BYKdb

Dataset for cluster tadcd of phylum ignavibacteriae

[Download (right click)] [Edit] [Sequences] [Repertoires]

26 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2G6EB58      ---------------------MAKQNLNGNDLQYIKDFMAEEETHSIKDYINIIRQHQFA
A0A1G0X4V9      --------------------------------MVNNNNNTSIRANTLWDYINLIRNNIVL
A0A3A0BB82      -------------------------------MVKKSRDKDKHNIDILKEFIGIIRVDWIY
A0A2G6EAS5      -----------------------------MENKKVINNSLSNPSNTFNDYISLIRTNIYT
A0A1G0P817      -------------------------------MNKTNNSSKNLNQSILKEYLRLIRANFSS
A0A1G0QLK5      -------------------------------MNKTNNSSKNLNQSILKEYLRLIRANFSS
A0A2N1VFP3      ------------------------------MNGSQGNSPLNQDAHTMRDYINLIRLNFVA
A0A1G0VGZ5      -------------------------------MNKAAVQPHVQDTHTLRDYINLVKLNFVP
A0A1G1B9H5      -------------------------------MNKAAVQPHVQDTHTLRDYINLVKLNFVP
A0A419H3A3      -------------------------------MNKAAVQPHVQDTHTLRDYINLVKLNFVP
A0A2M7ZEP7      ------------------------------MENKVFHNLREQENSSIKDYINLIKINFLP
A0A419EVC1      MIRRGKVDNNNFQ--------------------------RVQEGSSLKDYLFLIRNNLVP
A0A2E0W055      ------------------------------------MNYREQEGNSLKDYINLIKINIIP
A0A2N1VVT2      MVCNNAIHNFHITIFNNSYTEHQQLIKGNILENKLFQNLRDEESNSLHDFINILRLNLVI
A0A3N5Q7G8      ------------------------------------------------------------
A0A1G0P4D7      ----------------------------MSEENKNE---NLVETNSLKDYINLVRNNLFP
A0A1G0QKB6      ----------------------------MSEENKNE---NLVETNSLKDYINLVRNNLFP
A0A1G0V7G7      ----------------------------MSEENKNE---NLVETNSLKDYINLVRNNLFP
A0A1G0XBL4      -----------------------------MNNNKNDFDFQELEGRNFKDYLILLRKNLTP
A0A3D6BED1      ----------------------------MSNPNLNDTDVDESQSSTLKDYLILFSANIKP
A0A2H0FVC7      ---------------------------MNNGLNNNGAGFEVEETNSLKDYVNLIKLNLIP
I6ZVA1          --------------------------------MNNNDNNFYQENNSLKDYINLIRLNIGS
A0A2H0DC71      ------------------------------MSNNNNTNSNEVREQGLQHYYNIIVDNLFP
A0A2M7MN42      ------------------------------MSNNNNTNSNEVREQGLQHYYNIIVDNLFP
A0A1V5TPD0      --------------------------MKNTIPNNF------KKEKSLLEIINIVYRGRIK
I0AMF0          --------------------MEQNKNNEEYIPLRFSNKNVPKREKTLVEIFQIIAKNKKI
                                                                            

A0A2G6EB58      VMIISLIILTLAVVYAVVAKDIYEASTMLKISEPQ-GSILDASSF-LPEFGG-GNKADRF
A0A1G0X4V9      ITIILAIIFLVTTIYAIVAPNKYTSTVSLKISPPS-GNILSSRFGDLQNFGG--QGSDRF
A0A3A0BB82      VLLIFLGVLLTTVFYVLNARNIYESTTVIKITKPQ-GSILTSSP--IPEFQDFGFLSDRY
A0A2G6EAS5      ILIISFVFLVGAIAYALFKNDVYQASTTLKITQNK-QNILKGPS--FDDLTGT-GGNNFF
A0A1G0P817      LLIINIIIIIVATIYAITAQDIYTATTDIKITTPQ-GSILTSPL--IPNSGNLGFGNDLL
A0A1G0QLK5      LLIINIIIIIVATIYAITAQDIYTATTDIKITTPQ-GSILTSPL--IPNSGNLGFGNDLL
A0A2N1VFP3      IALITLTGLLVALVYAINAPNIYKSTTVLKLSKPQ-GNILSGSL--IPEFQD--FGSDRF
A0A1G0VGZ5      IFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQ-GSVLSGSL--LPEFQD--FGSDRF
A0A1G1B9H5      IFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQ-GSVLSGSL--LPEFQD--FGSDRF
A0A419H3A3      IFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQ-GSVLSGSL--LPEFQD--FGSDRF
A0A2M7ZEP7      VLLISLTGLIVASLYAIYAIDIYKSTVVLKVAKPS-GSILNSPL--MPEFSD--FGSDRF
A0A419EVC1      IILITLAGLAVAVIYAINAPNIYKATTSLKVSKPQ-GSILESPL--IPEFQD--FGSDRF
A0A2E0W055      ILLISAAGLIVSVLYALTAQNIYKSTTVMKLSKPQ-GSILEAPL--MPEFQD--FGSDRF
A0A2N1VVT2      ILLISVTGLIVSVYYASRTPDIYTATALIKLQQPK-GSIISGPL--IPTISS--FGNDRF
A0A3N5Q7G8      -VLIIATALIVSIIYAVNARDIYKSTATLKVVKPQ-GNILYSPV--IPEFQD--FGNDRF
A0A1G0P4D7      IILIVAASLIISIVYAVNARNIYKSTAALKVVKPQ-GSILNSPV--ISDFQD--FGSDRF
A0A1G0QKB6      IILIVAASLIISIVYAVNARNIYKSTAALKVVKPQ-GSILNSPV--ISDFQD--FGSDRF
A0A1G0V7G7      IILIVAASLIISIVYAVNARNIYKSTAALKVVKPQ-GSILNSPV--ISDFQD--FGSDRF
A0A1G0XBL4      FLIILIMSIAVSIVYTLRLPDIYVSETSIKISKSG-GSVLQSQP--FGDFGD--LGSDRI
A0A3D6BED1      VSAILIASLIISIIYAISARDIFKTSTALKITKPG-GSILQSPL--MPEISD--YGNDRF
A0A2H0FVC7      ILLITFTGLTVAIIFAIISKDIYTASTSLKIAKPNGGGILDAPL--LPEFSD--FGNDRF
I6ZVA1          IVVISLTALIVAVVYALNAPDIYKSTTTLKITKPQ-GSILDAPL--IPEFQD--FGSDRF
A0A2H0DC71      FSLIAIVAIVVSVVYAVSSINIYKSTTVLKVSKPS-GNILNSPL--MPEFQD--FGSDRF
A0A2M7MN42      FSLIAIVAIVVSVVYAVSSINIYKSTTVLKVSKPS-GNILNSPL--MPEFQD--FGSDRF
A0A1V5TPD0      IVISVFLSLVLAFLYIKFTPPVYESKALLKKEAAE-NP---GQKDEFSELVK--LQTSDQ
I0AMF0          LFATVGVLLIAALIYSFTATPIYEASATLKKEGNP-NDRRLGSGTDISTLLS--LQSTDE
                        :  :  :       : : . :*           .    :             

