BYKdb

Dataset for cluster orphancd of phylum metagenomes

[Download (right click)] [Edit] [Sequences] [Repertoires]

104 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3R1QQP6      ------------------------------------------------------------
A0A3R5TF76      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
A0A3R4S1T4      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
A0A3R3TMZ8      ------------------------------------------------------------
A0A405KPI1      ------------------------------------------------------------
A0A404XVD4      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
A0A3R5S6P1      ------------------------------------------------------------
A0A3R2EVW0      ------------------------------------------------------------
A0A3R5HKR2      ------------------------------------------------------------
A0A404X108      ------------------------------------------------------------
A0A405D7C3      ------------------------------------------------------------
A0A404A688      ------------------------------------------------------------
A0A409R088      ------------------------------------------------------------
A0A3R4T9I0      ------------------------------------------------------------
A0A3R5C7Q1      ------------------------------------------------------------
A0A3R2KBB7      ------------------------------------------------------------
A0A3R3NKS5      ------------------------------------------------------------
A0A3R3PBR3      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A3R5TDH0      ------------------------------------------------------------
A0A409P6G9      ------------------------------------------------------------
A0A3R3YDR2      ------------------------------------------------------------
A0A3R4BTI6      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A3R1GI32      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3R2TTF1      MKTTHYNQLQKDKSINVLDVLAHLLYHWKWFALSILLFGSYYYYQYAKSPFIYRSAETII
A0A408BKC9      ------------------------------------------------------------
A0A409SIT6      ------------------------------------------------------------
A0A3R3BMP0      ------------------------------------------------------------
A0A3R4HSN4      ------------------------------------------------------------
A0A3R1RAJ9      ------------------------------------------------------------
A0A406EFX4      ------------------------------------------------------------
A0A408LKC9      ------------------------------------------------------------
A0A3R5KFR9      ------------------------------------------------------------
A0A404MRF7      ------------------------------------------------------------
A0A3R4D168      --------------------------------------MDIKYYLSIFLRRWWILVITTG
A0A0F9HWF5      ------------------------------------------------------------
A0A2H9T3X6      ------------------------------------------------------------
A0A380TAR7      ------------------------------------------------------MAERDE
A0A407YHX1      ------------------------------------------------------------
A0A3R4QZA0      ------------------------------------------------------------
A0A3R5GLV2      ------------------------------------------------------------
A0A3R4UA41      ------------------------------------------------------------
A0A0F9C030      ------------------------------------------------------------
A0A0F9G9C6      ------------------------------------------------------------
A0A2P2C6F5      ------------------------------------------------------------
A0A3R2Y861      ------------------------------------------------------------
A0A3R3WRK8      ------------------------------------------------------------
A0A3R3W423      ------------------------------------------------------------
A0A3R5NV43      ------------------------------------------------------------
A0A3R2VV23      ------------------------------------------------------------
A0A3R3PPN7      ------------------------------------------------------------
A0A404ALK7      ------------------------------------------------------------
A0A3R4HE49      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------------------
A0A407LWW7      ------------------------------------------------------------
A0A409DV79      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A404N310      ------------------------------------------------------------
A0A408M394      ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A3R4U3E9      ------------------------------------------------------------
A0A3R1HJ57      ------------------------------------------------------------
A0A3R2KDK8      ------------------------------------------------------------
A0A3R4U8W0      ------------------------------------------------------------
A0A404C9H2      ------------------------------------------------------------
A0A408ANB0      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A3R4ZJ07      ------------------------------------------------------------
A0A409P464      ------------------------------------------------------------
A0A3R3EEA8      ------------------------------------------------------------
A0A3R5AYY7      ------------------------------------------------------------
A0A408AG77      ------------------------------------------------------------
A0A406QJE9      ------------------------------------------------------------
A0A3R5CIW6      ------------------------------------------------------------
A0A3R2KDF2      ------------------------------------------------------------
A0A3R3PAM0      ------------------------------------------------------------
A0A3R3G320      ------------------------------------------------------------
A0A404NRH5      ------------------------------------------------------------
A0A3R1RKC9      ------------------------------------------------------------
A0A3R4GVU7      ------------------------------------------------------------
A0A3R1GW93      ------------------------------------------------------------
A0A3R5DAG0      ------------------------------------------------------------
A0A406DTV4      ------------------------------------------------------------
                                                                            

A0A3R1QQP6      ------------------------------------------------------------
A0A3R5TF76      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
A0A3R4S1T4      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
A0A3R3TMZ8      ------------------------------------------------------------
A0A405KPI1      ------------------------------------------------------------
A0A404XVD4      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
A0A3R5S6P1      ------------------------------------------------------------
A0A3R2EVW0      ------------------------------------------------------------
A0A3R5HKR2      ------------------------------------------------------------
A0A404X108      ------------------------------------------------------------
A0A405D7C3      ------------------------------------------------------------
A0A404A688      ------------------------------------------------------------
A0A409R088      ------------------------------------------------------------
A0A3R4T9I0      ------------------------------------------------------------
A0A3R5C7Q1      ------------------------------------------------------------
A0A3R2KBB7      ------------------------------------------------------------
A0A3R3NKS5      ------------------------------------------------------------
A0A3R3PBR3      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A3R5TDH0      ------------------------------------------------------------
A0A409P6G9      ------------------------------------------------------------
A0A3R3YDR2      ------------------------------------------------------------
A0A3R4BTI6      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A3R1GI32      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3R2TTF1      IKTPMNTPRTARISRTNEAYNSISVASEILQLKSKELMRQTVTRIGAEMSYTVGAGLRRK
A0A408BKC9      ------------------------------------------------------------
A0A409SIT6      ------------------------------------------------------------
A0A3R3BMP0      ------------------------------------------------------------
A0A3R4HSN4      ------------------------------------------------------------
A0A3R1RAJ9      ------------------------------------------------------------
A0A406EFX4      ------------------------------------------------------------
A0A408LKC9      ------------------------------------------------------------
A0A3R5KFR9      ------------------------------------------------------------
A0A404MRF7      ------------------------------------------------------------
A0A3R4D168      LVTGVTAIRAGKEPVTYTAQARMLYETNNVASSVLGGAMFMPMSWNNPVDTQLQLITTRP
A0A0F9HWF5      ----------------------------------------------IVITSFLKRFDVKP
A0A2H9T3X6      -----------------------------MIGRAVARRFSPDAEAGELINTPWLWFSGYG
A0A380TAR7      FTSSRSRSLLEIASRAAALGGKDETNPGSADRQALAAQAARAASLDEVVDEFLKHLDVRP
A0A407YHX1      ---------------------------------------------------------MER
A0A3R4QZA0      ------------------------------------------------------------
A0A3R5GLV2      ------------------------------------------------------------
A0A3R4UA41      --------------------------------------------------------MVVS
A0A0F9C030      ------------------------------------------------------------
A0A0F9G9C6      ------------------------------------------------------------
A0A2P2C6F5      ------------------------------------------------------------
A0A3R2Y861      -----------------------------MWGEPLLTLRGKVGVPLHADTARGPVDLLVK
A0A3R3WRK8      ------------------------------------------------------------
A0A3R3W423      ------------------------------------------------------------
