BYKdb

Dataset for cluster tadcd of phylum lentisphaerae

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G0YAS5      MNKFMEQPVQSGTGSAGIGGGSKKSFNVVDLKQYFFIVVKRIWLVALCFIVSLSVMVVIL
A0A1G0YCS8      -------------------MADSQQDTALHFLDYWRVIKSRKEIVMAVTLLIVITGVAVT
A0A1G0YWH6      ---------MTQDRSFQDHDYDIPEEQQTHWREYVRVLWEWKWITITAVVIGATLGLIQN
                                     .  .       :*  :: ..  :.    ::     :   

A0A1G0YAS5      IRQIPEYQSVATLLLSRGLPLPVRLKQEEMELILGD-YIATQQRIIQSSLVINGARERLN
A0A1G0YCS8      FMQPKKYSSTVRILVREDSMDVDVFERQMIQGYNPF-FLRTQERILKSTPLLYAVIDNLN
A0A1G0YWH6      FKAVPVYQATTPVELEADTPRIVNFQDVAATDTRSSDYLNTKVQVLRSRSLAEKVVKTLA
                :     *.:.. : :  .      ::           :: *: .::.*  :   . . * 

A0A1G0YAS5      LPG------------------DEFNQKYRSLSVVPIWQTAIMAITVKGLDPVFCADFANA
A0A1G0YCS8      LQAVWGQQYNDDKSPITKEDA--LATLSSSIKIEQDRDTSLINISVTQEDRELAARIANE
A0A1G0YWH6      LNG------NPDFLPGAGENADFAGALQGCVSAQLRRGTRIIDITAEHTNPKMAALVANG
                * .                          .:.    . * :: *:.   :  :.* .** 

A0A1G0YAS5      LAEEYLDFKAGERMDTSQATVISLTQQANRLHEELKKAEIQSLAFIRENSVVGIQERGNV
A0A1G0YCS8      MAAVYREQRLDVKRSELRRAIEVLDNEVQKQQEKVDQAESELERIRQEVGVSFLGQGFRA
A0A1G0YWH6      VAQEFVKLNSENRLSASMDAIRWLSTQAEQYKTQLAKSEAAVQEYREKTRDVSLEDSYNI
                :*  : . .   . .    ::  *  :.:. : :: ::*        :     : :  . 

A0A1G0YAS5      AAEFLGSLSRQAATYRNQRMLLEAQQPLLSQASDEVVLATLSYPIQIGTIPVPNSSMSTS
A0A1G0YCS8      DKVRLQQLEADRIASRVDMLVRKAR---------------------------------LN
A0A1G0YWH6      VLDKLKSMNTAFGNAKMARMSTETE---------------------------------WK
                    * .:.      .   :  ::                                   .

A0A1G0YAS5      SVNSVLGGGPESLIEYGVVEQPFWSALKRKKAVLEGQLVSYRKKYKEEHPLVKETVSALQ
A0A1G0YCS8      QLES-LEGTELMNASSYVVMDQSIASIRQQLIDTEVALKLMLENMGVNHPDVKRLQAGVD
A0A1G0YWH6      QVQALLDSGRDAALIPAIASDGEVETLHQSLTQKQIAVSVLRERYKDQYPAMIVALSEQK
                .::: * .         :. :    ::...    :  :    :.   ::* :    :  .

A0A1G0YAS5      ETDDALNVELEFALRQFYSQLESLSIREKSAERVEKEWEDQALE-VSKKMQEYRNIQRNS
A0A1G0YCS8      ELKKKLNESLVGLKIGLNADYEVAKAKFDALEAELQAAKHSDIEDEKKKFLPFDRAERNV
A0A1G0YWH6      EIENKLKQACVAAVEKIKARYAVAKAQEESLVEPLAEQEKQALE-LSRKLVEYNRLKRNA
                * .. *:         : :     . . .:        : . :*  ..*:  : . :** 

A0A1G0YAS5      DRLQGLYDLVFNRLKEVDITLGIEPESVRIMERAKPPSSPITPRKLQSLFMAALVGLGIG
A0A1G0YCS8      IIQRDILNALRARITQQGIEVEVPRTPVEVVEPAEPANKPSSPLVMLNILLSIFLGFGAG
A0A1G0YWH6      ESDRQLYDSLLMRMKEAGVTGKLEFNNMHIIDPARVPGAPCRPDKKRNLTYAIVMGLLAG
                   . : : :  *:.: .:   :    : ::: *  .. *  *    .:  : .:*:  *

A0A1G0YAS5      LGLIFGLEYIDDSIRYPEEVTQGLGIPFLGVVPSANWDPEDLRAHILANIDQKSGLAEAY
A0A1G0YCS8      IGLAYFIEYLDTSVRTVDDVEQFLGLPVLGVIPQ-------KIRPLIHE-GPESPHGEPY
A0A1G0YWH6      LVLSYGAHFYDDKIKTCKDIESYLGMPLLCEVPRIENKSDSDRATIVST-DPLSLASEAF
                : * :   : * .:.  .:: . **:*.*  :*            ::   .  *  .*.:

A0A1G0YAS5      RNVRSSLLLGKAKDRLKTLVITSAVPKEGKTTTCLNLAISLAQAGSRVLMVDADMRRGEL
A0A1G0YCS8      RVLRTNMQFSNKGIHGGAFAVISGGVGEGKSTTLFNLAYTCAQLGYKTIVVDSDLRRPVQ
A0A1G0YWH6      SSLRATIGATPNAKDIKVLMVTSTAPGEGKSLVASNMAIAFAHDNLRTLLIDADLRHPTL
                  :*:.:          .: : *    ***: .  *:* : *: . ..:::*:*:*.   

A0A1G0YAS5      HKFFGLEGGR--GLADVLTGQAKPEAVIQRSGVPNLDLIATGPFPSNPAEIVLRPEMNSF
A0A1G0YCS8      HSILSMSNRI--GLTNVLMKDSTLEECVKPTIVPNLSFLPSGRLPRSMMGIIDSQRMREL
A0A1G0YWH6      YKDFQIKTQTVRGLSQYLMDGCKREDVILKSGIRDLDIIIAGKIAKNPAELLGSARMREL
                :. : :.     **:: *   .. *  :  : : :*.:: :* :. .   ::    *..:

A0A1G0YAS5      LDYARRTYDKVVFDCPPVMAVSEAAILASMVDGVITIVWAGHTSKKLAQLCARLIRERGA
A0A1G0YCS8      VKDLKSRYDYVFFDSPPIIGITDASILASEVDGVLLVVQYRKYPRVISSRAKRMVENVGG
A0A1G0YWH6      IEQERQRYDRIIIDTPPVAVVSDAIVLLPRVQGIIFVTHFRKLRRDAVARAVKKLREMGA
                :.  .  ** :.:* **:  :::* :* . *:*:: :..  :  .     . . : : *.

A0A1G0YAS5      VILGCVLNNLEFSRVGYYYYSTYYGYYNYDYHYGKNEAGKRV---------------
A0A1G0YCS8      KLLGVVLNNINIMRDDYYYY--YHASYT---QYNPDGQEKVPAKTIAASADGKDSLF
A0A1G0YWH6      PLIGNVLNNIDLKKHGYYYYP-YHGSYRYPYYHKKDGRRRMESEEESES--------
                 ::* ****::: . .****  *:. *     :  :   .                 

© 1998-2019