A0A2G6EB58      IANEIETIK-NITITEKVAREIT-------------------------------------
A0A1G0X4V9      IANEIQTIY-NSTIMNEVAEAII-------------------------------------
A0A3A0BB82      ISNEIEVLK-SFSIRSLTAKTLL-------------------------------------
A0A2G6EAS5      IANEIETIR-NVTIREQVAGVVL-------------------------------------
A0A1G0P817      IANEIQTVTYNYTIREQVADAVI-------------------------------------
A0A1G0QLK5      IANEIQTVTYNYTIREEVADAII-------------------------------------
A0A2N1VFP3      IANEIEVLK-SYHLRERVSRCLI-------------------------------------
A0A1G0VGZ5      IANEIEILK-SYKLRSKVANALL-------------------------------------
A0A1G1B9H5      IANEIEILK-SYKLRSKVANALL-------------------------------------
A0A419H3A3      IANEIEILK-SYKLRSKVANALL-------------------------------------
A0A2M7ZEP7      IANEIEILK-SEKIRSLIIKQIQ-------------------------------------
A0A419EVC1      IANEIEILK-SYSVRERVANAML-------------------------------------
A0A2E0W055      IANEIEIMK-SYTIREKVAKSLI-------------------------------------
A0A2N1VVT2      IANELEILK-SYRMREIVAKALL-------------------------------------
A0A3N5Q7G8      LANEIEVLK-TFNTRERVAKSLI-------------------------------------
A0A1G0P4D7      IANEIEILK-TFNTRERVAEALI-------------------------------------
A0A1G0QKB6      IANEIEILK-TFNTRERVAEALI-------------------------------------
A0A1G0V7G7      IANEIEILK-TFNTRERVAEALI-------------------------------------
A0A1G0XBL4      INNEIEILK-SYDLREIIAKALL-------------------------------------
A0A3D6BED1      IANEIEILK-SNNIRERIAKILL-------------------------------------
A0A2H0FVC7      IANEIEILK-SYRLRTIVATSLI-------------------------------------
I6ZVA1          IANEIEILK-SYSLRNQVAETLS-------------------------------------
A0A2H0DC71      IANEIEVLK-SYKVREIASTALK-------------------------------------
A0A2M7MN42      IANEIEVLK-SYKVREIASTALK-------------------------------------
A0A1V5TPD0      LETEMELIK-TNEVLSGVINELKLYVELRKVV-DPNGNSYEFNNIFVDFPDSANNYTKQM
I0AMF0          IETELELIK-TFKVASEVAKELDLYVNVKEIKWNSNDKNYEINKTFVEMNDPS--FIGKN
                : .*:: :  .          :                                      

A0A2G6EB58      -----------------------DSFIAINNNEMFSLI----------------------
A0A1G0X4V9      -----------------------DSFKVKKNEDDFSLI----------------------
A0A3A0BB82      -----------------------DSAEANGNISSFYHL----------------------
A0A2G6EAS5      -----------------------DSFQNKADKENYDVV----------------------
A0A1G0P817      -----------------------DSVESSSPSD-FALI----------------------
A0A1G0QLK5      -----------------------DSVESSSPSD-FDLI----------------------
A0A2N1VFP3      -----------------------DSFKLSPEKNKFSLI----------------------
A0A1G0VGZ5      -----------------------DSFNVSSTKNKYYMI----------------------
A0A1G1B9H5      -----------------------DSFNVSSTKNKYYMI----------------------
A0A419H3A3      -----------------------DSFNVSSTKNKYYMI----------------------
A0A2M7ZEP7      -----------------------DSFKVIDA-DSFYLV----------------------
A0A419EVC1      -----------------------SYYKDSSIKDSFYII----------------------
A0A2E0W055      -----------------------DTFHNIGVRDSFYWV----------------------
A0A2N1VVT2      -----------------------DSFRTANRVDTQNFM----------------------
A0A3N5Q7G8      -----------------------DTYNDVASKDSFYIL----------------------
A0A1G0P4D7      -----------------------DSFNTFGVKDSFFLL----------------------
A0A1G0QKB6      -----------------------DSFNTFGVKDSFFLL----------------------
A0A1G0V7G7      -----------------------DSFNTFGVKDSFFLL----------------------
A0A1G0XBL4      -----------------------DSFAQSSSKDDFKLL----------------------
A0A3D6BED1      -----------------------DTLLKSNDPKSFHLL----------------------
A0A2H0FVC7      -----------------------DSFNVIAQPDSFYNI----------------------
I6ZVA1          -----------------------DTFKLSRDKDKFELI----------------------
A0A2H0DC71      -----------------------DSFNALNQIDSFKVL----------------------
A0A2M7MN42      -----------------------DSFNALNQIDSFKVL----------------------
A0A1V5TPD0      SFSFPIFKNFQLLNDYTEK----EYYIKKINQNRFELWDAKGKNIITSFNDFSVSKSDSI
I0AMF0          SRKFRIPEKFKIKFERAEDLLLGDFSIVKKSNDKYELID------LLSGNKISESTIEKP
                                       .        .                           

A0A2G6EB58      ---------------------------------VN--KNYF---EDGSSGLKEFDAIIKV
A0A1G0X4V9      ---------------------------------FD--KSYF---QSKGTLLKSANEVAGN
A0A3A0BB82      ---------------------------------LN-DPDDL------SKGLKNEFEIAKM
A0A2G6EAS5      ---------------------------------FR-KNSFF---DDSDKKIRTVESLAGA
A0A1G0P817      ---------------------------------IDDENT-----AKSRGKLKEYDDILDI
A0A1G0QLK5      ---------------------------------IDDENT-----AKPRGKLKEYDDILDI
A0A2N1VFP3      ---------------------------------YE-DARGI---STTGRKLKTVEEIAVM
A0A1G0VGZ5      ---------------------------------FE-DPSEL---KQGKFRLKTIASIVGM
A0A1G1B9H5      ---------------------------------FE-DPSEL---KQGKFRLKTIASIVGM
A0A419H3A3      ---------------------------------FE-DPSEL---KQGKFRLKTIASIVGM
A0A2M7ZEP7      ---------------------------------LD-QDSKFFSNNKNKKKLLPYREISKL
A0A419EVC1      ---------------------------------KNKDYGKD---RTVKSPVKSVQQITDM
A0A2E0W055      ---------------------------------LN--QDLD---LTPDSEVKTVVQLSEL
A0A2N1VVT2      ---------------------------------IN--YSKL---LSEKSDTNISQNLGSI
A0A3N5Q7G8      ---------------------------------LD-VSSAF---QETKARLLSTDDIAER
A0A1G0P4D7      ---------------------------------LN-QKS-----DKQKGKLLPVSEIAEE
A0A1G0QKB6      ---------------------------------LN-QKS-----DKQKGKLLPVSEIAEE
A0A1G0V7G7      ---------------------------------LN-QQS-----DKQKSRLLPASEIAEE
A0A1G0XBL4      ---------------------------------YK-SESEF---RNDNKRLLKLGEIEGV
A0A3D6BED1      ---------------------------------LT-DEF------GEDSRPKTVPEIAGV
A0A2H0FVC7      ---------------------------------FD-RSIDF---DREAYKLKNINDLVLM
I6ZVA1          ---------------------------------VD-REDR-----NTKPTLMPIEDIVEL
A0A2H0DC71      ---------------------------------VH-TPSKL---TNDKPKLLEVDEIASL
A0A2M7MN42      ---------------------------------VH-TPSKL---TNDKPKLLEVDEIASL
A0A1V5TPD0      KESNALDLSDSTKSSVQDAEGVTVI---TDAAKFEFSWSDAPVGSKIYFNIKNYLKFLTR
I0AMF0          KYDGFSPLDTIPGFTIKRDTSVVYIIPMNDKVNIEFSWNGAPVKSEFIFTVNDINQTAIG
                                                                            