A0A3R5NV43      ------------------------------------------------------------
A0A3R2VV23      ------------------------------------------------------------
A0A3R3PPN7      ------------------------------------------------------------
A0A404ALK7      ------------------------------------------------------------
A0A3R4HE49      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------------------
A0A407LWW7      ------------------------------------------------------------
A0A409DV79      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A404N310      ------------------------------------------------------------
A0A408M394      ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A3R4U3E9      ------------------------------------------------------------
A0A3R1HJ57      --------------------------------------------------------MNVS
A0A3R2KDK8      ------------------------------------------------------------
A0A3R4U8W0      ------------------------------------------------------------
A0A404C9H2      ------------------------------------------------------------
A0A408ANB0      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A3R4ZJ07      ------------------------------------------------------------
A0A409P464      ------------------------------------------------------------
A0A3R3EEA8      ------------------------------------------------------------
A0A3R5AYY7      ------------------------------------------------------------
A0A408AG77      ------------------------------------------------------------
A0A406QJE9      ------------------------------------------------------------
A0A3R5CIW6      ------------------------------------------------------------
A0A3R2KDF2      ------------------------------------------------------------
A0A3R3PAM0      ------------------------------------------------------------
A0A3R3G320      ------------------------------------------------------------
A0A404NRH5      ------------------------------------------------------------
A0A3R1RKC9      ------------------------------------------------------------
A0A3R4GVU7      ------------------------------------------------------------
A0A3R1GW93      ------------------------------------------------------------
A0A3R5DAG0      ------------------------------------------------------------
A0A406DTV4      ------------------------------------------------------------
                                                                            

A0A3R1QQP6      ------------------------------------------------------------
A0A3R5TF76      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
A0A3R4S1T4      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
A0A3R3TMZ8      ------------------------------------------------------------
A0A405KPI1      ------------------------------------------------------------
A0A404XVD4      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
A0A3R5S6P1      ------------------------------------------------------------
A0A3R2EVW0      ------------------------------------------------------------
A0A3R5HKR2      ------------------------------------------------------------
A0A404X108      ------------------------------------------------------------
A0A405D7C3      ------------------------------------------------------------
A0A404A688      ------------------------------------------------------------
A0A409R088      ------------------------------------------------------------
A0A3R4T9I0      ------------------------------------------------------------
A0A3R5C7Q1      ------------------------------------------------------------
A0A3R2KBB7      ------------------------------------------------------------
A0A3R3NKS5      ------------------------------------------------------------
A0A3R3PBR3      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A3R5TDH0      ------------------------------------------------------------
A0A409P6G9      ------------------------------------------------------------
A0A3R3YDR2      ------------------------------------------------------------
A0A3R4BTI6      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A3R1GI32      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3R2TTF1      ELYTGSPIKVIVPQKKPEDSFSFTVTPVGGKELVLSNWSEGDATLEVDATLDKPVNTPFG
A0A408BKC9      ------------------------------------------------------------
A0A409SIT6      ------------------------------------------------------------
A0A3R3BMP0      ------------------------------------------------------------
A0A3R4HSN4      ------------------------------------------------------------
A0A3R1RAJ9      ------------------------------------------------------------
A0A406EFX4      ------------------------------------------------------------
A0A408LKC9      ------------------------------------------------------------
A0A3R5KFR9      ------------------------------------------------------------
A0A404MRF7      ------------------------------------------------------------
A0A3R4D168      NAEEAIKRLGLNDPAKGPVITPEEVLGGLSAQVDKNTDIIMLRFTHLKSDLAIKVVNEMG
A0A0F9HWF5      V---------------------------------RNTQIAVVSFNSKSPEMAARVANAAV
A0A2H9T3X6      W---------------------------------GGEALKIERFEMHSSLLDQPYTLVAG
A0A380TAR7      T---------------------------------KASRVISVRFQSRDAQLAADVANAVA
A0A407YHX1      V---------------------------------GRSSVIAISTRSTDRQLAAQIAKTYA
A0A3R4QZA0      ------------------------------------------------------------
A0A3R5GLV2      ----------------------------------------------------------MA
A0A3R4UA41      RLDGKPGAEFLVSRASLLATTEDLQKRLQLAEQGKQSNVISASLEDSDRDRLQRTLNEIG
A0A0F9C030      ------------------------------------------------QQHAFAMVDTIG
A0A0F9G9C6      ------------------NTILDLQAAIGASEKGKDSGIINLSLQSEKPHYAEKVLDKVA
A0A2P2C6F5      ----------MTFGDFVRLTRAYVWVLIGCTVLGALLMMAKTTRDPVLYSATSSGLVVVG
A0A3R2Y861      TADGEPGATFTIKRYSEIATTEWLQRSLSISERGKQSSIIGVALDSVDPVRASQILNVVG
A0A3R3WRK8      -----------------------------------------MALDSVDPVRASQILNVVG
A0A3R3W423      ---------------------------MSAAERGKESGIIALSLENEDPDLANKVLDEIN
A0A3R5NV43      ---------------------------MSAAERGKESGIIALSLENEDPDLANKVLDEIN
A0A3R2VV23      --------------------------------------------------MAIKTLNEIA
A0A3R3PPN7      ------------------------------------------------------MLDEIG
A0A404ALK7      ------------------------------------------------------------
A0A3R4HE49      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------------------
A0A407LWW7      ------------------------------------------------------------
A0A409DV79      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A404N310      ------------------------------------------------------------
A0A408M394      ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A3R4U3E9      ------------------------------------------------------------
A0A3R1HJ57      AIKAQVGDTFTVTKYSTLGMINQLQGNLVVAENGKDTGVLSLSYTGEDRDKIRDILDSIT
A0A3R2KDK8      ------------------------------------------------------------
A0A3R4U8W0      ------------------------------------------------------------
A0A404C9H2      ------------------------------------------------------------
A0A408ANB0      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A3R4ZJ07      ------------------------------------------------------------
A0A409P464      ------------------------------------------------------------
A0A3R3EEA8      ------------------------------------------------------------
A0A3R5AYY7      ------------------------------------------------------------
A0A408AG77      ------------------------------------------------------------
A0A406QJE9      ------------------------------------------------------------
A0A3R5CIW6      ------------------------------------------------------------
A0A3R2KDF2      ------------------------------------------------------------
A0A3R3PAM0      ------------------------------------------------------------
A0A3R3G320      ------------------------------------------------------------
A0A404NRH5      ------------------------------------------------------------
A0A3R1RKC9      ------------------------------------------------------------
A0A3R4GVU7      ------------------------------------------------------------
A0A3R1GW93      ------------------------------------------------------------
A0A3R5DAG0      ------------------------------------------------------------
A0A406DTV4      ------------------------------------------------------------
                                                                            

A0A3R1QQP6      ------------------------------------------------------------
A0A3R5TF76      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
A0A3R4S1T4      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
A0A3R3TMZ8      ------------------------------------------------------------
A0A405KPI1      ------------------------------------------------------------
A0A404XVD4      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
A0A3R5S6P1      ------------------------------------------------------------
A0A3R2EVW0      ------------------------------------------------------------
A0A3R5HKR2      ------------------------------------------------------------
A0A404X108      ------------------------------------------------------------
A0A405D7C3      ------------------------------------------------------------
A0A404A688      ------------------------------------------------------------
A0A409R088      ------------------------------------------------------------
A0A3R4T9I0      ------------------------------------------------------------
A0A3R5C7Q1      ------------------------------------------------------------
A0A3R2KBB7      ------------------------------------------------------------
A0A3R3NKS5      ------------------------------------------------------------
