BYKdb

Dataset for cluster orphancd of phylum lentisphaerae

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      MNQMVESQEKSNSLE--------DFFCLTNILDTTLRYWKIWVFAAFFGLAFSFIVTKYF
A0A1G1AKK0      MSTESEQ----------------RGIDFRVYIGIIFFRWQIIAVCFLYCLLGGVLYL-SL
A0A1V6FKM9      -----------------------MRLLLGYYNTYVRQYFWLYPTAILLFAAAAFIYL-RT
A6DFD0          MNQQINENEFS------------QDIEFLQYLKVLLHYWWIISPISLIGAGAMMAYS-MT
A6DSE4          MKQNHSDEIEK-------------EIDLLSYFLVVLRYWWIIAPITALGGVAAYFLA-QA
A0A1G1C9Z9      MTNNPNTDTVAVQGDWSAGAAGGDGEGLLTYIRPLLMYWWIIAPLAIVGGAGALAYS-YT
A0A348XG41      MEQKRNGVSLV---------------DLQSYLAMGLRHFRLMVLLMCLALAAGLAYY-IF
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      TPPVFMAKTTIYAGITNKASIQDGSEKEISISQYSQSIMMNSLLVNDYKMLLVSDRVQDK
A0A1G1AKK0      APKEYLASSKVMVYRDPLLEMSGN------------IAGAERTSLTMHTFLLQDDKFRER
A0A1V6FKM9      QVPLYRSTCQLHV-SNADLRVTELRGIVDPY------NAAGASFINTQIRLMQSPEI---
A6DFD0          LPKKYRAECRFEIFENQAIQVAER----------IKDDYWEEDPMEKHMLMLRSSKLNTP
A6DSE4          LPPKFEADCRFEIIQNKVSQLSED--VDDKALNAV--KSRKYSLLDRHIVLLKSEKLNKS
A0A1G1C9Z9      LQPLYRASCRFEIFENEMMRIGEQPGLRDAAFYYM-----NANPIDRHVVLLTSGNLDAR
A0A348XG41      KRPVFHARSLVQV-EYEHRPFTDDDLWSDAEMEYVLRQLNSPHILERALAEFGIEASYST
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      VREKMAEKFPS----------------------------PEGKAPWFSVDAQYHRNTRII
A0A1G1AKK0      AARQLAEKWGD-------KMGNFQKMILPVTVARERGFGSMLNISVKSADPGYGVEFLKV
A0A1V6FKM9      ----LNRAYELTGGLEGDSSKCSEPEIAQV--PNT----TLVNLSITSPYPEAAAKLANT
A6DFD0          IRNSVLEKFPKLKQINLTS---FQLNLNPVKGAQY----DLIDISVDSHNKEASLEYLKQ
A6DSE4          VEKVILNNFPDLRELKLLKKKIFEVEITPVKGAAQ----SMLDISIVSPDVSASKEYLLK
A0A1G1C9Z9      VRTRLAKTWPG----EVKMSRPVLLSVVPVKKAPQ----VMVDISADSYDARYSEAYVTA
A0A348XG41      IRSKYIKQMRS----ETNSEGNIVVRVWAT--SPE----LANNAVSTAIDVFYR------
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      TILAYAHTAFQAQCAANITGEI--------------------------------------
A0A1G1AKK0      LLTVHSNEWRAIQMEASESATRKLTEELSRLEEKIKQSEDDVVEYKRLNDVARVEGRAST
A0A1V6FKM9      IAEVYMTSVLQRRVSISITGVDLLRDQLDDLQKSRDKAMAELLKFKEQHGIFDLEQTYTT
A6DFD0          LIPAYENLRVNTNSGEVEASREQLEQKIQSLDKQIDDVEKEIIEFKTRHNFVFVSTKTEF
A6DSE4          LLGEYAKMRVEENRLTTETTRLALENEEKSIDTKIKKQSDFILDYKIDNNYVFMSTKNEF
A0A1G1C9Z9      LVEEYRDSQREEMGLIHEETVKNLRIELAKLAADLKMERAEVAKFEAEHNVQFEAEKSES
A0A348XG41      YRSEKRKLQRKQQILVYTEEMGRMLRDMTEFNDRMR-----------AFVMSSRLPEVEA
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      ------------------------------------------------------------
A0A1G1AKK0      ELRYLQALMERRSQISTELMLLEAEFPALKGMNPGIISDVVNLTRETGAIEPIRETSEES
A0A1V6FKM9      LLSQLTELNKHCIEAEIQDVELTATLQTIEEHRADAVILMPFLLPEG-------------
A6DFD0          DQKYISNLLEKANKNQFILDILKPELIRLDKETSLASEVFDQIIEIVGH---------GN
A6DSE4          DKEYISELFSKSNQKKLQLGVLEANIDELELSNMEDSKFSSVIDALM-----------SI
A0A1G1C9Z9      ELAHMRDVLRKARSIQTQRMIIESQLKLLTNANAATMRDVLDLTMYTTA---------AA
A0A348XG41      SMERLKQVPEQLQQVRTRLAMLERAQSELRKENKTVAERLSIIATLDVG---------RT
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      ------------------------------------------------------------
A0A1G1AKK0      RRDGREVGNKDNEVQKSELPAALRNGKADNTKADDAHGWRDLRVKLFRLQQKEKELAAN-
A0A1V6FKM9      -----------------------------------ATNLGSLKSLYLSHEMRLPELLTQ-
A6DFD0          NRLSIGQTGLEQD----------------------IQQWKDHKLSRFRIEAQLKIMLKK-
A6DSE4          QGDQKSEFVFKD-----------------------VSEWKSRQVILGSYIAEYDILLEK-
A0A1G1C9Z9      AADDKGGPEWTD-----------------------VSDWQKNEAELIRLNADYGQMRTV-
A0A348XG41      LKPGEGISSLGDGEEDGVLEVDNDVIVTPWMSQSRITGWEEDHKALEELAVKREELLTQN
                                                                            