A0A2G6EB58      LENKV--SVEQKRGLDFIEIKVESPSAQEAALIADTYARVYREFNLLDNRKQVSKVKDFL
A0A1G0X4V9      LYSNV--KITQLNDLDWVDIVVESQTPQEAALIANIFAKKYQKFNLLENRKQIRIIKEFL
A0A3A0BB82      LKQVV--QVVQKKGLDVVDLSVESPSPYEAAIICNAYAKTYSDYSLEFSRLDLTNIINYL
A0A2G6EAS5      LLKSV--EITQKNNLNFMEIMVESESPEEAAMIANSYAEVYRNFNLLENRKQFTIVKDFL
A0A1G0P817      LENHV--EVEQIGNLDFISISVESPSAKEAAVIANSYAEAYRVFNLMVNRNELTTIRKTL
A0A1G0QLK5      LENHV--EVEQIGNLDFISISVESPSAKEAAVIANSYAEAYRVFNLMVNRNELTTIRKTL
A0A2N1VFP3      LTSKV--SIDQKRGLDIIEISVESQAPFEAAMIANSYASSYKEINLTYNRQQLTVIKNFL
A0A1G0VGZ5      LPSKV--SIDQKRGLDIVEISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFL
A0A1G1B9H5      LPSKV--SIDQKRGLDIVEISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFL
A0A419H3A3      LPSKV--SIDQKRGLDIVEISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFL
A0A2M7ZEP7      LEKV---SIDQKRGLDIIEISVESPSPFEAAFLANAYAKAYESLNLSYNRQQLVVVRDFL
A0A419EVC1      LTSVV--SIDQKRGLDIVEISVESQSPYEAALLANEYATAYNQMNLQTNRAQLTNIKNFL
A0A2E0W055      LSKIA--VIEQKRGLDILEISVESPSSFEAALIANSYAEAYKQQNLTYNRLQLITVKNFL
A0A2N1VVT2      IGILSGVSVNQKQGLDLVEISATSTSPLEAKIIANTYAKSYENLNLKYERQQLISVKNFL
A0A3N5Q7G8      LSSAV--SIDQKRGLDIIEISAESPSPYEAMLVANSYANEYKTLNLEVNRNQLTIVKNFL
A0A1G0P4D7      LFHAV--SIDQKRGLDIIEITVESPSPYEAVLAANCYTNEYKNLNLEVNRDQLTLVKDFL
A0A1G0QKB6      LFHAV--SIDQKRGLDIIEITVESPSPYEAVLAANCYTNEYRNLNLEVNRDQLTLVKDFL
A0A1G0V7G7      LFYAV--SIDQKRGLDIIEITVESPSPYEAVLAANCYTNEYKNLNLEVNRDQLTLVKDFL
A0A1G0XBL4      LGSKV--NIEQKRGLDVIVISAESPSPKEAALIAALYAKVYRTYNLEINREQLSYIRNFL
A0A3D6BED1      LGSAV--QIEQKRGLDIIDISVESQAPKEAALIANVYAKEYLTYNLEISRDQLTFVREFL
A0A2H0FVC7      LE-DT--KIEQKRGLDIVTISYESHSPFEARLITNAYADAYENLSLKYTRQQLTTVVQFL
I6ZVA1          LESEV--DISQKRGLDIVEITVESRSPYEASLIANCYAEAYKKLNLTYNRQQLTAIKEFL
A0A2H0DC71      LSTNV--TIEQKRGLDIVEISSQSPSPFEAALITNLYAQAYKTLNLEINRNQLTLVKAFL
A0A2M7MN42      LSTNV--TIEQKRGLDIVEISSQSPSPFEAALITNLYAQAYKTLNLEINRNQLTLVKAFL
A0A1V5TPD0      FGDAI--NVSRVGHTGVFELNVRSVSPLACNIIANSVIRHFREVRMEQQKQMVRYSFHFV
I0AMF0          VSKSI--KVSRVGKTNIFNLGYSSSSAYAAALITNTVVDKYREARMDQKKQTIRYSYNTV
                .       : .    . . :   * :.  . .        :    :   .  .      :

A0A2G6EB58      FNQRNDKLNELIAAEDKLKNYQLKGGVVELSSQAQSLIETITDLEAKINANAVELSIARE
A0A1G0X4V9      GEQLKEKQLALYAAEDAVKEYQLRKGGVQLDAQAQLLISKLADFESQKNTAKVNMSITKE
A0A3A0BB82      NTEKEKKFRDLKLSEAALEDFQQREGVVQLDVQADELVRSLSAIDKEKTMTSIELAANEK
A0A2G6EAS5      NEQKEQKYDELLVAEENIKVYQANSGGIELNSQAKAMINTLTKFESDKNITQMEIAIERK
A0A1G0P817      EEQRKEKLSDLILAENNIKAYQLKGGVIQLDAQAKNLIDKLSNYEAQRNTAQIDLSILKG
A0A1G0QLK5      EEQRKEKLSDLILAENNIKAYQLKGGVIQLDAQAKNLIDKLSNYEAQRNTAQIDLSILKG
A0A2N1VFP3      AQQREEKLAQLVGVEETLKNFQEKSGIVQLPEQARALIDQSSDFQAKMNAAKVDLTISEK
A0A1G0VGZ5      ASQRDEKQSELISVEETLKNYQEQRGIVELPEQAKALIEQSSDIQAKMNATRIDLTMTEK
A0A1G1B9H5      ASQRDEKQSELISVEETLKNYQEQRGIVELPEQAKALIEQSSDIQAKMNATRIDLTMTEK
A0A419H3A3      ASQRDEKQSELISVEETLKNYQEQRGIVELPEQAKALIEQSSDIQAKMNATRIDLTMTEK
A0A2M7ZEP7      MEQREEKYHELILAEEKLKNYQEKGGIIALDEQAKSLIAALSDFQSQRDASQIEVAMTQK
A0A419EVC1      EEQRKGKQGELSRSEDSLRRYQQQGGIIALDEQAKSLIDQLTNFEAQKNSTNIELTVARN
A0A2E0W055      EEQRVDKLNELREAEDAVKKYQEQGGIVVLDEQARALIDLISEFESQLNAAKIEMMSSEL
A0A2N1VVT2      EKQRNQKLDELMQSEDNLKRFQEQGGIIAIDEQAKALIDVITDFQSQRDATQIELSISGK
A0A3N5Q7G8      LEQRNEKQTLLNEAEETLRKFQERGGVIALDEQANNLIAQLSNFEAQKNAAQIDLMASDK
A0A1G0P4D7      LDQKQEKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQLSDFEAQKNATQIELMASSK
A0A1G0QKB6      LDQKQEKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQLSDFEAQKNATQIELMASSK
A0A1G0V7G7      LDQKQEKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQLSDFEAQKNATQIELMASSK
A0A1G0XBL4      DQQRAEKKTQLSQAEDTLRAFQEKGGMIALDEQSQLLIQQLSQFEAQMNAAKIELVASEE
A0A3D6BED1      ANQRLEKKEQLNDAEEILRSYQERGGIIALDQQAQTLIQQLAQFEAQKNATQIEIEASSE
A0A2H0FVC7      KEQRKDKYSALLEVEEKIKTFQVEGGIIALDEQAKALIDMLSTFESQRDAAAIEMMATEK
I6ZVA1          AQQREEKLAELSAVEEALRTYQEQKGIVELPEQARALIEQTTDFESKMNATKIDLTIAEN
A0A2H0DC71      LDQKNEKLAQLNNSEELLKMFQEKGGIIALDDQAKELITQLSKFEADLNLGKMELAISEK
A0A2M7MN42      LDQKNEKLAQLNSAEDILKIFQEKGGIIALDDQAKELITQLSKFEADQNLAKMELAISEK
A0A1V5TPD0      DQQLSEVQKKLLDAENNLSSFKGSQQIMNIDQNTQELLNYQSTLEAENLQTDLLLSDYRN
I0AMF0          DKQLVEVQEKLQEAEKILSDFKSSGQIMSIDASSQEIVGFLSRLEAEKVSTDLLLSDYKN
                  :       *   *  :  ::     : :  .:  ::   :  : .     : :     