A0A3R3PBR3      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A3R5TDH0      ------------------------------------------------------------
A0A409P6G9      ------------------------------------------------------------
A0A3R3YDR2      ------------------------------------------------------------
A0A3R4BTI6      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A3R1GI32      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3R2TTF1      QVIVQSALKPNKVLPQQEIKVEKFALEGMVNYFISTISITQMEEDASLLQIVAEDTNPLR
A0A408BKC9      ------------------------------------------------------------
A0A409SIT6      ------------------------------------------------------------
A0A3R3BMP0      ------------------------------------------------------------
A0A3R4HSN4      ------------------------------------------------------------
A0A3R1RAJ9      ------------------------------------------------------------
A0A406EFX4      ------------------------------------------------------------
A0A408LKC9      ------------------------------------------------------------
A0A3R5KFR9      ------------------------------------------------------------
A0A404MRF7      ------------------------------------------------------------
A0A3R4D168      HVFVERNRANHQETARTARQ---FIMEQLAKTEKTLTEAEDQLRAFRESNGLFEVSS---
A0A0F9HWF5      QAYVDYTLTTKIKANVGASG---VLRKNIQEQRKKIEESEKLLFEYKEKFKIISLEE---
A0A2H9T3X6      E-------------NGHYQL---WLDDRMILTGKVGEAAQSKDQQLRLFVSLLQARPGTR
A0A380TAR7      DTYTNRFIETKIAIAEKATG---WLKGQVKALREAVARSEKAVEAFRTQSGLLRGS----
A0A407YHX1      QAYLTEQLNANFDASERASV---WLQERMTDLNQRAQAAELAVQKYRSDNNIVSSR----
A0A3R4QZA0      ------------------------------------------------------------
A0A3R5GLV2      SAYLLDKLNSKYEATRRASD---WLSDRIAELRQRALDTDLAVQKFRAEHNLISTGNNSL
A0A3R4UA41      AQYVRQNVERKAAEAEKTIE---FLDRQLPEFKRQLESSEDAYARFRNQNGTV-------
A0A0F9C030      REVLLRQLGLKTADPYASSR----INQQLIDDRGKLQAKLLLYGSAHQEVRTL-------
A0A0F9G9C6      GIYVRRNVERNSAEAQKSLE---FLEVQLPEIKKQLEFAEQRFNDYQIQRQSI-------
A0A2P2C6F5      NATTAGEEQGNAALAEEKAGLYAFLVSSMPVAEKVVDD----------------------
A0A3R2Y861      TEYVEQNVRRRSEEADKSIR---FLDEQLPQLKQQVEESESAYNAYRAKEGAV-------
A0A3R3WRK8      TEYVEQNVRRRSEEADKSIR---FLDEQLPQLKQQVEESESAYNAYRAKEGAV-------
A0A3R3W423      RLYVLQNVQRNSAEAAQSLE---FLRTQLPDVRKQLEKAEGQLNAYQTSARSV-------
A0A3R5NV43      RLYVLQNVQRNSAEAAQSLE---FLRTQLPDVRKQLEKAEGQLNAYQSSARSV-------
A0A3R2VV23      DIYVRQNIERTSAEAAKSLG---FLNEQLPKVRRDLEKAEDALNSYQTRSKSV-------
A0A3R3PPN7      KLYVRQNVERTSAEAASSLE---FLRGQLPEVRRDLEKAEDALNAYQTLSKSV-------
A0A404ALK7      ------------------------------------------------------------
A0A3R4HE49      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------------------
A0A407LWW7      ------------------------------------------------------------
A0A409DV79      ------------------------------------------------------------
X0S5W7          ---------------------------------------QLAPLLLQMAQQGL-------
A0A404N310      ----------------------------------MLGKSFEISLTKQITDLNL-------
A0A408M394      ---------------MKSEP---NRLDIYRLIPEMLGKSFELSLTKQITDLNL-------
A0A3B1DSI5      ------------------------------------------------------------
A0A3R4U3E9      ------------------------------------------------------------
A0A3R1HJ57      RNYLEQNVQRKSEEAAKSLK---FLAEQLPEVRTRLDAAENKLNAYRQQQDSV-------
A0A3R2KDK8      ------------------------------------------------------------
A0A3R4U8W0      -------------------------------MRTRLDDAENKLNAYRQQKDSV-------
A0A404C9H2      ------------------------------------------------------------
A0A408ANB0      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A3R4ZJ07      ------------------------------------------------------------
A0A409P464      ------------------------------------------------------------
A0A3R3EEA8      ------------------------------------------------------------
A0A3R5AYY7      ------------------------------------------------------------
A0A408AG77      ------------------------------------------------------------
A0A406QJE9      ------------------------------------------------------------
A0A3R5CIW6      -------------------------------MRKQLEKAEGQLNAYQSSARSV-------
A0A3R2KDF2      ------------------------------------------------------------
A0A3R3PAM0      ------------------------------------------------------------
A0A3R3G320      ------------------------------------------------------------
A0A404NRH5      ------------------------------------------------------------
A0A3R1RKC9      ------------------------------------------------------------
A0A3R4GVU7      ------------------------------------------------------------
A0A3R1GW93      ------------------------------------------------------------
A0A3R5DAG0      ------------------------------------------------------------
A0A406DTV4      ------------------------------------------------------------
                                                                            

A0A3R1QQP6      ------------------------------------------------------------
A0A3R5TF76      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
A0A3R4S1T4      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
A0A3R3TMZ8      ------------------------------------------------------------
A0A405KPI1      ------------------------------------------------------------
A0A404XVD4      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
A0A3R5S6P1      ------------------------------------------------------------
A0A3R2EVW0      ------------------------------------------------------------
A0A3R5HKR2      ------------------------------------------------------------
A0A404X108      ------------------------------------------------------------
A0A405D7C3      ------------------------------------------------------------
A0A404A688      ------------------------------------------------------------
A0A409R088      ------------------------------------------------------------
A0A3R4T9I0      ------------------------------------------------------------
A0A3R5C7Q1      ------------------------------------------------------------
A0A3R2KBB7      ------------------------------------------------------------
A0A3R3NKS5      ------------------------------------------------------------
A0A3R3PBR3      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A3R5TDH0      ------------------------------------------------------------
A0A409P6G9      ------------------------------------------------------------
A0A3R3YDR2      ------------------------------------------------------------
A0A3R4BTI6      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A3R1GI32      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3R2TTF1      ATALIAEMINVYNEVALQDKNQIGVNTANFIRERLAIIEQELGSVESSIEDLRTQNQGMD
A0A408BKC9      ------------------------------------------------------------
A0A409SIT6      ------------------------------------------------------------
A0A3R3BMP0      ------------------------------------------------------------
A0A3R4HSN4      ------------------------------------------------------------
A0A3R1RAJ9      ------------------------------------------------------------
A0A406EFX4      ------------------------------------------------------------
A0A408LKC9      ------------------------------------------------------------
A0A3R5KFR9      ------------------------------------------------------------
A0A404MRF7      ------------------------------------------------------------
A0A3R4D168      ---LGNTTAGQLSSIDTRLIDLDVDRKVAEEKLA--------------------------
A0A0F9HWF5      ---EKNITIQKLAAHSKNLVSAENVRIEAQSKYQ----------------VAVGMLVDGD
A0A2H9T3X6      FNVTDQLLVSTVNQLSQRLSVSEKGKKTGVLSLSLTGPSRPENSRLLEAIIQRYVRQNIE
A0A380TAR7      ---QVTLISEEISEINRRLAAASADRAQATATLN-----------EVQA-LQKASNIEAA
A0A407YHX1      ---GELMSESQLADLNGQLISAQADAATASARYS-----------QYKSIIDRGPETAVD
A0A3R4QZA0      ------------------------------------------------------------
A0A3R5GLV2      LSDQQLAESNSALILAQSETAKARARVQRIEHIL--------------------------
A0A3R4UA41      ------------------------------------------------------------
A0A0F9C030      ------------------------------------------------------------
A0A0F9G9C6      ------------------------------------------------------------
A0A2P2C6F5      ------------------------------------------------------------
A0A3R2Y861      ------------------------------------------------------------
A0A3R3WRK8      ------------------------------------------------------------
A0A3R3W423      ------------------------------------------------------------
A0A3R5NV43      ------------------------------------------------------------
A0A3R2VV23      ------------------------------------------------------------
A0A3R3PPN7      ------------------------------------------------------------
A0A404ALK7      ------------------------------------------------------------
A0A3R4HE49      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------------------
A0A407LWW7      ------------------------------------------------------------
A0A409DV79      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A404N310      ------------------------------------------------------------
A0A408M394      ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A3R4U3E9      ------------------------------------------------------------
A0A3R1HJ57      ------------------------------------------------------------
A0A3R2KDK8      ------------------------------------------------------------
A0A3R4U8W0      ------------------------------------------------------------
A0A404C9H2      ------------------------------------------------------------
A0A408ANB0      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A3R4ZJ07      ------------------------------------------------------------
A0A409P464      ------------------------------------------------------------