A0A1V5GU03      MDRDKP------------------------------------------------------
A0A1V5V8D4      FSQTVQDVLRLDN-----------------------------------------------
A0A1G1AKK0      LKPEHPELKRVRDEIADIKNQLDAAAEIELGRLKDRYDALKIHLNTVEAAEYKWKAQNLL
A0A1V6FKM9      YNEAHQAVQTHRKVGDMIIAAEEKEIDISIQGLELRRKRSQQRVIRLNAQIAEIRERLNS
A6DFD0          YKLSHPKVIAVTDELEIIEVEQEVFRKNILSGLRGKVKTLEAQNRNYLLRADRIEDTFGQ
A6DSE4          FKPGHPNMEELQKKIDIITKEIQAYRKNIVRLIKSRVETLKVEYKSYIARAIELEKTFAN
A0A1G1C9Z9      LKPGHPRLAELQEKIAKAQREQQISAELTLKRLEARRDALRMQGEALDSAAAKIESGMNL
A0A348XG41      YLALHPKIAALDNEIKELREGLEGMLNGASDQLEWEISKLEAHRTDLEKKIPMNRAAMNN
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      ---------------------------------------------VKIIDPAK--LPFQR
A0A1G1AKK0      ASTRQSELKRIMDVVERFESNYKTLYTRLQDMKIQEE---LKAEHFYVVEAPG--LRSDY
A0A1V6FKM9      LDRIGGDYKIREAACAALDDTCRMLVNRINEIKIADATTKIENYAIFIVEPAI--SASQP
A6DFD0          NANVISTLEGFVNKQQRLNDLRASLHETLVSISSSGG----DKYFTRMLREPF--LYDGP
A6DSE4          SGVLINEIESLEGRLDQLNELKSNIRSKLILLNENVD----DKYITRIIREPF--AEENP
A0A1G1C9Z9      TGADKAKYENLKSTADHLKSLHDKVFTRIIDSSSTPT----ERYFSRIVEGPV--SSSTP
A0A348XG41      YEAIMWEFEQLGVTEFPWKEKYLEMARKIAELEYAAE----TPFATRLEYMGILDRSRHA
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      HRPLLRLNLVLGFLSGLFLGWLAAFFLAFLDQTIKNPDQVESYLH--QPQMGTIPWLVDQ
A0A1G1AKK0      VWPDPIKVLILALVLGLGSGFGLALVMQVMDNRIQSISDVEKDLG--VKFLGGVPYWVHS
A0A1V6FKM9      FYPVPKKVFSTALVLALALAGGIAFILVSVNNKVTHIEMVSAQFGNTLANFGSVPLFTED
A6DFD0          VSPQQSKYIIKGFVVCFGISSALILFNFFLKIKRYNFSRISRENH--LPCLATIPHFPAK
A6DSE4          VFPSIPKFTLAGALLFNLASSFLVIILFYGKSKRYNFAKVINDYQ--APILSVIPKFASS
A0A1G1C9Z9      VYPVKSRLALIGMVIAGGIGMAIAFLLYYRYVRLYDLTLLETQFG--LPSMGCVPLITDE
A0A348XG41      VSPNRGKLLVMSLGMGLALCVAFVFVIEYLDHTISRVDKAEQVLS--MRGLGIVPQLPSS
                                                                            