A0A2G6EB58      NLNQFKEELNKKDPTIIQYLENKSAEPYLLRLQEQIAEVQTQKDIALS-SLGDSKSSKDV
A0A1G0X4V9      KLNQYKNELEKRDPSISNFLANKTSEPYLQKLQEEIASLQTQRDVALA-SSKTANANN--
A0A3A0BB82      KYSELSQKIDEIDPKLKVYLESEISKGYLPELQKQIAQLEIERELQLS-IISNDRVRQ--
A0A2G6EAS5      KLNEFKNELSERDPSLSNYFDLQSARPSIEMLQKEIASIETQKAIALS-GKGSREQKN--
A0A1G0P817      SLEKYKNELKQKDPSLITYLESKTSEPYLTSLQTQIAQLETQRDMALS-GSSGSRVNS--
A0A1G0QLK5      SLEKYKNELKQKDPSLITYLESKTSEPYLTSLQTQIAQLETQRDMALS-GSSGSRVNS--
A0A2N1VFP3      TLNNYKQELNKHDPNLTDYIENLATEPYIKKLQEQIGEQKIQRDRALA-SQSS--NKQ--
A0A1G0VGZ5      SLNQYKDELKRRNPEIQNYIDNLASEPYIKRMQDELAEQKSQRDRAIK-DAGP--N-S--
A0A1G1B9H5      SLNQYKDELKRRNPEIQNYIDNLASEPYIKRMQDELAEQKSQRDRAIK-DAGP--N-S--
A0A419H3A3      SLNQYKDELKRRNPEIQNYIDNLASEPYIKRMQDELAEQKSQRDRAIK-DAGP--N-S--
A0A2M7ZEP7      ALDQYKEELEKKNPSLTQYIESYAAEPRLKSLQEQIAKLETQRDLAIA-NKN-VPENK--
A0A419EVC1      NLAQYRDELKKQDPRLADYLQSFAAEPYLKSLQEEIAKLETNRDIALA-SKGQYTSNS--
A0A2E0W055      TLKLYNEELDRQNPEIKKYIENFAAQKELEQYQTSIAKLTVDKELAMA-NLNRTNKEQ--
A0A2N1VVT2      RLQQYNNELEKKNPTIAQYIKNAATQPRLENLQKSIAQMETQRDVAIS-NTQGASRRK--
A0A3N5Q7G8      ILAQYKRELAEQNPRLADYLKGLSSEAYFTSLQEQLVKLEVNRDIALS-NNNPIENRN--
A0A1G0P4D7      VLNQYRNELDKQNPRLADYLKGLSSEAYFKSLQEQLVRLEVNRDLALS-TKSSLEDDS--
A0A1G0QKB6      VLNQYRNELDKQNPRLADYLKGLSSEAYFKSLQEQLVRLEVNRDLALS-TKSSLEDDS--
A0A1G0V7G7      VLNQYRNELDKQNPRLADYLKGLSSEAYFKSLQEQLVRLEVNRDLALS-TKSSLEDDS--
A0A1G0XBL4      VLNKYKDELSKQDPKLADYLESVTSETYITALQNQIAELQLNKDIALA-RLEPGIDIS--
A0A3D6BED1      VLKQYRDELSKQDPKLADYLASATSETYIKALQDQIAELQIRRDLALA-KTDTKTDFS--
A0A2H0FVC7      MVNSYKTEINRLNPSISKYIESFATKPKMKGLQEQIAQLEMQRDLAISDSSVTIESEA--
I6ZVA1          NLKQYKAELAKQDPNINDYIESFATEPYIKNLQLQIADLQTQKDRALS-SYKDSPRRS--
A0A2H0DC71      TLKQYKDELRRQDPQLTAYLENFSSEEYLKNLQTELARLEVNRDVALS-SVKDKNVDT--
A0A2M7MN42      TLKQYKEELRNQDPQLTAYLENFSSEEYLKSLQTELAKLEVNRDIALS-SSKDKNNDN--
A0A1V5TPD0      KEVALKSELKSSGYFDQGFLSPSTESQSSSPFTTLMSRLSDLELQRLE-LLQKRTEKH--
I0AMF0          KVADLQTQLSQKGFFDQSYLNPRGEGEGMSPFAELMRQLSNLELQRIE-LLQKRTENH--
                       ::   .     ::               :          :             

A0A2G6EB58      QIIKKFDEKLAELKNKLSKNVKSYQSSVLAASPEEIKTLTQQIFEEQVKAQALQASHDKL
A0A1G0X4V9      TAVAELNSKINSLKDKLNKSMKEYGNQILASSPEEIKVLSQKTFEEEVTYQSLAESYNSF
A0A3A0BB82      KAKEEYDRKISSLQESLDKNVKSLDAGMYVMTPEERREMVWELVKTGVMVNSDRIKNRVL
A0A2G6EAS5      TLVKGLDQKLGELRKKLKTDIDAYESKVYAATPEEVKELSAKIFESEVKIQSLAAKNSQL
A0A1G0P817      EVINDYNNRIDELKDKLKKSVSKYQSMILSSSPEEIKDLTKKVFETEVKYQAEMSSYNQL
A0A1G0QLK5      EVINDYNNRIDELKDKLKKSVSKYQSMILSSSPEEIKDLTKKVFETEVKYQAEMSSYNQL
A0A2N1VFP3      QMVREVDAKISELRDKLNSQLSVFRAGVLASSPEEIKELAKRVVDEEIKYQSIVASYKKL
A0A1G0VGZ5      PLVKKAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKL
A0A1G1B9H5      PLVKKAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKL
A0A419H3A3      PLVKKAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKL
A0A2M7ZEP7      RLIKDYDESIKELKLKLDEQLKIYKTSIFALSPEEVRELSLNVLEQEVKLISAQSKKENL
A0A419EVC1      KVIADYEAKIKSLKDKVTEKMSVYKAGIFASSPEEVKSLTQKIIEEETKVKAATASLQEL
A0A2E0W055      EIAKYYDDKIADLNKKVDKLLEKYEASIFASSPEEIKELTLKKLEEEVKYNAYKASYNEL
A0A2N1VVT2      ELVEDYNARINELKSTLDEQLAVYKASIFASSPAELKDLSLKVLEEEIKSKATASKFESL
A0A3N5Q7G8      KIVSDYDEKIKELQNKLNSKVDEIKTGIFASSPAEVKELSQKIIEEEVKNQALKISVSEL
A0A1G0P4D7      KSVQNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTEL
A0A1G0QKB6      KSVQNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTEL
A0A1G0V7G7      KSVQNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTEL
A0A1G0XBL4      QKVKEFDVKIRELKDRLDEKIKVLKSGILASSPEAVRGISQKIIEAEVKNQSLRSSVTGL
A0A3D6BED1      DQLRDYDNKIKDLKGKLAEKIKVLKAGIFASSPEEVKNLSQKIIEEEIKNGSLKTTLNEL
A0A2H0FVC7      KLISETNKRIAELKIELNKELETYKQSIFAASPEELKELSISLLEAEVKYESLKSTISKT
I6ZVA1          EIIREFDAKINDLKEKLNNQLTVYRAGILASSPEEIKELTRKVLEEEVKYQSLKASYEKL
A0A2H0DC71      QAIREYDAKIKELRNKLNSKIEGFKASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNL
A0A2M7MN42      QTIKEYDAKIKELRNKLKSKVEGVKASIFASSPEEVKLITKNVIEEEIKSQGYAIKVKNL
A0A1V5TPD0      PDVVKLDEQIRLTKEQLSS----YNQNTLASYRIVIDAMEKKQA--------------KI
I0AMF0          PDVKAVDEQINSVKQKLSS----FNENTITAYQIMIGTLEKKLL--------------KI
                      :  :      :                     :                     