A0A3R3EEA8      ------------------------------------------------------------
A0A3R5AYY7      ------------------------------------------------------------
A0A408AG77      ------------------------------------------------------------
A0A406QJE9      ------------------------------------------------------------
A0A3R5CIW6      ------------------------------------------------------------
A0A3R2KDF2      ------------------------------------------------------------
A0A3R3PAM0      ------------------------------------------------------------
A0A3R3G320      ------------------------------------------------------------
A0A404NRH5      ------------------------------------------------------------
A0A3R1RKC9      ------------------------------------------------------------
A0A3R4GVU7      ------------------------------------------------------------
A0A3R1GW93      ------------------------------------------------------------
A0A3R5DAG0      ------------------------------------------------------------
A0A406DTV4      ------------------------------------------------------------
                                                                            

A0A3R1QQP6      ------------------------------------------------------------
A0A3R5TF76      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
A0A3R4S1T4      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
A0A3R3TMZ8      ------------------------------------------------------------
A0A405KPI1      ------------------------------------------------------------
A0A404XVD4      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
A0A3R5S6P1      ------------------------------------------------------------
A0A3R2EVW0      ------------------------------------------------------------
A0A3R5HKR2      ------------------------------------------------------------
A0A404X108      ------------------------------------------------------------
A0A405D7C3      ------------------------------------------------------------
A0A404A688      ------------------------------------------------------------
A0A409R088      ------------------------------------------------------------
A0A3R4T9I0      ------------------------------------------------------------
A0A3R5C7Q1      ------------------------------------------------------------
A0A3R2KBB7      ------------------------------------------------------------
A0A3R3NKS5      ------------------------------------------------------------
A0A3R3PBR3      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A3R5TDH0      ------------------------------------------------------------
A0A409P6G9      ------------------------------------------------------------
A0A3R3YDR2      ------------------------------------------------------------
A0A3R4BTI6      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A3R1GI32      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3R2TTF1      ASTVGTAYFEDSRLYQSERNKVETDINLAQMMRGYLADGSKKNDLIPNNTGLVDASVETQ
A0A408BKC9      ------------------------------------------------------------
A0A409SIT6      ------------------------------------------------------------
A0A3R3BMP0      ------------------------------------------------------------
A0A3R4HSN4      ------------------------------------------------------------
A0A3R1RAJ9      ------------------------------------------------------------
A0A406EFX4      -----------------------------------------------------MLRAQQE
A0A408LKC9      ------------------------------------------------------------
A0A3R5KFR9      ------------------------------------------------------------
A0A404MRF7      ----------------------------------------MDLTLEAKSVLEQIVNADNQ
A0A3R4D168      NARRHLEVTDPGLMLRMEKLNADKVYASLQSSLAEGEAALTVKRTQYTDDAPEVQDAQAQ
A0A0F9HWF5      LAGSIPEVMSNGFITKL------------KTDEAVLREQLSEISRKYGSKHPKVIALNDK
A0A2H9T3X6      RVSAEAQNSLKFLERQLPEMKKDVELAESKLHRFQQENQTVDLTMETQAVLDQAVTIDTQ
A0A380TAR7      QAIM-----ESPVVQQL------------RIQEAAVLRELAELSIELGERHPRVINKKSE
A0A407YHX1      NAVVSARDTDNSVIQDL------------RKRYITISDRQRGIVQQFGADHPQAAALDAE
A0A3R4QZA0      ------------------------------------------------------------
A0A3R5GLV2      --------ATDDVDGVVTDILDSSVANDLRKKYLESSKIEAEITRRLGSNHIQAVRLRNE
A0A3R4UA41      -----------------------------------------AFDEEAKAALTMSVQLQTK
A0A0F9C030      -----------------------------------------QQRISLAEHFLQNQRFQDA
A0A0F9G9C6      -----------------------------------------NITLETQGVLEQVVKLETK
A0A2P2C6F5      ------------------------------------------------------------
A0A3R2Y861      -----------------------------------------DTSEEARTLLEQAVTMETR
A0A3R3WRK8      -----------------------------------------DTSEEARTLLEQAVTMETR
A0A3R3W423      -----------------------------------------DITIETKAVLDQIVALETL
A0A3R5NV43      -----------------------------------------DITIETKAVLDQIVALETL
A0A3R2VV23      -----------------------------------------DITLETKAILDQIVSLDTN
A0A3R3PPN7      -----------------------------------------DISLETKAILDQIVALDTS
A0A404ALK7      ------------------------------------------------------------
A0A3R4HE49      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------MNEQILVYKAGI
A0A407LWW7      ------------------------------------------------------------
A0A409DV79      ------------------------------------------------------------
X0S5W7          -----------------------------------------DKSKQKESILQASLDEARF
A0A404N310      -----------------------------------------LLERKEELLTNVTENNSEL
A0A408M394      -----------------------------------------LLERKEELLTNVTENNSEL
A0A3B1DSI5      ------------------------------------------------------------
A0A3R4U3E9      --------------------------------------------MQTKGLLEQEVAVEAS
A0A3R1HJ57      -----------------------------------------DLSLEAKSVLDTMVNIDAQ
A0A3R2KDK8      -------------------------------------------------MLDTIVSVESQ
A0A3R4U8W0      -----------------------------------------DLPLEAKSVLDSMVNIDAQ
A0A404C9H2      ------------------------------------------------------------
A0A408ANB0      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A3R4ZJ07      ------------------------------------------------------------
A0A409P464      -------------------------------------------------MLEQVVSLDTR
A0A3R3EEA8      ------------------------------------------------------------
A0A3R5AYY7      ------------------------------------------------------------
A0A408AG77      ------------------------------------------------------------
A0A406QJE9      ------------------------------------------------------------
A0A3R5CIW6      -----------------------------------------DITIETKAVLDQIVALETL
A0A3R2KDF2      ------------------------------------------------------------
A0A3R3PAM0      ------------------------------------------------------------
A0A3R3G320      ------------------------------------------------------------
A0A404NRH5      ------------------------------------------------------------
A0A3R1RKC9      ------------------------------------------------------------
A0A3R4GVU7      ------------------------------------------------------------
A0A3R1GW93      ------------------------------------------------------------
A0A3R5DAG0      ------------------------------------------------------------
A0A406DTV4      ------------------------------------------------------------
                                                                            

A0A3R1QQP6      ------------------------------------------------------------
A0A3R5TF76      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
A0A3R4S1T4      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
A0A3R3TMZ8      ------------------------------------------------------------
A0A405KPI1      ------------------------------------------------------------
A0A404XVD4      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
A0A3R5S6P1      ------------------------------------------------------------
A0A3R2EVW0      ------------------------------------------------------------
A0A3R5HKR2      ------------------------------------------------------------
A0A404X108      ------------------------------------------------------------
A0A405D7C3      ------------------------------------------------------------
A0A404A688      ------------------------------------------------------------
A0A409R088      ------------------------------------------------------------
A0A3R4T9I0      ------------------------------------------------------------
A0A3R5C7Q1      ------------------------------------------------------------
A0A3R2KBB7      ------------------------------------------------------------
A0A3R3NKS5      ------------------------------------------------------------
A0A3R3PBR3      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A3R5TDH0      ------------------------------------------------------------
A0A409P6G9      ------------------------------------------------------------
A0A3R3YDR2      ------------------------------------------------------------
A0A3R4BTI6      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A3R1GI32      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3R2TTF1      INDYNTTLLRRNRLIEGSSDANPVVQDLDRALQAMRGNIGRAVDNAIGGLKIKAGNMKKE
A0A408BKC9      ------------------------------------------------------------
A0A409SIT6      ------------------------------------------------------------
A0A3R3BMP0      ------------------------------------------------------------
A0A3R4HSN4      ------------------------------------------------------------
A0A3R1RAJ9      ------------------------------------------------------------
A0A406EFX4      LAAIDGQIQAEIQRVIS------------------------NLEARVQVARDRTNSVQSS
A0A408LKC9      ------------------------------------------------------------
