BYKdb

Dataset for cluster tadcd of phylum kiritimatiellaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2E0R8R5      MEHVDMQANESSQKTPSLEDEGIDLVELFGVLFARKILIISITLIFAIGALLYVIFATPI
A0A2E3TL68      -----------MIEENNENKNNPHFLDYWRVLRSRKELILAITFIVVLTGTIYTLLLPNV
A0A2E1U4L9      -----------MNNEANQQPSSLHFLDYWRVISSRKELILAVAFLVVLTGTVYTLLLPNI
A0A1Z9TC99      -----------MNDQSDQQSNSLHFLDYWRVISSRKELVLAVAFLVVLTGTVYTLLLPNI
A0A2E1U172      -----------MNDQSEQQGSTLHFLDYWRVISSRKELVLAVAFLVVLTGTVYTLLLPNI
A0A0G3EFP6      ------MDQPNPNQQQKDSDGGLHFLDYWRVIRARKEIILAVALLVVLVGTAYTFTLPRI
A0A2E0R7L7      -----------MNNKADQETSSVHFLDYWRVISSRKELILAIAFLVVLTGTVYTXLLPSI
                             .  . .     ::: : *: :** ::::::::..: .  *.   . :

A0A2E0R8R5      YKATAMVQVEESGPSMPGFDDMAGMFEETSKSV--TEIELLKSRRVIGEAVDALKLDIVA
A0A2E3TL68      FSSSSRISVSEDKPEINPFQAELMY-ERYDPYYLKTQFEILQSKPILNEVIYRLNLQE--
A0A2E1U4L9      YASSSRILVSEDSPEINPFAVQQNYMSTYNPYFLRTQFEILTSKPILNEVIYRLNLQS--
A0A1Z9TC99      YAASSRISVSEDMPEINPFAVQQNYMTSYNPYFLKTQFEILTSKPILNEVINRLNLQV--
A0A2E1U172      YASSARISVSEDSPEINPFAVQQNYMTPYNPYFLKTQFEILTSKPILNEVINRLSLQV--
A0A0G3EFP6      YRSTATIKVNNEGTDVDVFRNEGGR-SLYNPYFLRTQQRIISSRPVLYEVIERLNLRK--
A0A2E0R7L7      YASSSRIMVSEDTPEINPFASQQNY-MMYNPYFLRTQFEILTSKPILNEVIHRLNLQN--
                : ::: : *.:. ..:  *          .     *:  :: *. :: *.:  *.*    

A0A2E0R8R5      KPNLFPAVGGKFYRDHKPATDGALASAKLGAITYAWGGEQIEVFRLELPGYLMNEPLTLR
A0A2E3TL68      ----------------------------------KWGKD----------G-SLSREVAYK
A0A2E1U4L9      ----------------------------------EWGKN----------NEILKRDIALK
A0A1Z9TC99      ----------------------------------EWGQD----------GQTLSRDVALK
A0A2E1U172      ----------------------------------EWGKN----------GETLSRDVALK
A0A0G3EFP6      ----------------------------------VWGNE----------DRKIPEDVALN
A0A2E0R7L7      ----------------------------------EWGKD----------GKVLTRDVALK
                                                   ** :          .  :   :: .

A0A2E0R8R5      VEENNQITLQHKKSILLQGTVGQDLVANGVALSVRDLSARPGTEFTLMRQDRFQTILKLQ
A0A2E3TL68      ILKNSLSIFQQ-------------------------------------------------
A0A2E1U4L9      ILKNSISVFQQ-------------------------------------------------
A0A1Z9TC99      ILKNSVSVFQQ-------------------------------------------------
A0A2E1U172      ILKNSVSVFQQ-------------------------------------------------
A0A0G3EFP6      ILRRSINLSAA-------------------------------------------------
A0A2E0R7L7      ILRNSVSVFQQ-------------------------------------------------
                :  ..                                                       