A0A2G6EB58      KGFLAGYEKRFNSLPQRTIDLARYEREKLAYEKLYSLLEEKYQEALINEQSTTGSVLIMN
A0A1G0X4V9      TNVINKYEQEFNKLPTSTLDYARLERRRLAEENLFNTLTEKYQEAQLNEQATPGNVLIMN
A0A3A0BB82      GNYVNEYETRFNKLPSQIIEYARLERDKLTNEKIYILLEEKYQEALINQNARIGNVTIID
A0A2G6EAS5      SQVLNSYESEFQSLPAKSLEIARLERKRQSLEKMYLVLEDKYQEALLNEQSIPGNVLILS
A0A1G0P817      GQIISSYEGRFNNLPGRTLDLARLERERSVFEKLYLALEEKYQEALINEQAMPGNVFIMN
A0A1G0QLK5      GQIISSYEGRFNNLPGRTLDLARLERERSVFEKLYLALEEKYQEALINEQAMPGNVFIMN
A0A2N1VFP3      NEIVGEYDKKMNLLPTTATDQARLEREKSANEKLYLQVEERYQEAIINEQSVPGNALVID
A0A1G0VGZ5      NEIGGDYDRKLSALPTSSTDLARLTREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIID
A0A1G1B9H5      NEIGGDYDRKLSALPTSSTDLARLTREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIID
A0A419H3A3      NEIGGDYDRKLSALPTSSTDLARLTREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIID
A0A2M7ZEP7      EKIVGKYDKKFNELPSQTIDLARYQRELSAYEKLYLLVEEKYQEALINEQSTPGNVLIID
A0A419EVC1      NDVVRSYDAKFNSLPKATIELAKLERDRTANEKMYLLVEEKYQEAIINEQSQPGNVLIID
A0A2E0W055      DKIVKNYERRFNQLPERTIDLARLQREREAYEKLYLLVEEKYQEALINEQSTPGNVIIVD
A0A2N1VVT2      DDIVRRYERRFNELPRQTIDYARFQRELTSYEKLYLLVEGKYQEALINEQSTPGTVLIID
A0A3N5Q7G8      EIIVKSYESKFNNLPKTAIELARYQRSRESLEKLYTLVEEKYQEALINEQSQPGNVLIID
A0A1G0P4D7      GSIVRNYEKKFNKLPQTAIELARYQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIID
A0A1G0QKB6      GSIVRNYEKKFNKLPQTAIELARYQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIID
A0A1G0V7G7      GSIVRNYEKKFNKLPQTAIELARYQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIID
A0A1G0XBL4      SALVNRYEERFNRLPKTTLELARFKRTRESSEKLFTLIEEKYQEALINEQSQAGNVLIID
A0A3D6BED1      NLVVKKYDERFNKLPKTSIELARFERNRESLEKLYTLVEEKYQEAVINEQSQPGNVLIID
A0A2H0FVC7      KEIVNQYEARFNELPKQTISLARLTRELNANEKLYLLVEEKYQESLIVEQSTAGNVLIID
I6ZVA1          SEIVADYDKRLNKLPTSSIDLARLTREKQAYEKLYLQVEEKYQEAIINEQSVPGNVMIID
A0A2H0DC71      SEIVNKYDSKFNQLPKSAIEYARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIID
A0A2M7MN42      DAIVKTYDAKFNQLPKSAIEYARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIID
A0A1V5TPD0      KDLMSGFEAQIKRLPGQESQLARLIREKEVYEKIFNVLLNKREEMRVAELSKLQDIIIVD
I0AMF0          NDMMSKYEAKLQSLPAQENKLAQILRQKATYEKIFTILLDQREAMRVAELSSPQDISIVD
                      ::  :. **    . *.  *     *:::  :  . :   : : :      ::.

A0A2G6EB58      YARVPKVPAKPNRKLIILIGLVLGLGLAFGYALIMNYFDKAIKSPEDIEER-NINLIGWV
A0A1G0X4V9      TANPSRNPSGPNRMMIILMGLFIGIGFALGFVYVRNYFDKTIKTPEDIEAQ-NVNVLAWI
A0A3A0BB82      PAFESLLPSKPNRVFLLVSGAVFGLILGIGFVITRNYLDKSIKTPDDLENN-GYSILAWI
A0A2G6EAS5      KARAPESPAEPNRLKIAIMGLFAGLFFAVVFVYVKSFFDKTVKTPDDLENL-GLYVLGSV
A0A1G0P817      YAFPPPDPNKPSRPLIIVFGVIIGFGFGFGFIYLKDFLNKRIKTPEDIQDL-GTTLLTWI
A0A1G0QLK5      YAFPPPDPNKPSRPLIIVFGVIIGFGFGFGFIYLKDFLNKRIKTPEDIQDL-GTTLLTWI
A0A2N1VFP3      AGLVPILPAKPNRLLIVIIGLFLGIGMGIGFAFIRNYLDNTVKTPEDIQNK-NINILSWI
A0A1G0VGZ5      EGLVPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKTPEDIQNK-NLNILAWI
A0A1G1B9H5      EGLVPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKTPEDIQNK-NLNILAWI
A0A419H3A3      EGLVPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKTPEDIQNK-NLNILAWI
A0A2M7ZEP7      EARRPELPSKPNRMLIVLVGLVIGVGMGAGFAFVKNYFDNSVKTPEDIQNN-DINVLAWI
A0A419EVC1      YARIPYKPAKPNRMLIVIVGFIFGLGMGLGYAFIKNYFDNTIKTPDDIENR-NINVLAWI
A0A2E0W055      QARRATKPSKPNRMLIVLVGIVLGTGMGLGFAFVRNYFDSTVKTPEDIQNK-NINLLTWI
A0A2N1VVT2      EAIQPSSPSAPNRMRIILTGFIFSLVVGFSFAFIRHYLDNTVNTPEDIQKN-RLNVLTWI
A0A3N5Q7G8      NARKPSNPSKPNRVLIIIIGLILASGLAFGYVLIKNYFDNTVKTPEDLQSR-NIPVLGWV
A0A1G0P4D7      NARRPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVKTPEDLQKR-NISVLAWI
A0A1G0QKB6      NARRPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVKTPEDLQKR-NISVLAWI
A0A1G0V7G7      NARRPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVKTPEDLQKR-NISVLAWI
A0A1G0XBL4      NARIPSGPSKPNRHLLILIGVLMGFGLGFGFVLVKDYFDNTIKTPEDIEKQ-NVNVLAWI
A0A3D6BED1      DARVPYSPAKPNRALIIIVGLLIGAGLAFAYVFLKNYFDNTVKTPEDLQKR-NINVLAWL
A0A2H0FVC7      PAIRPLLPSKPNRKLIVLIGLILGMGIGFAFAFIKDFLDNTVKTPEDIQKK-NINVLGWI
I6ZVA1          PAIVPTIPSKPNRLLIVFAGLVIGVGLGLGFAFLRHNFDNTIKTPEDIQNR-NINILAWI
A0A2H0DC71      VARRPDKPSKPNRLLIVLVGTILGLGFGLGYAFLRNYFDNTVKTPEDLKDR-NINVIGWV
A0A2M7MN42      VARRPDKPSKPNRLLIVLVGTILGLGFGLGYAFLRNYFDNTVKTPEDLKDR-NINVIGWV
A0A1V5TPD0      YPSSPFKPVLPKKLFTLIIAVFLGGFVGIVIIFIGELSKTRLISLDDLENEFNMPILALI
I0AMF0          EAKIPTDPSWPKKSFIVLISLVLGSFLGILLIFTIELKKTKYVNLDELEEEFKIPILSLI
                    .  *  *..    . . . .  ..          ..   . ::::      ::  :