A0A3R5KFR9      ------------------------------------------------------------
A0A404MRF7      LNELTFREAEISQLFK-------------------------KDHPTYRALNEKRQTLENE
A0A3R4D168      LNKLRAAMQMRVKHVLGKGLGDQELVSSRTTSEERFLADLVTAQTEVAQLDARAAALKAS
A0A0F9HWF5      ISTVRGMIDDEIFRVVD------------------------SMKSQYDVALRNELALKGE
A0A2H9T3X6      LAKLDMQIEQMSQRYTA------------------------NHPVMEELQLQRQLIVDRQ
A0A380TAR7      LEKFRAKIEAEMERVLK------------------------GYATAVSVATAREDSLERE
A0A407YHX1      KKEISQQIFQELQQLTG------------------------SFKNEVDVANSRVQSLRDS
A0A3R4QZA0      ------------------------------------------------------------
A0A3R5GLV2      MQEYRRLMFQEISRIAQ------------------------SYKSDLEVSEAKEKSLAES
A0A3R4UA41      LLESQQLRRELLSR-FT------------------------ESNPKVRMIDGQIAAVRHE
A0A0F9C030      EQARQIIQQELGPALFD------------------------MARQQCDEAVASERAISAA
A0A0F9G9C6      LQELELKRLELGRK-FK------------------------KDHPTYQGIIEQIAAVNEQ
A0A2P2C6F5      -LDLDVPPSEIAGR-FS---------------------------------------ATVN
A0A3R2Y861      QLDLKEKRRELITR-YT------------------------DEHRYVRALDAQLQEGAAA
A0A3R3WRK8      QLDLKEKRRELITR-YT------------------------DEHRYVRALDAQLQEGAAA
A0A3R3W423      ISELKLKQAEMEHR-FT------------------------REHPSYQALMTQMGQLDQQ
A0A3R5NV43      ISELKLKQAEMEHR-FT------------------------REHPSYQALMTQMGQLDQQ
A0A3R2VV23      ISELKLKQAEMDRK-FT------------------------REHPAYRALMTQLGELTNK
A0A3R3PPN7      ISELKLQQAEMDRK-FT------------------------RQHPAYQALVKQLGELSTK
A0A404ALK7      ------------------------------------------------------------
A0A3R4HE49      ------MRQDLTKD-LV------------------------QAEINNLGYATRVDALKTL
K1S5Q5          ------------------------------------------------------------
A0A0W8FVN7      FASNPAQIQQLTAK-VL------------------------EEEVRYQSLLSSHKELDEL
A0A407LWW7      ------------------------------------------------------------
A0A409DV79      ------------------------------------------------------------
X0S5W7          EAVTHQRDTS-------------------------------HITMLEQNVLRLRRLHDAI
A0A404N310      KNLNLRIQSKIQSI-RR------------------------SVEVIQERILEQAKVIRGK
A0A408M394      KNLNLRIQSKIQSI-KR------------------------SVEVIQERILEQAKVVKGK
A0A3B1DSI5      ------------------------------------------------------------
A0A3R4U3E9      IQQLRLKQAEMDRS-FT------------------------REHPAYRALLRQIGDLEGR
A0A3R1HJ57      LNELTFKEAEISKL-YT------------------------KVHPAYRTLLEKRKTLEDE
A0A3R2KDK8      LNELTFREAEISKL-YT------------------------REHPAYRALMEKRATLEQE
A0A3R4U8W0      LNELTFKEAEISKL-YT------------------------KVHPAYRTLLEKRQALEDE
A0A404C9H2      ------------------------------------------------------------
A0A408ANB0      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A3R4ZJ07      --------------------------------------------------------MNKQ
A0A409P464      ISELKMQQAEMDRK-FT------------------------RQHPAYRALMTQIGELTQQ
A0A3R3EEA8      ------------------------------------------------------------
A0A3R5AYY7      ------------------------------------------------------------
A0A408AG77      ------------------------------------------------------------
A0A406QJE9      ------------------------------------------------------------
A0A3R5CIW6      ISELKLKQAEMEHR-FT------------------------REHPSYQALMTQMGQLDQQ
A0A3R2KDF2      ------------------------------------------------------------
A0A3R3PAM0      ------------------------------------------------------------
A0A3R3G320      ------------------------------------------------------------
A0A404NRH5      ------------------------------------------------------------
A0A3R1RKC9      ------------------------------------------------------------
A0A3R4GVU7      ------------------------------------------------------------
A0A3R1GW93      ------------------------------------------------------------
A0A3R5DAG0      ------------------------------------------------------------
A0A406DTV4      ------------------------------------------------------------
                                                                            

A0A3R1QQP6      ------------------------------------------------------------
A0A3R5TF76      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
A0A3R4S1T4      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
A0A3R3TMZ8      ------------------------------------------------------------
A0A405KPI1      ------------------------------------------------------------
A0A404XVD4      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
A0A3R5S6P1      ------------------------------------------------------------
A0A3R2EVW0      ------------------------------------------------------------
A0A3R5HKR2      ------------------------------------------------------------
A0A404X108      ------------------------------------------------------------
A0A405D7C3      ------------------------------------------------------------
A0A404A688      ------------------------------------------------------------
A0A409R088      ------------------------------------------------------------
A0A3R4T9I0      ------------------------------------------------------------
A0A3R5C7Q1      ------------------------------------------------------------
A0A3R2KBB7      ------------------------------------------------------------
A0A3R3NKS5      ------------------------------------------------------------
A0A3R3PBR3      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A3R5TDH0      ------------------------------------------------------------
A0A409P6G9      ------------------------------------------------------------
A0A3R3YDR2      ------------------------------------------------------------
A0A3R4BTI6      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A3R1GI32      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------MGKVSR
A0A3R2TTF1      ENVARGKAMQVPQKQRVMLSVERQQKVKEELYLYLLNKREENAIN--QAMTEDNIRVIDP
A0A408BKC9      ------------------------------------------------------------
A0A409SIT6      ------------------------------------------------------------
A0A3R3BMP0      ------------------------------------------------------------
A0A3R4HSN4      ------------------------------------------------------------
A0A3R1RAJ9      ------------------------------------------------------------
A0A406EFX4      IGRARGTLAGNNAAAVRLNELERNAEAVRTLYKGLLDRYQETTSR--AGVETADSRIVSA
A0A408LKC9      ------------------------------------------------------------
A0A3R5KFR9      ------------------------------------------------------------
A0A404MRF7      KARLNKRVTAMPSTQQEILRLSRDVDSGRAVYQQLLTRQQELSIS--RSSAIGNVRIIDS
A0A3R4D168      RGEYESRFSSLPAKDQQLAQLNRRKAAAEQTYEVFLKREQEMRIT--EAMNLGNVRMVEE
A0A0F9HWF5      LVRLKEESQSLGKHAVAYSVLARDVYTNKEMYEVLLKRLKETSIT--GGMQTTNVRVLDE
A0A2H9T3X6      -DKFSDQARGLPKTQQEVMRLARDVQVSTEVYTELLNKAQELKIV--KASAVGNVRILDH
A0A380TAR7      LNKLKSKQALANSREIELRELEREAEANRKLLETFLTRLKETTPQLDTEMQVPGATVLSP
A0A407YHX1      IDKVAGRNSQANITMVQLRELEQRSTALRTLYQSYLGRFEEASQK--QSLPIAKARIISE
A0A3R4QZA0      ------------------------------------------------------------
A0A3R5GLV2      VAKATDISNSASETQVQLRELQREAETYKNMYQTFLQRYQEAMQQ--QSFPVTEARVISK
A0A3R4UA41      IEGLETRVSAMPAIQRDALRLERDVRVNGELYKSMLDSSLQLRLV--KEGKIGNVRLLDT
A0A0F9C030      YEEEKQAAVSLYGTLAELQIIERDLEHLHAFHETLLDRVKDLNLG--QDKGIIRTSILTP
A0A0F9G9C6      KKALVGEVGNLPETQQELLRLRRDVEVSNQIYTLLLSKTQELDIV--RAGTVGNVRIIDY
A0A2P2C6F5      ADVNALTITAIGSTPEQARDLANGVVDAVVEYAQEVDTGESNP----KRDPLTRVVPVQP
A0A3R2Y861      LALNQARTRNLPLIEQTLLQRQRKMKVDTELYTNRLNARQQLALV--RAGKVANVRLIDP
A0A3R3WRK8      LALNQARTRNLPLIEQTLLQRQRKMKVDTELYTNRLNARQQLALV--RAGKVANVRLIDP
A0A3R3W423      KRGLEKKVKNLPETQQELLRLARDMQVTTEIYTQLLNKTQELDIV--RAGTVGNVRVIDS
A0A3R5NV43      KRGLEKKVKNLPETQQELLRLTRDMQVTTDIYTQLLNKTQELDIV--RAGTVGNVRVIDS
A0A3R2VV23      QDGLAKKVQSLPSTQQELLSLTRDVRVGTEIYTQLLNRSQELDVM--RAGTVGNVRLIDG
A0A3R3PPN7      QKRLSKKVEGLPETQQELLRLTRDVQVGTQIYTQLLNKAQELDVM--RAGAVGNVRVIDT
A0A404ALK7      --------------------MQREVEANRALYDTFMTRLKETAAT--SDLETANARVVDQ
A0A3R4HE49      VSNYNSRLTGLPNKELQLTRLMRNASVTAELYKMLLQKQQEARIS--ENMNLGNVRIVEE
K1S5Q5          DIKNWVSIEAVEDTAIINLTVTTPNADVSYGIANAYVNNYESAIN--AAFPSTTLTVIDP
A0A0W8FVN7      VQRYEVRFNEMPKRTLDLARLQRIKEANEKLYLLVEEKYQEAQIN--EQSTPGNVLIIDA
A0A407LWW7      ------------------------------------------------------------
A0A409DV79      -----------------------------------MNNAQQLRLI--RAGKVGNVRILDA
X0S5W7          IDQIAGVDLRQGHGEIQ-------------------------------------ATIIKD
A0A404N310      IGIVEGEYLKMPQKKMEYNRLKSLQDLNEKYYTLLTEKKIMYSIS--NAGYTSNNRVLNE
A0A408M394      IGIVEGEYLKMPQKKMEYNRLKSLQDLNEKYYTLLTEKKIMYSIS--NAGYTSNNRVLNE
A0A3B1DSI5      ------------------------------------------------------------
A0A3R4U3E9      KGGFQKQVGDLPETQQELLRLTRDLQVSNELYTALLNQAQQLDVA--RAGAVGNVRIVDP
A0A3R1HJ57      KARLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKIT--EASTVGDVRIVDA
A0A3R2KDK8      KGKLNKRVSGMPKTQQEIIRLTRDVDAGKEIYMQLLNKQQELSIT--KASTVGNVRIVDP
A0A3R4U8W0      KTKLNNRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKIT--EASTVGDVRIVDP
A0A404C9H2      --------------------------------MQLLNKQQELGIT--KASTVGNVRIVDP
A0A408ANB0      -------------MEQDTLRLMRDVKVNNELYVGLLNSMQQLRLV--KAGKVGNVRLLDK
X0T0M9          ------------------------------------------------------------
A0A3R4ZJ07      RHGLEKKVQDLPATQQELLNLTRDVEVATQIYTQLLNKSQELDIV--RAGAVGNARLIDS
A0A409P464      QKALESKAQDLPATQQELLNLTRDVEVASQIYTQLLNKSQELDIV--RAGAVGNVRLIDT
A0A3R3EEA8      --------------------------------------------------------MIDG
A0A3R5AYY7      ----------------------------------MLNRSQELDVM--RAGTVGNVRLIDG
A0A408AG77      --------------------------------------------M--RAGKVANVRLIDP
A0A406QJE9      ------------------------------------------------------MRIVDP
A0A3R5CIW6      KRGLEKKVKNLPETQQELLRLTRDMQVTTDIYTQLLNKTQELDIV--RAGTVGNVRVIDS
A0A3R2KDF2      --------------------MARDMQVTTEIYTQLLNKTQELDIV--RAGTVGNVRVIDS