A0A2E0R8R5      QGIGASEKGKDSGIILLSYQSENPQLAKEILDQIAEIYVRQNVERNSAEAQKSLDFLKVQ
A0A2E3TL68      ---------RDTSLIVINVKRNNPNEAAEIANEIAQVYRDSRIELVTKNTRNALDKIDES
A0A2E1U4L9      ---------RDTSLIVINVKRDNPDEAADIANEIAQVYRDSRLELASKSAREAIDKIEES
A0A1Z9TC99      ---------RDTSLIVINVKRDNPDEAADIANEIAEVYRDSRLDLASRDARIAIDKIEES
A0A2E1U172      ---------RDTSLIVINVKRDNPNEAADIANEIAEVYRDSRLDLASKDARTAIDKIEES
A0A0G3EFP6      ---------PDTSLISIIAEREKPEEAARIANQVAEVYRDMRRDVKRKEMRNAIEELRTQ
A0A2E0R7L7      ---------RDTSLIVINVKRDNPNEAADIANEIAQVYRDSRLDLASKNARGAIDKIEES
                          *:.:* :  : ::*: *  * :::*::*   . :    . . ::: :  .

A0A2E0R8R5      LPEVKKQLEEAE-------------------QKFNDYQIRQKSVDIS--------LETQG
A0A2E3TL68      ISQQRIRVDEAEENIQKIREELDIAVVGGE-GQFDVGEVRMQTLERDRLAAQREMVEKKG
A0A2E1U4L9      LTEQRQRVANAEENIQKIREDLNIAVVGGE-GQFDVGEVRMQQLEGDRLFAQREMVEKEG
A0A1Z9TC99      LSEQRQRVADAEENIQQIREDLNIAVVGGE-GQFDVGEVRMQQLEGDRLFAQREMVEKEG
A0A2E1U172      LSEQRQRVADAEENIQQIREDLNIAVVGGE-GQFDVGEVRMQQLEGDRLFAQREMVEKEG
A0A0G3EFP6      LQKQQTKVDEAEQEMERIRQELDVTFVGNEQSGVSVDKMRLQQLEGDRIQARVEMLVRKA
A0A2E0R7L7      LTEQRQRVASAEENIQKIREDLNIAVVGGE-GQFDVGEVRMQQLEGDRLFAQREMVEKEG
                : : . .: .**                     ..  ::* : :: .        :  :.

A0A2E0R8R5      VLEQIVELETK---------------------LQELELRRLEMSRRFKREHPLYQGVVEQ
A0A2E3TL68      LLDILNNIGDEDLAEQASFITFDQFVVDIVRSMELLEVELSALDADFGKNHPEVKRLVFQ
A0A2E1U4L9      LLRILEDLNDKDLLERASYITFDQFVMNTIQQIQDIEVNLSSVQADYGDNHPEVKRLKSQ
A0A1Z9TC99      LLKILENLDDKDLLEQASYITFDQSVMNTIQQIQDVEVQLSSVQEDYGDNHPEVKRLKSQ
A0A2E1U172      LLKILENLNDKDLLERASYITFDQSVMNTIQQIQDVEVQLSSVQADYGDNHPEVKRLKSQ
A0A0G3EFP6      RFEQMQALEGPELLNASEYVVKDPNLSDLRKQILDTDVSLSLMSENYGQNHPEVKRLRAA
A0A2E0R7L7      LLRILEDLNDKDLLERASYITFDQFVMNTIQQIQDIEVNLSSVQADYGNNHPEVKRLRSQ
                 :  :  :                        :   ::    :.  :  :**  : :   