A0A2G6EB58      PKVVS-----IDSENRQRGEGFIISNKADSVASEAFKAIRTRIRYSMVEGEA--KRILIT
A0A1G0X4V9      PKISH-----EESVGLKNP-ELIVAQKPDSLSSEAFRTIRTRLQFSHISKGA--KLILIT
A0A3A0BB82      PSIDI-----KEKSDLSSPDEFIVASDAKSSISEAFKVLRTRVQYAKIEEEP-LKTILIT
A0A2G6EAS5      PRFER-----KVSSEGDDS-EIFMSSKNEIAASEAYRAMRTRIQFSKLSEGT--KAILIT
A0A1G0P817      PRT---------KRNISDP-ELIVFNNSDFPTIESFRALRTRIQFSKNKSE--VKVLLIT
A0A1G0QLK5      PRT---------KRNISDP-ELIVFNNSDFPTIESFRALRTRIQFSKNKSE--VKVLLIT
A0A2N1VFP3      PQIEG-----M-EGGNKDF-EFIVAKKPDASASEAYRALRTRIKFSKIDKDS-LKTILVT
A0A1G0VGZ5      PQIEG-----L-ESGIKDF-EFVVARKPDASASEAYRALRTRIKFSKLDKES-LKVLLVT
A0A1G1B9H5      PQIEG-----L-ESGIKDF-EFVVARKPDASASEAYRALRTRIKFSKLDKES-LKVLLVT
A0A419H3A3      PQIEG-----L-ESGIKDF-EFVVARKPDASASEAYRALRTRIKFSKLDKES-LKVLLVT
A0A2M7ZEP7      PQIDI-----L--EENKDF-EFIVAKKPDSLHAEAYRALRTRIQFSKLDQKRGIQTLLVT
A0A419EVC1      PTIEG-----LGQNGNSDY-EFIVAKKPDSIPSEAYRALRTRVQFSKLEKDA-IKSVLIT
A0A2E0W055      PEIEG-----VGSEDHKEF-EFIVAKRPDSIPSEAFRALRTRIQFSKIRPDA-LKTILVT
A0A2N1VVT2      PKMEQ-----LATKD--EF-QFIVHSKPDSIYSESFRALRTRITFSKIQESP-VQTILIT
A0A3N5Q7G8      PQFEI-----EGRNGMTGN-EFVVSSKPDSMAGESFRTIRTRIQLTKLDKDS-LKTILIT
A0A1G0P4D7      PQFEG-----ASKNGTQDY-EFIVAKKPDSMASEAFRALRTRIQLLRFDKDS-LKTFLVT
A0A1G0QKB6      PQFEG-----ASKNGTQDY-EFIVAKKPDSMASEAFRALRTRIQLLRFDKDS-LKTFLVT
A0A1G0V7G7      PQFEG-----ASKNGTQDY-EFIVAKKPDSMASEAFRALRTRIQLLRFDKDS-LKTFLVT
A0A1G0XBL4      PKVEE-----LNGKSKNGN-DFIIEKNPSSIPSETIRGLRTRVQFSKVDKDK-LKTILVT
A0A3D6BED1      PRVDE-----LLLKESSKV-DFIILNKPDSVTSESFRALRTRIQFSRPDKET-LKTIVVT
A0A2H0FVC7      PKIEG-----ITL--NKEF-EFIIAKKSDSIYSEAFRALRTKIQFAKIDKKS-INTIHVT
I6ZVA1          PHIEG-----IET--NPEL-EFIVSKKPDASASEAYRALRTRIKFSKIDKDS-LRTILVT
A0A2H0DC71      PKIQS-----LDKSISKDL-EFIIYNKPDSVPSEAFRALRTRVQFSKVDQGN-MKVIHVT
A0A2M7MN42      PQIQS-----LDKSISEDL-EFIIYNKPDSVPSEAFRALRTRVQFSKVDQGN-MKVIHIT
A0A1V5TPD0      PIFDKSIRNKMKKSNDKKD-QFVMLQTDNSGISESYRLLNTKL--SHLDLKD--KTIMVT
I0AMF0          PRLPKEIVKVVD--NNPEH-KVALLTVQDDGLRETYRVLKTKL-FQNLNPET--KLLMVT
                *                    . :    .    *: . :.*.:           . . :*