A0A3R3PAM0      --------------------------------------------------------MIDS
A0A3R3G320      --------------------------------------------------------MIDS
A0A404NRH5      --------------------------------------------------------MIDS
A0A3R1RKC9      ---------------------------------------------------MGNVRLIDT
A0A3R4GVU7      --------------------------------------------M--RAGTVGNVRLIDT
A0A3R1GW93      ------------------------------------------------------------
A0A3R5DAG0      ------------------------------------------------------------
A0A406DTV4      ------------------------------------------------------------
                                                                            

A0A3R1QQP6      ------------------------------------------------------------
A0A3R5TF76      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------MERIKQAILRAKNHQSSEANLAQLRPDGQG
A0A3B0VRL8      ------------------------------MGKVFKALNKAMSNPDDSASPPASTPEPSI
K1SQJ7          ------------------------------------------------------------
A0A3R4S1T4      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
A0A3R3TMZ8      ------------------------------------------------------------
A0A405KPI1      ------------------------------------------------------------
A0A404XVD4      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
A0A3R5S6P1      ------------------------------------------------------------
A0A3R2EVW0      ------------------------------------------------------------
A0A3R5HKR2      ------------------------------------------------------------
A0A404X108      ------------------------------------------------------------
A0A405D7C3      ------------------------------------------------------------
A0A404A688      ------------------------------------------------------------
A0A409R088      ------------------------------------------------------------
A0A3R4T9I0      ------------------------------------------------------------
A0A3R5C7Q1      ------------------------------------------------------------
A0A3R2KBB7      ------------------------------------------------------------
A0A3R3NKS5      ------------------------------------------------------------
A0A3R3PBR3      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
X1SDZ3          ---------------------------------------------------------LVF
A0A0F9CMN4      ------------------------------------------------------------
A0A3R5TDH0      ------------------------------------------------------------
A0A409P6G9      ------------------------------------------------------------
A0A3R3YDR2      ------------------------------------------------------------
A0A3R4BTI6      ------------------------------------------------------------
A0A3B1CXE3      ----------------------------------MSRIERAMEKAAKIRISAERSPSVDK
A0A3B1CYP8      ----------------------------------MSRIERAMEKAARIRGSAERSPAVDS
A0A382PKY1      -------------------------------------------------NLSVLGIIPSI
A0A3B1DET2      ------------------------------MGKITSALKKAAEERIN-----------RI
A0A3B1D1Y9      ------------------------------MSRIEEILEKAARMREG-------------
A0A3R1GI32      ------------------------------------MLEEH-----------GINVYASI
K1ULC5          ------------------------------------MLDTTIRGRKDIEDNLAVPFLGDI
A0A3B0VG16      ALDKAGAPIKPDENSFIPADVTPG-------------------SRDAVVERKKVPGGTKT
A0A3R2TTF1      AIVS-FDAVAPSKMRKLGLGMAIGFILPAIVIMTLSILDTGVRRRQDIEEAIDVPLLGEI
A0A408BKC9      ------------------------------------------------------------
A0A409SIT6      ------------------------------------------------------------
A0A3R3BMP0      ------------------------------------------------------------
A0A3R4HSN4      ------------------------------------------------------------
A0A3R1RAJ9      ----------------------------------MEMLDDGLLTADDVEARLGLPTLGSV
A0A406EFX4      AKAP-GSPSSPNIPVNLVLGFIFAVGAGLTAVVIMEMLDDGLLTADDVEARLGLPTLGSV
A0A408LKC9      ----------------MLIGSLLGAVLSVALILIKQMLNRGVEDPAQIE-ELGLPVYASI
A0A3R5KFR9      ----------------------MGFVLSVGIVLLRMAMKRGIETPEQLE-MQGITVLATL
A0A404MRF7      AVTQ-PEPIKPQKPLIVVIGGLLGFVLSLGIVLLRMAMKRGIERPEQLE-MQGITVLATL
A0A3R4D168      ATVA-SA-SASGYSRTVSLAALLGLIFGLGVALLIEFLDDRIRRPEEAENVLELPILGML
A0A0F9HWF5      AIPP-TIPFRPRRMLNILLAIVLGLFMGPVVAISFEYMDSSVKTPEDIERYLRVPYLGPL
A0A2H9T3X6      ALSG-ITPVKPKKPLIFVLAVLLGGMCGTGFVFLRDMLRQGVKTPEEIEAKTGLSVFATI
A0A380TAR7      AAVP-LR-SLPDKRIVLAVATIIALLLGLGLALMAERLDYGFRHAEQVSEATGLPVIAHL
A0A407YHX1      AGLP-TSPSSPKKTMTMALSVVLGLMLGGGIAALLEFRDRFFHTGNDVRDNLRMRFLGYL
A0A3R4QZA0      -------------------------------------MRSGIKDSAQIENELDLPVYATV
A0A3R5GLV2      AMPP-RIPSKPNKPIILALFMIMGAAAGGGIAMFREFRDRFFRTGEQVRDVLGLEFLGNT
A0A3R4UA41      AVEP-RRAVKPQKPLVVALSLVLGLLTGVALAILRSKLSSGIRNPQEIEDRLGLNVYSVV
A0A0F9C030      PKTP-GGPVWPNLSMIAMFSIAIGFGMGLGIVYIQDLLDDHFRSPEELRIQLGLPVLAMV
A0A0F9G9C6      AEVNTSKPVKPKKALIVVMTTMLGGMLAVAIVLVQKAMHKGVEDPNEIE-AIGLPVYASV
A0A2P2C6F5      AQLP-GAPFTPDYVKAAMKGAAGGLALAYAFLIARRLIDRRIRSVKHVEDATGAAVLGII
A0A3R2Y861      ATPP-ETPFMPRRGVAVGGSLLAGLFAGLVLATFRRRMAGAVQDREEIEIATGLPVYATV
A0A3R3WRK8      ATPP-ETPFMPRRGVAVGGSLLAGLFAGLVLATFRRRMAGAVQDREEIEIATGLPVYATV
A0A3R3W423      ADANIEKPVKPKKALIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEVIE-QLGIPVYASI
A0A3R5NV43      ADANIEKPVKPKKMLIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEVIE-QLGIPVYASI
A0A3R2VV23      ADVDRTKPVKPKKILIVLVATLFGAFLAVALVLLRKAINRGIESPEVIE-KLGLPVYASV
A0A3R3PPN7      ADVDVTKPVKPKKPLIVLIATMLGLFVAIALVLVRKALNRGIENPEAIE-QLGLPVYASI
A0A404ALK7      SVVP-TQPIKPQKSLIISMAGILALMAGIGLSLLLEMLNNTFKGAEEVEAKLNLPVLGIL
A0A3R4HE49      AVMP-EKPIKPKKLQNMLVALVVGLMFGVGAAMFLEYLDDTIQTADDAEAIAELPTLGII
K1S5Q5          PLLASAPDRDASAKIYTIVGFAAGLVISIFAIVLAVIAKDTVKTADDVKDKLGVDVIGMV
A0A0W8FVN7      ARQP-ENPSKPNRILIIAVGLVLGLGFGFGFAFVRNYFDNTVKTPEELQ-QKNISLLAWI
A0A407LWW7      ------------------------------------------------------------
A0A409DV79      AVQP-DRPVRPKAAIIIGVATVIGLIFGMLCAFVRNALFGGLSEPDDVERYTGLPVLAAI
X0S5W7          ATAS-GQIVSPKISRIIACWILGTLGIGFVLVYVQDTIDDRFRTPEELSKRVGHPLIGLV
A0A404N310      ASLN-FTPVSPNRKLVYAGFIFIGFVSGFAFLFFKYVTFNEINTIDDLKHLLPDKVTVLG
A0A408M394      ASLN-FDPVSPNRKLVYAGFIFIGFVSGFAFLFFKYVTFNEINTIDDLKHLLPEKVTILG
A0A3B1DSI5      -------QVSPNFTRMMTIGGLLGFLVGAGFAFLRETFDKRFSAPEDIQQQLGVPVIGHV
A0A3R4U3E9      AIVDIAHPVAPRKGLIVAIATLLGAFLSVAFVFLQRMLNPGIEDPADIE-ALGLPVYAAI
A0A3R1HJ57      AIAQ-PGMVKPQRALIILGSIILGLMLSIMGVLLRSLFNRGIESPAVLE-EAGIGVYASI
A0A3R2KDK8      AVTQ-PNPVKPRKTLIVLLATFLGGMLSVAIVLLKTMLHKGIETPEQLE-QDGINVYASI
A0A3R4U8W0      AITQ-PGVLKPKKALIILGSMILGLMLSIVGVLLRSLLNRGIESPQVLE-ENGISVYASI
A0A404C9H2      A-VTQPRPVKPQKTIIVLIVTLLGGLFSTGFVLLKTMLHRGIESPEQLE-QQGINVYASI
A0A408ANB0      ALVP-EEPVKPRRVIVLALAAVLGVALGVVAAFVRNALHGGIKDPKDIERHTGLNVYATV
X0T0M9          -AISPLNRTSPNTKVNLAVGLLLGLGLGALAAFLIEQTDNSIKNVSDIE-RKGINVLGII
A0A3R4ZJ07      ADVDITSPVKPRKALIILAATLLGGFVGVALVLVRKSLGRGIEGPDAIE-KLGLPVYASI
A0A409P464      ADVDLTNPVKPRKPLIVLIATFLGAFFGVALVLLRKSLSRGLEGPEAIE-QLGLPVYASI
A0A3R3EEA8      ADVDRTKPVKPKKILIVLVATLFGAFLAVALVLLRKAINRGIESPEVIE-KLGLPVYASV
A0A3R5AYY7      ADVDRTKPVKPKKILIVLVATLFGAFLAVALVLLRKAINRGIESPEVIE-KLGLPVYASV
A0A408AG77      ATPP-ETPFMPRRGVAVGGSLLAGLFAGLVLATFRRRMAGAVQDREEIEIATGLPVYATV
A0A406QJE9      AVVDTANPVKPRKALIVAIATLLGGFLSVAFVFLQRMLNPGIEDPADIE-ALGLPVYAAI
A0A3R5CIW6      ADANIEKPVKPKKMLIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEVIE-QLGIPVYASI
A0A3R2KDF2      ADANIEKPVKPKKMLIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEVIE-QLGIPVYASI
A0A3R3PAM0      ADANIEKPVKPKKALIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEVIE-QLGIPVYASI
A0A3R3G320      ADANIEKPVKPKKALIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEVIE-QLGIPVYASI
A0A404NRH5      ADANIEKPVKPKKALIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEVIE-QLGIPVYASI
A0A3R1RKC9      ADVDRTKPVKPKKALIVLVATLLGAFLAIALVMLRKALNRGLESPEAIE-QLGLPVYASI
A0A3R4GVU7      ADVDLRKPVKPRKPLIVLIATLFGAFLATALVLFRKALNRGVENPDQIE-QLGLPVYASI
A0A3R1GW93      -------------------------------------------------------MYASI
A0A3R5DAG0      -------------------------------------------------------MYASI
A0A406DTV4      -------------------------------------------------------MYASI
                                                                            

A0A3R1QQP6      ------------------------------------------------------------
A0A3R5TF76      ------------------------------------------------------------
A0A382GX28      ----------------------------------------------------SPHAEAYR
A0A0F9BMP5      ------------------------------------------------------------
A0A1J5SIM8      K------SFKSNISKSQDE---LVDFRYENTRVVKLEKEHLEKNRIVAFDKSNPMSMNFD
A0A3B0VRL8      K------TERQPTPAKRETPTVSVTGSMDNTSGV----NNWDEKLVAFSAPSSIITENIR
K1SQJ7          ------------------------------IPQIQAPDRKSKPVLVLGENSSFAVRESYN
A0A3R4S1T4      -------------------------------------------MRVAVEAPRSQFAETLR
A0A3B0VF49      ------------------------------------------MDLVTITDPRSPRSEAYR
K1RRH4          ---------------------------------------MKSTDLIINVNPKSIFSESIK
A0A3R3TMZ8      -------------------------------------MVSVIKDLIAYSDPKSSSAEAYR
A0A405KPI1      -----------------------------------MLQRTNKRPIITHENPKSPISEAYR
A0A404XVD4      ------------------------------------------------------------
A0A3B0Z1H7      ----MSDQKVDVIPARRMPEDDLSGVRYKQTKPIKISKSQLKENRIISGMDLGVEMDAYR
W1Y9X6          -----------------------------------------MAKRGAYDEGNFELNESYR
X1MSI7          ------------------------------------MPNKYSDWLVVKSKPKSHVSEAYR
J9H061          ---------------------------------------------MVQEGNRDVINEAFR
A0A3R5S6P1      ----------------------MLQKAEEDKRSTGKSRSAKAAPLLAVSHPTDLAVESLR
A0A3R2EVW0      --------------------------------------MRLNEALLAARNPADLAMESLR
A0A3R5HKR2      --------------------------------------MPLNEALLAARNPADLAMESLR