A0A1V5GU03      ---------------------NAASEAYRSLRTS-------LERFIADKKGYSLLLTSAD
A0A1V5V8D4      EKNNALYKCLEEHSN------YDFVEALRLIRANLPYIVPLREASANAHSCRVFLITSTL
A0A1G1AKK0      GLEKTIRPIVTEEHS------TGAIEAYRALRTT------ILSE-LVKRNEKIVMVTSAD
A0A1V6FKM9      EHQ-----------LLKSSGEDPIDEAFRDIRTS------LNLS-ALTRSSRVLAISSAT
A6DFD0          FAKQNPFFL-----NEISKS-SVLAESYRSLRLF------MDKN----MDGKIVLFTSSG
A6DSE4          LAKKNPQFL-----NELPKN-SVLAESYRSLRLN------IEQK----SSGKLIMFTSFG
A0A1G1C9Z9      TQKSDPRQL-----NKLSKA-APLCEAYRMIRTA------AEEKL---GEGKVLLFTSSE
A0A348XG41      LTDVNEIPLLTDGESEFGRARSSVRETFRVIRAN------IMESRDFEGDRQVIMVTSSI
                                         *: * :*                 .   . .:*  

A0A1V5GU03      AGEGKSCTTANLGIAFSWTGKRVLLIDADLRRPNLHTALG----EKNAAKGLTQFFLGEV
A0A1V5V8D4      SGEGKSGCTSSIAVLTAKTGKKVLLLDADLRKSTVERIF-----DLSPKVGLAQILAGET
A0A1G1AKK0      SREGKTLTALNLAIMIAQMEKKVLLVDMDLRRGRLHRSL-----GLEREPGVTDVLKEGR
A0A1V6FKM9      PSEGKTFIAANLARSFARDKKRTLLIDMDLRKPQLHKLLQDFLPPDSGKRGISNVLVGDC
A6DFD0          PSEGKTCTSLNTALCSSWTDKKVLLIDGDFRRVTLRKIF-----PNKSKEGLMDYLKNDT
A6DSE4          PAEGKTTTSLNTALCCAWTDKKILLIDADFRRSTLRKSF-----PEMPHKGLLDFLKSDD
A0A1G1C9Z9      QSEGKTFTSAYTAVACTWTKTKVLLVDGDFRRPSQRKLF-----SLPDSKGLAECLSDSS
A0A348XG41      PKEGKSLVSSNLALSFASVGEKTLLIDADIRRRSLSRTF-----NRGSGRGLSDVLKNYT
                  ***:  :   .   :    . **:* *:*.      :           *: : :    