A0A2G6EB58      SSTPGEGKSTMAVNLAGSFAIANKKTVIIDCDLRKPRIHGIFNE-KRFPGFTDYFIGRAT
A0A1G0X4V9      SSAPGEGKTTISTNLAASFAQANKRSVIIDCDLRKPRLYSLFGG-NDSNGFLDYLFGNVQ
A0A3A0BB82      STIPGEGKTTVAINLAGSFALDGKNVLLIDCDLRKPRVHSVMGV-NRYPGLTDLLFGNND
A0A2G6EAS5      SSAPQEGKTTVTVNLAAGFAQTNKKVIILDCDLRIPRIHSVFKG-KSSPGFTNFLFGQVS
A0A1G0P817      SSAPGDGKTMVSTNIASSFARDDKRTIIVDCDLRKPRLHSIMGE-SISPGLSDYLFGRTN
A0A1G0QLK5      SSAPGDGKTMVSTNIASSFARDDKRTIIVDCDLRKPRLHSIMGE-SISPGLSDYLFGRTN
A0A2N1VFP3      SPTSQEGKTTTSINLAGSFAQANFRTIIIDADLRKPRIHSVFNQ-KRFPGFTDYFFGQAT
A0A1G0VGZ5      SPTSGEGKTTTTVNLAGSFAQANFKTIILDADLRKPRVHTVFNQ-KRFPGFTDYFFGQAT
A0A1G1B9H5      SPTSGEGKTTTTVNLAGSFAQANFKTIILDADLRKPRVHTVFNQ-KRFPGFTDYFFGQAT
A0A419H3A3      SPTSGEGKTTTTVNLAGSFAQANFKTIILDADLRKPRVHTVFNQ-KRFPGFTDYFFGQAT
A0A2M7ZEP7      SSAPREGKTTTAVNIAGTFAQANKRTVIVDCDLRKPRMHTVFKA-QRFPGFSDYFFGQST
A0A419EVC1      SSTPQEGKTITAVNLAGSFAQANKKTLLLDCDLRKPRLHAVFKN-NRYPGFTDYFFGQAT
A0A2E0W055      SSTPKEGKTTVSVNLAGSFAYTNKRTVVVDCDLRKPRMHNVFKA-QRFPGFTDYFFGQAE
A0A2N1VVT2      SSAPREGKTTVAVNLSGSFAQANKKTIVVDCDLRKPRIHNVFQA-QRFPGFSDYFFGQAP
A0A3N5Q7G8      SSAPQEGKTVVGINLGGSFAQSNRRTLIIDCDLRKPRVHEIFRD-KRVPGLIDYLFGQAQ
A0A1G0P4D7      SSAPQEGKTLIAINLAGSFAQSGRRTVIIDCDLRKPRVQELFNA-KRIPGLIDYLFGHLS
A0A1G0QKB6      SSAPQEGKTLIAINLAGSFAQSGRRTVIIDCDLRKPRVQELFNA-KRIPGLIDYLFGHLS
A0A1G0V7G7      SSAPQEGKTLIAINLAGSFAQSGRRTVIIDCDLRKPRVQELFNA-KRIPGLIDYLFGHLS
A0A1G0XBL4      SPAPLEGKTTIALNLAGSFAQGNRKTLLIDADLRKPRLHQVFNK-EKQPGLVDYLFGEVP
A0A3D6BED1      SPAPQEGKTFVTINLAGSFAQANKKVLLVDCDLRKPRVHRVFDI-AKEPGLIDYLVGDKT
A0A2H0FVC7      SSTPSEGKTTVSVNIAGSFAQTNRKTVIVDCDLRKPRMHKVFAS-QRFPGFTDYFLGEAT
I6ZVA1          SPRSQEGKTTTAVNLAGSLAYANNKTIIIDADLRKPRLHNVFGH-KRYPGFTDYFFGQVG
A0A2H0DC71      SSTPGEGKSLISSNLAGSFAQANHKTLLLDCDLRKPRVHTIFGM-NRQPGLVEYLFDQVN
A0A2M7MN42      SSTPGEGKTLISSNLAGSFAQANHKTLLLDCDLRKPRVHTIFGM-NRQPGLVEYLFDQVN
A0A1V5TPD0      SCEENTGKTTIVANLAITLALNNKNVLIIDCDLRKGELSRRFNVFHNSSGLIDFLEKGSS
I0AMF0          SCEEDSGKTTVVANLAASLAQEGKRVLLIDCDLRKGDLSGLFGLGKETKGLLDYLLNDSP
                *     **:    *:.  :*  . . :::*.***   :   :       *: : :     

A0A2G6EB58      LEEIKRKT-STENLTIITAGTIPPNPSEILDSKGMAALLEKL-ASDFDIVIIDSPPVLTV
A0A1G0X4V9      YDKIIKKS-EVRNLDFVTAGSIPPNPSEILGSPAMKSFLDKL-KNDYDIIIIDSPPIMAV
A0A3A0BB82      LSEVIRPT-KFDNMHFIPSGTIPPNPSELLGSLQMKKTLENL-KTQYDIIVLDSPPSISV
A0A2G6EAS5      FDEIVRKSNEVDNLYYIAAGTIPSNPSEILGSKQLEDFLKKL-KSEFDLVILDAPPVMTI
A0A1G0P817      KEGIIRNS-NLAKLDYITAGTIQNNSSEVLNSIKMVTLLQKL-REDYDVVIIDSAPILAV
A0A1G0QLK5      KEGIIRNS-NLAKLDYITAGTIQNNSSEVLNSIKMVTLLQKL-REDYDVVIIDSAPILAV
A0A2N1VFP3      FEEIVRKS-EVNNLDFITAGTIPPNPSEILGSSQMESFFEKL-KNEYDYIIVDSPPVIAV
A0A1G0VGZ5      FEEVVRKT-ELNNLDYITAGTIPPNPSEILSSTQMEAFIEKL-KTMYDYILIDSPPVIAV
A0A1G1B9H5      FEEVVRKT-ELNNLDYITAGTIPPNPSEILSSTQMEAFIEKL-KTMYDYILIDSPPVIAV
A0A419H3A3      FEEVVRKT-ELNNLDYITAGTIPPNPSEILSSTQMEAFIEKL-KTMYDYILIDSPPVIAV
A0A2M7ZEP7      YEEIIHKS-ELPNLFYITAGTIPPNPSELLSSDQMVAFLEKL-KSEFDMIVIDSPPIVAV
A0A419EVC1      YSEIIRPS-GTNNLYIITAGTIPPNPSELLGSHQMLEFMEKL-RREFDIIIIDSAPVIAV
A0A2E0W055      YEEIVRTS-EIENLDFITAGTIPPNPSEILGSPQMEKFLEKL-KSLYDVVILDSPPVIAV
A0A2N1VVT2      FEDIIHAS-DVPNLFYITSGTIPPNPSEILASSQMEAFLEKL-RGEYDIIILDSPPIIAV
A0A3N5Q7G8      LKDIIHKA-DINNLEYITCGTIPPNPAEMLESEKMREFLADM-REKYDIVILDSPPIIAV
A0A1G0P4D7      LNEVTHKA-EIDNLDYITCGTIPPNPAEMLESEPMKRFLTEM-REKYDIVILDSPPIIAV
A0A1G0QKB6      LNEVTHKA-EIDNLDYITCGTIPPNPAEMLESEPMKRFLTEM-REKYDIVILDSPPIIAV
A0A1G0V7G7      LNEVTHKA-EIDNLDYITCGTIPPNPAEMLESEPMKRFLTEM-REKYDIVILDSPPIIAV
A0A1G0XBL4      FEKVLTVT-NTKNLFLITSGMIAPNPAEMLDSVQMENLLAKV-RTEFDYVVIDSSPIVAV
A0A3D6BED1      LEEITHTG-EMPNLSFISSGTIPPNPAEMLDSRQMDEFLALV-RGMYDYIIIDSPPIIAV
A0A2H0FVC7      FESIVHKS-ELPNLDFITAGTIPPNPSEILGSQQMLAFIDKL-KVIYDLVVIDSPPIIAV
I6ZVA1          YEEIIRTT-DVNNLSYISAGTIPPNPSEILGSDQMINFIKKL-KGEYDYVVIDSPPLIAV
A0A2H0DC71      LATIIKPT-KLANLDVITVGTIPPNPAEMLGSKKMQDFITHM-KTLYDYIIIDSPPIISV
A0A2M7MN42      LATIIKPT-KLANLDVITVGTIPPNPAEMLGSKKMQDFITHM-KTLYDYIIIDSPPIISV
A0A1V5TPD0      PVIYTKLL---KKINILPSGGINENSSILLSSDRMKSLFEKIDTSAYNYVIIDTPPVTRV
I0AMF0          PKIYTRAS---KNIDIIPSGGLSSDSGTLLDSARMRLLFRSLDTTQYDLIIVDTPPVTRV
                            ::  :. * :  :.. :* *  :   :  :    :: :::*:.*   :