A0A404X108      --------------------------------------MPLNEALLAARNPADLAMESLR
A0A405D7C3      --------------------------------------MPLNEALLAARNPADLAMESLR
A0A404A688      ------------------------------------------MPFLPVDRPLDIFVEAIR
A0A409R088      ------------------------------------------MPFLPVDRPVDVFVEAIR
A0A3R4T9I0      ------------------------------------------MQLLAVTSPESLAIESLR
A0A3R5C7Q1      ----------------------MPLALEQETILEHIAGGAKGVQLLAVTSPESLAIESLR
A0A3R2KBB7      ------------------------------------------------------------
A0A3R3NKS5      ----------------------------------MSQQPSKQRHLITVTNPRSPVSEAFR
A0A3R3PBR3      ----------------------------------MSQLPNKQRHLITVTNPRSPVSEAFR
W1YAG3          -----------------------------------------MGRITSLEKPQSNISEAYR
X1SDZ3          LIEYLDTSLRTIEDVEKYLPWPVLGIIPRFEQAFEGKIPHSDIQPVVRKHPKSVPAEAYR
A0A0F9CMN4      ------------------------------------------------------------
A0A3R5TDH0      ------------------------------------------------------------
A0A409P6G9      ------------------------------------------------------------
A0A3R3YDR2      ------------------------------------------------------------
A0A3R4BTI6      ------------------------------------------------------------
A0A3B1CXE3      P--PAIHRDQPCL--EGIETVIDKAMTDK--------------CIVTLAEPQSPAAEQYR
A0A3B1CYP8      PAAPVIHRDQPCFECECIEAVIDRALADK--------------HIVTLTEPQSPAAEQYR
A0A382PKY1      GNPDKKRRRWLMAKNRSTSNTRGLRR-----------------RLITKEDPKSPVSEAYR
A0A3B1DET2      DKITKIQER------DQMVIKKIGESNVDP-------------RIVTYFDPKALITEQYK
A0A3B1D1Y9      -EKNGEKSRKISPPGSKVPGVVRQARIENP-------------NLVTIVDPDSPTAEEYR
A0A3R1GI32      PLSEWQKSR------DSVKTVHGVKRYKQS-------------QLLAVGNPTDLAIEAIR
K1ULC5          PQYSGEKQR------GS---------------------------FVVRENGRDPVSEAFR
A0A3B0VG16      SPSPAPTVNTFEGWDE---------------------------RLVAASRNFSGVVESFR
A0A3R2TTF1      P------LANNKRTSQN--------------------------NILVSAMGRDPLTEAFR
A0A408BKC9      ------------------------------------------------------------
A0A409SIT6      ------------------------------------------------------------
A0A3R3BMP0      ------------------------------------------------------------
A0A3R4HSN4      ------------------------------------------------------------
A0A3R1RAJ9      P-----LLMSIADRKDRHMPP----------------------TEYLLARPLSGFAEAFR
A0A406EFX4      P-----LLMSIADRKDRHMPP----------------------TEYLLARPLSGFAEAFR
A0A408LKC9      PVS--VQQQTDSVRGKFRADGRLH--------------------LLAIKDPADLAIEAVR
A0A3R5KFR9      PRSEWLWKKTRLRSKRFISERWNHRTRNV--------------PFLPVDRPVDVFVEAIR
A0A404MRF7      PRSEWLWKKTRLRSKRFISERWNHRTRNV--------------PFLPVDRPVDVFVEAIR
A0A3R4D168      P--------WVEGREASRRRLVVL------------------------EDPRSPVTESYR
A0A0F9HWF5      P----DFHGQESERAGGRSTMLVT-----------------------SLDPKSVPAEAYR
A0A2H9T3X6      PQSEQNLLLERNARKQGGGFMLAQ------------------------SAPDDLAVESLR
A0A380TAR7      P-----V-----ARSGRDGPEAAM-----------------------LDSQPSLFLEGIR
A0A407YHX1      P-----FIGERGVENAKAGTSAATPGGEHATLDESGQVSFQKMLRLAVDSPRSSFAETLR
A0A3R4QZA0      P-----RSPVQESRINILKKKKNI-------------------PILAVKNSDDIAIESLR
A0A3R5GLV2      P-----LIPNKPATEAPESGHPGLTLPTSV-------------ARYAVDHPLSSFAETLR
A0A3R4UA41      P-----L-ALEQETILEHIAGG----AKGV-------------QLLAVTSPESLAIESLR
A0A0F9C030      -----------------GKLEPQTNVGVDA-------------LHVHV-QPNAVESEAFR
A0A0F9G9C6      P-----Y-SDYQDKLTGFSKALKNKVSKPK-------------SILALDNPADLSIEALR
A0A2P2C6F5      P-----K-ED----------------ALGR-------------THRGVRGDLGRAAESFR
A0A3R2Y861      P-----R-SRLTSEAKPGRPNWPLRLASPA-------------ERAVL---PDAAIESLR
A0A3R3WRK8      P-----R-SRLTSEAKPGRPNWPLRLASPA-------------ERAVL---PDAAIESLR
A0A3R3W423      P-----L-SK-GQSQIEGTLKGNNRASTGS-------------LLLAVNNPADLAVESLR
A0A3R5NV43      P-----L-SK-GQSQIEGTLKGNNRASTGS-------------LLLAVNNPADLAVESLR
A0A3R2VV23      P-----Y-SLLQKTEEQKKSRTPNRTGKAP-------------SLLAIHHPTDLSIEALR
A0A3R3PPN7      P-----Y-SVLQKAEEDKRGKGKSRAAKAA-------------PLLAISHPTDLAIESLR
A0A404ALK7      P------LVKNKHRSQI--------------------------ASLFSSNEDKSFSESIR
A0A3R4HE49      P-----WLRSQTDA-----------------------------KLITLADPRSPASEAYR
K1S5Q5          A-----HVNRKKKKKGEEYKP----------------------LLISDRRSGFPFIETFK
A0A0W8FVN7      P-----EMFVADKNRAPGS------------------------EFIVNKKSDSTASEAYR
A0A407LWW7      ------------------------------------------------------------
A0A409DV79      P------YSDMQDKLWRRSRRKNATVP----------------ALLAQSQGNSPPIESLR
X0S5W7          R------ALPELSGEGLK-------------------------KVSAFGDPVSVFVESFR
A0A404N310      N------IPLLKESTEYS-------------------------QLLVHNTPKSILAESMR
A0A408M394      N------IPLLKDSSEYS-------------------------QLMVHNSPKSILAESMR
A0A3B1DSI5      P--------------NISIKRRKKNALSQLDP-----------SVCTFHLPKSKASEAFR
A0A3R4U3E9      P------LSVSNTLPKLRKGKHGTRVVSDGRQ-----------HLLAVSAPADPTVEALR
A0A3R1HJ57      P------LSEWQKSRDNATVRGVKAAKRNKQS-----------QLLAVGNPTDLAIEAIR
A0A3R2KDK8      P------LSEWQQKKDRETLLSSKRKSNTRSN-----------SLLAVGNPADLAIEAIR
A0A3R4U8W0      P------LSEWQ--KSRDSVKTVKGIKRYKQS-----------QLLAVGNPTDLAIEAVR
A0A404C9H2      P------LSEWQQKSDRETMLSGKRSSTKS-Y-----------TLLAVGNPADLAIEAVR
A0A408ANB0      V------LSQAQGAITEEFHSSKRGN-----------------RLLASRCPNDPAVESLR
X0T0M9          P-----DISKSKSATKKRNITRKTQKTPKGQEGTINIARDIKRRIITKEDPRSPISEAYR
A0A3R4ZJ07      P------YSVLQQEEDSKKLRLANGVNSQ--S-----------FLLAQRNPTDLSIESIR
A0A409P464      P------YSALQQEEDSKKVRAKDGTDKP--A-----------YLLALRNPTDLSIESIR
A0A3R3EEA8      P------YSLLQKTEEQKKSR-TPNRTGKA-P-----------SLLAIHHPTDLSIEALR
A0A3R5AYY7      P------YSLLQKTEEQKKPR-TPNRTGKA-P-----------SLLAIHHPTDLSIEALR
A0A408AG77      P------RSRLTSEAKPGRPNWPLRLASPAER-----------AVLP-----DAAIESLR
A0A406QJE9      P------LSVSNTLPKLRKGKHGTRVVADGRQ-----------HLLAVSAPADPTVEALR
A0A3R5CIW6      P------LSKGQSQIEGTLK--GNNRASTG-S-----------LLLAVNNPADLAVESLR
A0A3R2KDF2      P------LSKGQSQIEGTLK--GNNRASTG-S-----------LLLAVNNPADLAVESLR
A0A3R3PAM0      P------LSKGQSLIEGTLK--GNNRASTG-S-----------LLLAVNNPADLAVESLR
A0A3R3G320      P------LSKGQSQIEGTLK--GSNRASTG-S-----------LLLAVNNPADLAVESLR
A0A404NRH5      P------LSKGQSQIEGTLK--GNNRASTG-S-----------LLLAVNNPADLAVESLR
A0A3R1RKC9      P------YSTLQKAEEDKNTR-GQGRANRA-A-----------PLLTTSHPTDLAVEALR
A0A3R4GVU7      P------FSSLQKSEESKILRSGRGRANKV-A-----------PILASSHPTDLAIEGLR
A0A3R1GW93      P------FSTLQKGEESKTLRSGRGRANKA-A-----------PILASTHPTDLAIEGLR
A0A3R5DAG0      P------FSSLQKSEESKILRSGRGRANKV-A-----------PILASSHPTDLAIEGLR
A0A406DTV4      P------FSSLQKSEESKILRSGRGRANKV-A-----------PILASSHPTDLAIEGLR
                                                                            

A0A3R1QQP6      -------------------------MPSEGKSTISINLAQLLAGQ-GS-RVLLLDADIRN
A0A3R5TF76      -------------------------MPSEGKSTISINLAQLLAGQ-GS-RVLLLDADIRN
A0A382GX28      VLRTNILFAGRKDES-QTTFSVVSGGAGEGKTTTMFNLAVVFAQM-GD-RILIVDSDLRR
A0A0F9BMP5      ---------------AGQAIALTSACPREGKTMLTLSLAMALNAMKDQ-RAVILDCDLRR
A0A1J5SIM8      LLRTHVLQKM-EEN-GWRTLAITSPTPEAGKTVIAINLAMSIAQQTNR-TAMLVDFDLRR
A0A3B0VRL8      HLRNRILHPP-SGGPALRRVMTTSALPGEGKSMLCSNLAISMAQGLEQ-HALLVDCDLRR
K1SQJ7          TIRANLLFTG-KGER-CPVYAVTSADKDEGKTLNSVNIAISYAQ-LGK-KVLLIDGDMRN
A0A3R4S1T4      NTKLACDIVL-QGKK-CAVIGVVSCLPGEGKSTVAANFAGLIAS-SGA-RTLVIDADLRN
A0A3B0VF49      TLRTNLSFYS-LDTP-LQTLVVTSPVMGEGKSSTVANLAVTMAQ-SGR-KIVLVDCDLRR
K1RRH4          TIRTNLAFSA-IGNE-MKVLLATSPAAGDGKSFISANLAVAYAQ-EGK-KVLMIDCDLRR
A0A3R3TMZ8      TLRTNLQFSM-LDKD-SNIIAVTSCAPGEGKSTIIANLAVSLAQ-SGK-KVLLVDCDLRK
A0A405KPI1      ALRTNIQFSA-IDED-IRVIMVTSAGPGEGKSTTINNLATAYAQ-SDK-KVLIIDADLRK
A0A404XVD4      --------------------MISGPSPGVGKTFVSVNLAAVIAQ-AGR-RVLLIDVDMRK
A0A3B0Z1H7      KLRTRVLKKM-KKNN-WNVLAVTSPAPGAGKTLTAINLAISIAMEVDK-TVLLIDADLRQ
W1Y9X6          EIRTYVT----INKN-IKTILVTSAEMDEGKTTIICNLAKCFSELEGV-RVLLIDCDFRK
X1MSI7          TLRTNIEFSN-LDKP-LNTIMVTSAVPQEGKTTNTVNLALTIAE-SGK-KVIIVDVDLRV
J9H061          VLRTNLEFMVGKDHS-SNVIVVTSFNPGSGKSFLTMNLAVSLAV-KNK-KVLVIDGDLRH
A0A3R5S6P1      SLRTSLHFAT-LEAE-NNRLMISGPSPSVGKTFVSANLAAVIAQ-AGQ-RVLLIDVDMRK
A0A3R2EVW0      SLRTSLHFAM-MEAK-NNIVMITGPGPGLGKTFVSTNFAATLAM-GGK-KVLVIDADLRK
A0A3R5HKR2      SLRTSLHFAM-MEAK-NNIVMISGPGPGLGKTFVSTNFAATLAM-GGK-KVLVIDADLRK
A0A404X108      SLRTSLHFAM-MEAK-NNIVMISGPGPGLGKTFVSTNFAATLAM-GGK-KVLVIDADLRK
A0A405D7C3      SLRTSLHFAM-MEAK-NNIVMISGPGPGLGKTFVSTNFAATLAM-GGK-KVLVIDADLRK
A0A404A688      GLRTSLHFAM-MDAQ-NNILMFSGPTQDCGKTLVSTSLAALVAQ-VEQ-RVLFIDADMRK
A0A409R088      GLRTSLHFTM-MGAK-NCVVMLTGPTQDCGKTLVATSLAAIVAQ-AGQ-KVLFIDADMRK
A0A3R4T9I0      NLRVSLQLTL-METG-NNRVLITGATPGVGKSFVSGNFAVIMAQ-AGK-RVLLIDADLRK
A0A3R5C7Q1      NLRVSLQLTL-METG-NNRVLITGATPGVGKSFVSGNFAVIMAQ-AGK-RVLLIDADLRK
A0A3R2KBB7      --------------------MVTSSGPEEGKSTVTANLAAAYAQ-ADK-KVLLIDGDLRK
A0A3R3NKS5      ALRTNIDFSS-VDEQ-IQIIMVTSSGPEEGKSTVTANLAAAYAQ-ADK-KVLLIDGDLRK
A0A3R3PBR3      ALRTNIDFSS-VDET-IQVIMVTSSGPEEGKSTVSANLAAAYAQ-ADK-KVLLIDADLRK
W1YAG3          TIRTGIEFSN-LDKD-LKIICITSSKKDEGKTTVLSNLGVSFAK-IDK-KVLLIDADLRN
X1SDZ3          TLKTNIQLAD-LDRP-PRSIAITSAVPLEGKSTTAVNLAVALAQ-KGS-KVLLVDADLRK
A0A0F9CMN4      ---------D-IDNP-PKSLVITSAVPLEGKSTTALNLAVALAQ-KES-KVLLIDADLRK
A0A3R5TDH0      -----------MNGP-HRILVVTSSLPGEGKSTVAANLAYAFGQ-ME--RVLLIDADLRR
A0A409P6G9      ------MLSD-LKQP-HKVLLVTSSIPGEGKTTVSTNLACALGQ-ME--KVLLIDADLRR
A0A3R3YDR2      -----------MDDP-HKILVITSSIPGEGKSTVAANLAMALGQ-ME--KVLLIDADMRR
A0A3R4BTI6      -----------MDDP-HKILVVTSSIPGEGKSTVAANLACALGQ-ME--KVLLIDADMRR
A0A3B1CXE3      KLRARILKAIATKDDSGNTIMITSSDKREGKTITAINLAVAMANVIDY-PVVLVDADLRN
A0A3B1CYP8      KLRARILKAAETKDDSINTIMITSSDKKEGKTITAINLAVAMAKVINY-PVVLVDADLRN
A0A382PKY1      SLRTSMLYSTS-AKE-LKSILVSSAGPGEGKTTTVANLAITYANL-GR-KTLLVDTDLRR
A0A3B1DET2      ILRTNILSLNK-SKP-PKTIVITSSLHSEGKTITSLNLAVALSQAIHKPKVLLVDADMRK
A0A3B1D1Y9      KLKSMVVKLTEMDDF-RNMLMVTSAIGGEGKSVTSLNLAITLAQEYDH-TVLLVDADLRQ
A0A3R1GI32      SLRTSLHFAMM-QAN-NNVLMLTGVSPSIGKTFVCANLAAVVSQT-NK-RVLLIDCDMRK
