      EMLGSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLE
A0A2M7ITQ8      EMLGSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLE
A0A1G0RXP0      EVIESEVMKNFLLEIRDFFDVIILDSAPIIAVIDAEVLANLADGTILVISADKTEYRLMK
A0A3D6B6N8      ELLESKAMKNFLQEVKDIFDVVIIDSAPIVAVIDSEILAKLVDGTILVISADKTENRLMK
A0A1G0RWW2      EMLDSQEMRSFLKKLRDQFDLIILDSPPIIAVTDSEILTSMVDGTILIVSSENTEIDMME
A0A3A0BD75      ELLGSVQMKKFLELLENKFDMIVIDSPPLISVTDSEILFAVTDGGILVAKAQKTPIDVVM
A0A1G0TD08      EVLDSTELDILLKKVREEFDYVIIDCPPIIAVTDAEILARKVDGVILVVSANKTEKNLLD
A0A3N5L0V6      ELIASKHMQTFLNLVKPKFDYIIIDSPPLATVTDAELLSSYADGTVVVSLANKTRLDLLI
                *:: *  :  ::  :   :* :::*..*: :* *:*::    *.  ::  :: *   :: 

A0A2M8FIB1      KALDILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT--------
A0A2H0Z4Q0      KALDILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT--------
A0A2M7ITQ8      KALDILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT--------
A0A1G0RXP0      DAVELIKHNNV-SFLGTVLNNFEYKSGYGYYYKYYYNY------SKYSNQRGRKKIKLKS
A0A3D6B6N8      DAVDLIKRDKA-TFLGTVLNNFKYKSGYGYYYKYYYNY------SNSSDHKSKKSYKLKS
A0A1G0RWW2      RSVELIRRENT-QFLGTVLNNFSYKSGYGSYYKYYYYY------SRPDGKSA--------
A0A3A0BD75      KSANTVNNINPRNFLGCVLNDFNVKGSYGYYYNYYYYY------SKPEQKANA-------
A0A1G0TD08      LAVKLIKSEDS-FLIGTVLNNFSTKTGYGSYYKYYYYY------TADGEKKTSKFKKKEK
A0A3N5L0V6      NTIETLNKIND-SFIGVILNNFDYQATYGSYYKYYYYYYGSEKGKESGEKVTKAAKGTTK
                 : . :.  .   ::* :**:*  :  ** **:*** *           :          

A0A2M8FIB1      -----
A0A2H0Z4Q0      -----
A0A2M7ITQ8      -----
A0A1G0RXP0      -----
A0A3D6B6N8      -----
A0A1G0RWW2      -----
A0A3A0BD75      -----
A0A1G0TD08      QA---
A0A3N5L0V6      SSLKP
                     

© 1998-2019