A0A2G6EB58      TDAEILSRIVDETILVVSANTTDVDMMTKAVSLLKSGDKNSFVGAILNRFEVQNSYGSYY
A0A1G0X4V9      SDAEILARFVDICLLVVSANSSEVDWLKESVSLLRH-DNVNLAGVLLNNFNYKSGYHSYY
A0A3A0BB82      TDSEILFKITDGTLLVVQSLKTPMDAFSKVYDRFNSFSEPNLLGTVLNNFSYKRNYGYYY
A0A2G6EAS5      TDAEILSHIVDITLLVVFANKTEVDWVTESAQILNRGEESSFVGAILNNFDYNTGYRSYH
A0A1G0P817      ADTELLSNFVDASILVVSANNTEMEWAKQSISLLSH-GQSAFLGIVLNNYDYKFGYPSNY
A0A1G0QLK5      ADTELLSNFVDASILVVSANNTEMEWAKQSISLLSH-GQSAFLGIVLNNYDYKFGYPSNY
A0A2N1VFP3      TDSEILSSMVDGTVLVVSANNTEMELMEKAVQLINH-ERSSFLGVILNNFTYRSGYGSYY
A0A1G0VGZ5      TDSEILSSIVDATVLVVSANNTEMELMEKAVELLNH-EQGSFIGIILNNFTYRSGYGSYY
A0A1G1B9H5      TDSEILSSIVDATVLVVSANNTEMELMEKAVELLNH-EQGSFIGIILNNFTYRSGYGSYY
A0A419H3A3      TDSEILSSIVDATVLVVSANNTEMELMEKAVELLNH-EQGSFIGIILNNFTYRSGYGSYY
A0A2M7ZEP7      TDSEIISRLVDAAILVVSANNTEIELMRKAAELLTH-ESKSFIGAILNNFSYKSGYGSYY
A0A419EVC1      TDSEIISRIVDATILVVSSNITEVDVMEKSVNLLKH-EQKTFIGVLLNNFTFRSSYGSYY
A0A2E0W055      TDSEILSRMVDATVLVASANITENDLLEKSVELLTH-DHGSFIGVVLNRFMYRSGYGSYY
A0A2N1VVT2      TDSEILSRLVDATILVVSAHTTEVELMRKSAELLDH-EQNTFIGVLLNNFSYKSGYGSYY
A0A3N5Q7G8      TDSEILSTMVDGTILIISADTTEVELMERSVELMKN-DKSSFIGAILNNFSYKSGYGSYY
A0A1G0P4D7      TDSEILATMVDGTVLVVSADTTEFDLMEKAVEIMKK-DKLTFLGTVLNNFSYKSGYGSYY
A0A1G0QKB6      TDSEILATMVDGTVLVVSADTTEFDLMEKAVEIMKK-DKLTFLGTVLNNFSYKSGYGSYY
A0A1G0V7G7      TDSEILATMVDGTVLVVSADTTEFDLMEKAVEIMKK-DKLTFLGTVLNNFSYKSGYGSYY
A0A1G0XBL4      TDAEILARKVDGSILVVSSNKTEKDLLNLAVQLIKN-DSSYLIGTVLNRFSSKSGYGSYY
A0A3D6BED1      TDAEILSKKVDGAVLVVSSEITEYQMMERAYQLIKH-DNTTLIGTVLNNFDTRSAYGTYY
A0A2H0FVC7      TDSEILSRIADASILVASAGETDIELMTKAVDLMRH-ENKSFIGVVLNKFSYRSGYGSYY
I6ZVA1          TDSEILAQLVDATILVVSANFTETDLLEKSVEILRR-DNSTFIGTVLNNFNYRSGYSSYY
A0A2H0DC71      TDSEIIAAYCDAVYLVVSANYTEFDLLEKALDILKN-SNVNFVGTILNNFVFKNSYGSYY
A0A2M7MN42      TDSEIIAAYCDAVYLVVSANYTEFDLLEKALDILKN-SNVNFVGTILNNFVFKNSYGSYY
A0A1V5TPD0      VDTLILGQYVTNAILVVRPDISMKDSVIGGIQDMNQ-AQIKILGIVANATEIQSSYRYRY
I0AMF0          VDPLVLSHSLHNAIVVVRPEHSLLETVRWGISELLN-AKINVKGLVINAADIENSYYYKH
                 *. ::        ::  .  :  :      . :       . * : *       *   :

A0A2G6EB58      RYAY--TYARGGVEGKREKVRIKKKKQNKSK--------
A0A1G0X4V9      KYYD--HYTEKYKNT--KKKGKLNKPA------------
A0A3A0BB82      NYYY--YYSSGEKPN------------------------
A0A2G6EAS5      KYNSNKYYRRADES---RSKEWVKS--------------
A0A1G0P817      KYYN--YYYSSDSTDKKKPSKKIKTNI------------
A0A1G0QLK5      KYYN--YYYSSDSTDKKKPSKKIKTNI------------
A0A2N1VFP3      KYYY--YYSRPTNG---AKKGRVKV--------------
A0A1G0VGZ5      KYYY--YYSRPKDGS--SKKNKLKV--------------
A0A1G1B9H5      KYYY--YYSRPKDGS--SKKNKLKV--------------
A0A419H3A3      KYYY--YYSRPKDGS--SKKNKLKV--------------
A0A2M7ZEP7      KYYY--YYSHQSKGNGVAKVKKIDKV-------------
A0A419EVC1      KYYY--YYSRPNENGR-KKSKKLDSV-------------
A0A2E0W055      KYYY--YYSRPDQKNK-KPKAELKS--------------
A0A2N1VVT2      KYYY--YYSQGGNGAA-K-KNRIKA--------------
A0A3N5Q7G8      KYYY--YYSENPPGGK-NKSKV-----------------
A0A1G0P4D7      KYYY--YYSENSEGKK-SRSSKRKA--------------
A0A1G0QKB6      KYYY--YYSENSEGKK-SRSSKRKA--------------
A0A1G0V7G7      KYYY--YYSENSEGKK-SRSSKRKA--------------
A0A1G0XBL4      KYYY--YYSSDGKKKS-TKKKHSKT--------------
A0A3D6BED1      KYKY--YYYYASKK-------------------------
A0A2H0FVC7      KYYY--YYSHNRDN---SKVKHKTTV-------------
I6ZVA1          KYYY--YYSSPTNG---SKKNRVKAN-------------
A0A2H0DC71      KYYY--YYYNREKE---GTRSKKTT--------------
A0A2M7MN42      KYYY--YYYNREKE---GTRSKKTT--------------
A0A1V5TPD0      SYGYGYGYGNSPKDKNGKHG--VKKLSSIVRKHSKVNSS
I0AMF0          RYGYGYGYGSKNGNGKAKDAKKIKPEFQLKFKDQITHKN
                 *     *                               

© 1998-2019