A0A2E0R8R5      IKLVKEQ--------------------------KDVLTTRVTDLPETQQELLRYTR----
A0A2E3TL68      KNSLEKNLKQRLDALRNGLQTEYSIAKSKFDGLDQVLKSVRSDSIETQGAKYRPYRNALA
A0A2E1U4L9      IVTLEETLKKRLSALRNGLDTEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRNALA
A0A1Z9TC99      IITLEGTLKKRLNGLRNGLETEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRNALA
A0A2E1U172      IATLEGTLTRRLNGLRNGLETEYVIAKNNFESLDKVLASVRTDTIESQGTKFRPYRNALA
A0A0G3EFP6      REELMGKLEEALDGLIKGLKADYEVARANYEALEKELAGIREEERQTQRESLLPFNKARR
A0A2E0R7L7      IVTLEETLKKRLTALRNGLDTEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRNALA
                   :                             .. *     :  ::*       .    

A0A2E0R8R5      DVQVSSEIYTMLLGKAQELDIMRAGTVGNVRIVDHAAVDLQHPIKPRKSLLVVLITLLGF
A0A2E3TL68      DLETERFIYNQLLAKHRQEIITMQLPRNPVNIIDVAEANLR-PVSPNLFINVLISIFAGL
A0A2E1U4L9      DLETERFIYNQLMSKHRQEIITLQVPQNPVDIIDVAEPNMQ-PVSPNLFLNVLLSIFVGL
A0A1Z9TC99      DLETERFIYNQLMSKHRQEIITLQVPRNPVDVIDIAEPNMR-PVSPNLFLNVLLSIFVGL
A0A2E1U172      DLETERFIYNQLMSKHRQEIITLQVPRNPVDVIDIAEPNAR-PVSPNLFLNVLLSIFVGL
A0A0G3EFP6      NLEIQRSILDALKARVTQEGITLEIPRTAVEVIEPAEPGSS-PVSPNLFLNVLMSVFLGL
A0A2E0R7L7      DLETERFIYNQLMAKHRQEIITLQIPRNPVDIIDVAEPNMQ-PVSPNLFLNVLMSIFVGL
                ::: .  *   * ..  :  *    .   * ::: *  .   *:.*.  : *::  : *:

A0A2E0R8R5      GLACAYVLIVRAIHRGLEDPSEVEA-IGMPVYATIPQSDKLLKNSKSKADKGKRTSRDLL
A0A2E3TL68      GAGIGLAYFIEYLDTSVKTVEDVENKLKLKVLGLVPQKVRPLIE----------------
A0A2E1U4L9      GAGVGLAYFIEYLDTSVKSADDLENQLKLKVLGLVPQKVRPLIE----------------
A0A1Z9TC99      GAGVGLAYFIEYLDRSIKSADDIENLLKLKVLGLVPQKVRPLIE----------------
A0A2E1U172      GAGVGLAYFIEYLDRSIKSADDIENQLKLKVLGLVPQKVRPLIE----------------
A0A0G3EFP6      GAGVGLAYFIEYLDTSIKTADDVERYLSLPVLGLVPQKVRPMIE----------------
A0A2E0R7L7      GAGVGLAYFIEYLDTSVKNADDIENQLQLKVLGLVPQKVRPLIE----------------
                * . . . ::  :  .::  .::*  : : * . :**. . : :                

A0A2E0R8R5      AVDHPTDLSVEALRGLRTSLHFAMLDAKNNVIVISGPSPGIGKSFVSTNLGAVIAQGGKK
A0A2E3TL68      --EGPDSENAESYRVLKTNLDFSSNHEVGGAYSVISAGAGEGKSTTVFNLAYVAAQQGMK
A0A2E1U4L9      --EGPDSENAESYRVMKTNLSFIANENEGMAHCVLSSGAGEGKSTTVFNLAYVAAQQGVK
A0A1Z9TC99      --EGPDSENAESYRVMKTNLQFTNEQEEGLAHCVLSSGAGEGKSTTVFNLAYVAAQQGQR
A0A2E1U172      --EGPDSENAESYRVMKTNLAFMSDSDEGVAHCVLSSGAGEGKSTTIFNLAYVAAQQGQR
A0A0G3EFP6      --EGPDSEHAEAYRVLRTNLTFTNEGQTKGTFLCTSGGAGEGKSTTIFNLAYICAQRGEK
A0A2E0R7L7      --EGPDSENAESYRVMKTNLSFTAKENVGMAYCVLSSGAGEGKSTTVFNLAYVAAQQGSK
                  : * .  .*: * :.*.* *        .    . ..* *** .  **. : ** * .