A0A1V5GU03      TDWREIVRPTAYENVDFIPAGRFVYEATELCSASVLRRLMQSWAEQYDLIILDSAPVGRI
A0A1V5V8D4      TLEQSILKGIVEPTFDVLPCGPIPPNPAELLVSESFGTILKKLREEYDYIFIDSPPALFL
A0A1G1AKK0      -SLKEVIMKTRIANLNLAPTGTTVEDSAEMLQSASVVDMFVGVQDDYDYIVVDTSPILRV
A0A1V6FKM9      -ALSDIVIPIKELGLDAALAGPIPPNPNELLGGGGLKKLLKDAQEKYDLVIIDTAPLLVV
A6DFD0          MNIEKYIIKKPVGDLDYLPAGTSDEYVTELIDGKKIKELFSELKNKYDLIIIDSAPAIRV
A6DSE4          HDIEDYIISKASGKMDYLPAGNNDEYVTELLDGKKMETLLTHLRNTYDLVIFDTAPAVRV
A0A1G1C9Z9      LDWRDLLVREVVPRLDLLQTGHADGHGAELIQLESAERLFKEFRDEYDLIIIDTAPINPV
A0A348XG41      -TLDDACVLTDHDYLHLLAAGTLTSQAPELLAGANFTQLMQELRQRYQRIILDTPPILGL
                    .         .     *       *:        ::    : *: :..*:.*   :

A0A1V5GU03      VDTAMIARGCDGVLL-VSLHGKSSVPAIR--HALRRLEGCNVLGFCLNAIDMPRGHGYYY
A0A1V5V8D4      ADPLSIAHYADAILF-IVACHMAKIGLIRKTIRQISRVSSIPLSIIVNRFNRNDISCKYR
A0A1G1AKK0      TDTVILVTQGIGVVLYVARVNHTPKPMVR--YSLDMLKDARVLGLVMNSIEMHKISSLYY
A0A1V6FKM9      SDTLIIASHGVPIIL-ATRLYTVTKPIIRHLSERLKQVNISLAGLIANNADVPKNAYYSY
A6DFD0          IDTVHLAEVADSTVI-VVRAGKTLAPNVS--ATVKRLPKEKLLGFVVNGFRSQDTKYTGT
A6DSE4          VDTVHLAEKTDGTII-VARMGRTYPKDVE--ATLNRLPKDKVVGIVMNDFKQSDLKFTSQ
A0A1G1C9Z9      VDTLLLAKHADGVIL-VVQPGKTSMTSIQ--RALRRLGDAPLLGYVANRITASTEKYYYD
A0A348XG41      SEACEVLRCVDGVVL-VIWSAYTPMHQVKDSTALMRANGARFFGFVLNRLDLSGAKNYYQ
                 :.  :       ::            :               .   *            

A0A1V5GU03      GGSYGYKWRYGLYSYYYYYSNSLYGYGYDDYYATKDAETAKKKATAGEPAEETKEAKEGE
A0A1V5V8D4      YSRYGS------------YGGYG-GYKYAYRASSKDSSTHSN------------------
A0A1G1AKK0      AYQYPNYAYYS-----NAYAY---GYDYYYYGDRHTAGRRQGHRRSEWDRRRNAFGQWVR
A0A1V6FKM9      KDGYGYGYGHG-----HGYGY---GYGYGKTKERQKR-----------------------
A6DFD0          VHSPNG------------YGY---TYGYKGYNYKKEY-----------------------
A6DSE4          -SENNA------------YGSNAYAYSYNSYSTYKDSY----------------------
A0A1G1C9Z9      -SKYGY------------YGH---AYHYQPEKSDQPS-----------------------
A0A348XG41      -Y---Y------------YYS---DYYYRSYSS---------------------------
                                  *      * *                                

A0A1V5GU03      AVEEGKREEETEEKA
A0A1V5V8D4      ---------------
A0A1G1AKK0      RTFMPME--------
A0A1V6FKM9      ---------------
A6DFD0          ---------------
A6DSE4          ---------------
A0A1G1C9Z9      ---------------
A0A348XG41      ---------------
                               

© 1998-2019