A0A2E0R8R5      VLLIDGDMRRGDLQDHLGMSFDAGLTGYLSGQYALEEVVRTTVVEGLDIIPRGIVAPNPS
A0A2E3TL68      VLLMDADLRRPVQHIILGMSNRFGLTNVLLRDVPAEEAIKATSIPNLQFLPSGRLPRASL
A0A2E1U4L9      VLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAIKATSIPNLQFLPSGRLPRASL
A0A1Z9TC99      VLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAIKATSVPNLQFLPSGRLPRASL
A0A2E1U172      VLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAIKATSVPNLQFLPSGRLPRASL
A0A0G3EFP6      VLLIDSDLRRPVQHRILDTDNRFGLTNVLLRDVPVEETIKPTSVPNLHFLPSGRLPRTSL
A0A2E0R7L7      VLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAVKATSIPNLQFLPSGRLPRASL
                ***:*.*:**   :  *. .   ***. *  : . **.:..* : .* ::* * :.  . 

A0A2E0R8R5      ELLMHPRFSELINYASENYDLVIVDTPPVLAVTDPVIIASHAGATLLVARYGITHKKELE
A0A2E3TL68      GVLDPKKIRELINSLKSKYDLVLIDTPPVVGLSDASIIGKETDGSILVVQYRKYPLDMIN
A0A2E1U4L9      GVLDPRKIRELVQSLKSKYDLVFIDTPPIVGMSDANIIAKEVDSSILVVQYRKYPLNMIR
A0A1Z9TC99      GVLDPKKIRELIQSLKMKYDLVFIDTPPVVGISDSSIIAKEADSSILVIQYRKYPIDMLR
A0A2E1U172      GVLDPKKIRELIQSLKLKYDLVLIDTPPVVGISDSSIIAKEVDSSVLVIQYRKYPIDMLR
A0A0G3EFP6      GLLESQRMKELIHNLRSKFDVIFLDSPPVIGISDASILASAVDRVIMVCQYRKYPRDMAM
A0A2E0R7L7      GVLDPKKISELVNSLKSKYDIVLIDTPPIVGISDANIIAKEVDSSILVVQYRKYPLNMLR
                 :*   .: **::    ::*::::*:**::.::*. *:.. ..  ::* .*     .   

A0A2E0R8R5      ISQQRFEQNGVSVQGIVFNAVQKRGGK----YGSYGYNNYEYGNE------------
A0A2E3TL68      KAKLSLIAQDIDITGVVMNNINITRDDYYYYYHTYYSDYYGSSDEETQEGSI-----
A0A2E1U4L9      KAVETLQAQSIDIAGAVLNNINVMRDDYYYYYQSYYSDYYQR-DDDDAEADLI----
A0A1Z9TC99      KALASLQAQSINISGAVLNNINVMRDDYYYYYHSYYSDYYQQSDEDNTEVQTV----
A0A2E1U172      KALASLQAQSINVAGAVLNNINVMRDDYYYYYHSYYSDYYQQNDDDQAEAKTI----
A0A0G3EFP6      RAKQLLESSNARVSGVVLNNINVMRDDYYYYYHSYYYNYYYYRSGESAPQETETAEG
A0A2E0R7L7      KAVSTLQAQSIEIAGAVLNNINVMHDDYYYYYHGYYSDYYHRDDDEAEADLI-----
                 :   :  ..  : * *:* ::   ..    *  *  : *   .             

© 1998-2019