K1ULC5          MIRSNMNFMNLGKGE-IKVIMVTSSNPHAGKTFVSTNLAMTFATT-GK-KVVIMDLDLRR
A0A3B0VG16      KLRTRILYP--VEGDVPRSILIISADAQEGKSFICANLGLSLAHSVAQ-HALMIDCDLRR
A0A3R2TTF1      ILRTNMSFMA-REGKHPQTITLTSFIPGVGKTFTSLNLSSTLSFL-NK-KVIVVDMDLRK
A0A408BKC9      -------------------------MPGEGKSWTSSNLAVTFAQA-GK-KVVLVDADMRK
A0A409SIT6      ----------MMEAK-NNILMVSGASPASGKSFTSTNLAVVIAQA-GQ-RVLLIDADMRK
A0A3R3BMP0      ----------MLESI-NNRLMISGPSPAVGKTFVSANLAAVIAQA-GQ-RVLLVDVDMRK
A0A3R4HSN4      ----------MMEAN-NNVLMISGASPNIGKTFVSINLAAVIAQT-GQ-RVLVIDADMRK
A0A3R1RAJ9      SLRTSILYAR-LGQA-VKVVTVTSALPGEGKTTTSVCLAISAAQA-GS-RVVVVDCDIRR
A0A406EFX4      SLRTSILYAR-LGQA-VKVVTVTSALPGEGKTTASVCLAISAAQA-GS-RVVVVDCDIRR
A0A408LKC9      SLRTSLHFAR-LEAK-NNIVLISGASPNAGKTFVSSNLAAVIAQA-GQ-RVLIIDADMRK
A0A3R5KFR9      GLRTSLHFTM-MGTH-NRVIMLTGPTQDCGKTLVATSLAAIVAQA-GQ-KVLFIDADMRK
A0A404MRF7      GLRTSLHFTM-MGTH-NRVIMLTGPTQDCGKTLVATSLAAIVAQA-GQ-KVLFIDADMRK
A0A3R4D168      ALQTYTRTVE-PDVR-HQCFMLTSPGPKEGKSTVLANLAITSAQL-GK-RTLIVDTDLRA
A0A0F9HWF5      SIRTSIIFSS-PDDK--RTLLVTSSNPTEGKSVTSSNLAVIMAQN-GA-RTLLLDMDFRR
A0A2H9T3X6      SLRTNLSFTM-MEGK-DNRVMITGPSPGIGKSFVSANLALLLAES-GE-KVLLIDGDMRK
A0A380TAR7      STYIQLALRS-KRPA-IRSLLVTSSMPKEGKTTLAIGLTRARAIA-GH-RALLIDADLRR
A0A407YHX1      NVKLTADVVI-QERQ-CRVIGVISCLPNEGKSVVALNLAGLIAST-GK-RTLVVDADIRN
A0A3R4QZA0      SMRTAIHFAL-SSAR-NNLITISGPAPEVGKSFISTNLATILAQS-DK-RVLIIDADLRR
A0A3R5GLV2      STRLAIDLGISTKSG-ARIVGVVSALPSEGKSTISINLAQLLAGQ-GA-RVLLLDADIRN
A0A3R4UA41      NLRVSLQLTL-MESG-NNRVLITGATPGVGKSFVSGNFAVIMAQA-GK-RVLLIDADLRK
A0A0F9C030      TLRTALALA---EGG-SQRLVVSSSEPGDGKTTVISNLAVAYAQS-GK-RTLLIDADMRR
A0A0F9G9C6      SLRTSLHFAM-MEAK-NNLIAISGPSPGVGKSFVSVNLAAVLAQS-GK-KVLIIDADMRK
A0A2P2C6F5      QLRTNLRFVD-VDNE-PRKIVVTSALAGEGKSTVSANIARLVAQA-GT-PVLLIDADLRR
A0A3R2Y861      TIRTTLHFAL-SEAP-NRVVLITGPTAGIGKSFVAANLATLAGAS-KR-RVLLIDADLRN
A0A3R3WRK8      TIRTTLHFAL-SEAP-NRVVLITGPTAGIGKSFVAANLATLAGAS-KR-RVLLIDADLRN
A0A3R3W423      SLRTSLHFAT-LEAK-NNILMISGPSPAVGKSFVSSNLAAIIAQT-GQ-KVLLVDADMRK
A0A3R5NV43      SLRTSLHFAT-LEAK-NNILMISGPSPAVGKSFVSSNLAAIIAQT-GQ-KVLLVDADMRK
A0A3R2VV23      SLRTSLHFGM-LDAK-NNLLMISGPSPGVGKTFISANLAAVVAQA-GQ-RVLLIDVDMRR
A0A3R3PPN7      SLRTSLHFAT-LEAE-NNRLMISGPSPSVGKTFVSANLAAVIAQA-GQ-RVLLIDVDMRK
A0A404ALK7      TIRTSLVLSG-MSDP-HRILVVTSSIPGEGKSTVAANLAYAFGQM--E-KVLLVDADLRR
A0A3R4HE49      TLRTNIKFLS-ADSP-LRTLTITSAGPEEGKSTTIANLGVSFAQT-GK-KVLIVDTDMRK
K1S5Q5          IIRTKIEHTA-QREK-YKTFVVTSTAENEGKTTSAVNIALALAQN-GK-SVLLVDGDLRK
A0A0W8FVN7      ALRTRIRYSG-VEGTIPKKLLVTSSSAGEGKTTTAVNLAGSFAQA-NQ-KVLLLDCDLRK
A0A407LWW7      ----MLQASL-RQSA-NNMVMFTGPVAGVGKSFLSANFAFIQGGV-GK-RVLLIDADFRK
A0A409DV79      SFRNVLQASL-RQSA-NNMVMFTGPVAGVGKSFLSANFAFIQGGV-GK-RVLLIDADFRK
X0S5W7          TLRTSLTLSG-VDST---RIAFTSSEPGDGKTTVIANLAVVCAQS-GK-KTLLIDGDLRR
A0A404N310      NIRTNLSFVN-SDVR---VIAISSSISGEGKTFVALNLAGIIALS-GK-RTIVIDLDLRK
A0A408M394      NIRTNLSFVN-SNVR---VIAISSSISGEGKTFVALNLAGIIALS-GK-KTIVIDLDLRK
A0A3B1DSI5      AVRTSLYFST-HNAN-HQVLQVTSPNPGDGKSTLASNLAVSIACS-GK-QVLILDCDFRK
A0A3R4U3E9      SLRTSLHFAM-LEAK-NNILTISGPRPGVGKTFVSTNLAAVIAQA-GQ-RVLVIDADMRK
A0A3R1HJ57      SLRTSLHFAM-MQAS-NNVLMLTGVSPSIGKTFVCANLAAVISQT-NK-RVLLIDCDMRK
A0A3R2KDK8      SLRTSLHFAM-LESK-NNVLMISGASPNIGKTFVSINLAAVIAQA-GQ-RVLVIDADMRK
A0A3R4U8W0      SLRTSLHFAM-MQAK-NNVLMLTGVSPSIGKTFVCANLAAVISQT-NK-RVLLIDCDMRK
A0A404C9H2      SLRTSLHFAS-LEAK-NNVLMISGASPSIGKTFVSINLAAVIAQA-GQ-RILVVDADMRK
A0A408ANB0      SLRTALQFAM-LDAG-NNRVLVGGPTPGVGKSFVSANLAAVIAAG-GK-RVLLIDADMRK
X0T0M9          SLRTSITYAS-VDNP-TKTIIVTSPGPGEGKTTTITNLAITFANI-GK-RTLLVDADLRR
A0A3R4ZJ07      SLRTCLHFAG-LDAT-NNRIMISGPSPQVGKTFVSSNLAAVIAQS-GQ-RVVLIDADMRK
A0A409P464      SLRTCLHFAG-LDST-NNRIMISGPSPQVGKTFVSSNLAAVMALS-GQ-RVVLIDADMRK
A0A3R3EEA8      SLRTSLHFGM-LDAK-NNLLMISGPSPGVGKTFISANLAAVVAQA-GQ-RVLLIDVDMRR
A0A3R5AYY7      SLRTSLHFGM-LDAK-NNLLMISGPSPGVGKTFISANLAAVVAQA-GQ-RVLLIDVDMRR
A0A408AG77      TIRTTLHFAL-SEAP-NRVVLITGPTAGIGKSFVAANLATLAGAS-KR-RVLLIDADLRN
A0A406QJE9      SLRTSLHFAM-LEAK-NNILTISGPRPGVGKTFVSTNLAAVIAQA-GQ-RVLVIDADMRK
A0A3R5CIW6      SLRTSLHFAT-LEAK-NNILMISGPSPAVGKSFVSCNLAAIIAQT-GQ-KVLLVDADMRK
A0A3R2KDF2      SLRTSLHFAT-LEAK-NNILMISGPSPAVGKSFVSSNLAAIIAQT-GQ-KVLLVDADMRK
A0A3R3PAM0      SLRTSLHFAT-LEAK-NNILMISGPSPAVGKSFVSCNLAAIIAQT-GQ-KVLLVDADMRK
A0A3R3G320      SLRTSLHFAT-LEAK-NNILMISGPSPAVGKSFVSSNLAAIIAQT-GQ-KVLLVDADMRK
A0A404NRH5      SLRTSLHFAT-LEAK-NNILMISGPSPAVGKSFVSSNLAAIIAQT-GQ-KVLLVDADMRK
A0A3R1RKC9      SLRTSLHFAM-MEAS-NNRLMISGPSPQVGKTFVSANLAAVIAQT-GQ-RVLLIDVDMRK
A0A3R4GVU7      SLRTSLHFAM-LEAS-NNRLMISGPSPKVGKTFVSANLAAVIAQT-GQ-RVLLIDVDMRK
A0A3R1GW93      SLRTSLHFAM-LEAS-NNRLMISGPSPKVGKTFVSANLAAVIAQT-GQ-RVLLIDVDMRK
A0A3R5DAG0      SLRTSLHFAM-LEAS-NNRLMISGPSPKVGKTFVSANLAAVIAQT-GQ-RVLLIDVDMRK
A0A406DTV4      SLRTSLHFAM-LEAS-NNRLMISGPSPKVGKTFVSANLAAVIAQT-GQ-RVLLIDVDMRK
                                             **:     :             :.:* *:* 

A0A3R1QQP6      PGATRAMARH-ASE--GLLEVLLE-GRSV----QDVLLR----DEKT--R-LAFLPTVVK
A0A3R5TF76      PGATRAMARH-ASE--GLLEVLLE-GRSV----QDVVLR----DEKT--K-LAFLPTVVK
A0A382GX28      PSMHRYMNVS---NNIGLTNYLLG-QVTI----DEVIQT----TELP--S-LHFIPS--G
A0A0F9BMP5      SRIAELLNLS---QGVALDSILLGQTCPL----DAVRVD----ERFG----LHVIPV--V
A0A1J5SIM8      PKVGAYLGMH-MEK--SLNDVLNG-TDQL----PDVLVN----PDVP--R-LVVLPT--R
A0A3B0VRL8      SSLAQMLAVN-NSQ--GLSNYLQH-DREL----GEVIRQ----TGLP--K-LSLLPS--G
K1SQJ7          MSVASLLKLRG--RL-GLSQYLAGLRETPQIVE-----------YRQ--N-LDVLVG--G
A0A3R4S1T4      PGLSKMLASEP--EV-GLVDVILNKASWTSVAR--VDRR----SRLT--I-LPMTTR--G
A0A3B0VF49      PSLHTLFNLKA--EP-GFTDAILE---NGEP----ALQE----TAVE--N-LWLLTA--G
K1RRH4          GRQHEIFEVMNLTSG-GYSNLILNYKEDVNLGK--YIMK----TSNA--N-VDLLPT--G
A0A3R3TMZ8      PTIHKKFGISN--AS-GLTSLLLK---ESTLEE--AIYK----VDIP--N-LGLIPS--G
A0A405KPI1      PTLHNTFNVTN--RW-GLTSLLTN---QVGLGE--VIHT----SFIP--N-LDILTS--G
A0A404XVD4      GYVHKMLGAGA--EN-GLSDVLSK---QCALDK--AIHQ----TDIK--G-FDFISR--G
A0A3B0Z1H7      SRVNKYFGLPE--TMLGLSDYLTS---DISLER--LLIN----PGIG--R-LIILPG--G
W1Y9X6          RGVSRYFGIEN--SF-GVSDIVFG---NNKKSE--CIKR------VG--D-LDIITS--G
X1MSI7          PTIHKVFNSDS--KP-GLTNVLVY---NKKLSEVIKKAD----EINS--N-LYYITS--G
J9H061          A-TTSAYIHSP--KI-GLSDYLGG---RIDKLSDIIVTH----ESHA--S-LDIIPV--G
A0A3R5S6P1      GYLHKILGTDE--QN-GLSDLLTK---RCDFDN--AIRN----TDVD--G-FFFIPR--G
A0A3R2EVW0      GYMQKVMGQEM--GA-GLSAYLAG---QTEMMQ--VISK----TGFD--G-LDFVCR--G
A0A3R5HKR2      GYMQKVMGQEM--GA-GLSAYLAG---QTEMMP--VISK----TGFD--G-LDFVCR--G
A0A404X108      GYMQKVMGQEM--GA-GLSAYLAG---QTEMMQ--VISK----TGFD--G-LDFVCR--G
A0A405D7C3      GYMQKVMGQEM--GA-GLSAYLAG---QTEMMQ--VISK----TGFD--G-LDFVCR--G
A0A404A688      GYVHNIFDLKN--DA-GLSDVLSG---KVEFQQ--AVQT----YASG--K-FDVVTC--G
A0A409R088      GYVHQIFSLIN--SH-GLADVLMG---KVEYES--AIQH----YAPG--S-VDVLTC--G
A0A3R4T9I0      GHLQKAFGLPR--KG-GLADVLSG---EMTPEQ--AIHA----QVVP--N-LDVLTT--G
A0A3R5C7Q1      GHLQKAFGLPR--KG-GLADVLSG---EMTPEQ--AIHA----QVVP--N-LDVLTT--G
A0A3R2KBB7      PTAHKTFSLSN--RA-GLSSLLSQ---QAELED--VVQD----SGVA--N-LSIMTS--G
A0A3R3NKS5      PTAHKTFSLSN--RV-GLSSLLSQ---QADLED--VVQE----SGVA--N-LSIMTS--G
A0A3R3PBR3      PTAHKTFSLSN--RF-GLSSLLSQ---QAVLED--TVQD----SGVP--N-LSIMTS--G
W1YAG3          PSISKMFDTS---NAQGLMDILLG---KRNIQD-CVKKT----KQEN----LYILTG--G
X1SDZ3          SVIHKILHLD---NSTGLVDLITN---HAKPEA-AIKEF----HSVD--N-LWVLTS--G
A0A0F9CMN4      PIIHKLLHLD---NSTGLVDALLN---GGHPGA-SVKQS----KNID--N-LWVLTS--G
A0A3R5TDH0      PTLAKNFKFPV--GTPGLANLIAG---TAKTDD-CIKSI----EGID------MMCA--G
A0A409P6G9      PMLAKHFQLPI--GSPGLANLLAG---TASLDD-CIQQA----DGVD------VLAA--G
A0A3R3YDR2      PTLAKNFDFAV--GTPGLANLIAG---TAKLEE-CIKHV----EGID------MLSA--G
A0A3R4BTI6      PTMAKNFGFAV--GTPGLANLIAG---TAKLEE-CVKHI----EGID------MLSA--G
A0A3B1CXE3      PFVHRYLGIE-PEY--GLSDYLTG-KVIL----SDILLR----TGIG--E-LIILPG--G
A0A3B1CYP8      PFVHKYLGIE-PEY--GLSDYLTG-RASL----SDILLR----TGIG--E-LMLLPG--G
A0A382PKY1      PVVHKVFDLD-REP--GVTTYLSS-ATDD----YASLIQ----TCEI--SNLSIITA--G
A0A3B1DET2      GRIERYLGVD-QKE--GLSDILSG-QKNI----EDVVFH----LDTE--N-LTFISS--G
A0A3B1D1Y9      PSLNDYLGIH-SEI--GLTDCLVD-GVGI----GSALIK----TGIG--G-LVFLPS--G
A0A3R1GI32      GYTHELLGTN-NVN--GLSDILLG-KGEI----SQCAKP----TSIT--N-FDLVSR--G
K1ULC5          RTFSKQMGHDGDTN--GVSSYLSG-STEL----QAIIRK----SKLS--EKLDIIYA--G
A0A3B0VG16      PSLAGIFGLD-NSR--GLVDYLRG-EEDF----ARLVYE----TGLP--D-LSIMPA--G
A0A3R2TTF1      GTLSERMGII-HGK--GLSHYLSDVNLEL----EEIIHY-----NLHGKN-VDYISI--G
A0A408BKC9      GRQYSIFDGK-PRP--GLSNFLSG-IDQE----DNSLPVLVQATEVD--N-LFIIAT--G
A0A409SIT6      GFLHRWLNNS-AKA--GLSDMLSG-LIAP----DQAVKK----TDIV--N-LDFVPR--G
A0A3R3BMP0      GYLHKTLGTS-VEN--GLSDLLAK-RCDL----ETATHK----TEIE--N-FDFISR--G
A0A3R4HSN4      GYSHILVGTE-WNN--GLSDFLSG-KITQ----EQAIHQ----TKVE--G-MDFIPR--G
A0A3R1RAJ9      RNVSRLLGVT-AEK--GLLDVLDG-STPL----NQAVLQ----DETS--G-AWILPL--A
A0A406EFX4      RNVSRLLGVT-AEK--GLLDVLDG-SAPL----NQAVLQ----DETS--G-AWILPL--A
A0A408LKC9      GTLHKALGAT-QTP--GLSDLLVG-KSDL----SDVVRV----L-PGLEN-LSFISR--G
A0A3R5KFR9      GYVHQIFSLT-NRC--GLADVLMG-KGEY----QDAIQH----YAPG--G-VDVLTC--G
A0A404MRF7      GYVHQIFSLT-NRC--GLADVLMG-KGGY----QDAIQH----YAPG--G-VDVLTC--G
A0A3R4D168      PSQHINFDRQ-NLM--GIYDVVYE-GCPL----EEAIQQ----TDVE--G-LDILCT--G
A0A0F9HWF5      PVLHKIFNVP-QEK--GFSNMLVG-DAGV----DDVITH----TNVP--N-LDVIPS--G
A0A2H9T3X6      GRLNHYFGVK-RGD--GLSNILAG-TAGY----DAVREI----NKKC-----YLMTT--G
A0A380TAR7      PSVHVRLKLA-REP--GLVDLLVG-DASL----EQVLQR----DEPT--G-AFVIAS--G
A0A407YHX1      PGLSRMLTTR-QSA--GLVEVVLD-EIPW----TQAVKV----DTRTKMG-ILPVST--S
A0A3R4QZA0      GYLHKYFNLD-TQP--GLTELLNG-QQSL----ETVIRH----TEVP--G-LSVISR--G
A0A3R5GLV2      PGATRAMARH-ASE--GLLEVLLE-GRSV----QDVLLR----DEKT--K-LAFLPTVVK
A0A3R4UA41      GHLQKAFGLP-RKG--GLAEILAG-DLTP----EQATHV----QVIP--N-LDVLTT--G
A0A0F9C030      PGLTPMLDLK-GQK--GLSTILRA-GLPVVQSAEANLCS----SLLE--N-LDVIPS--G
A0A0F9G9C6      GYLQTQFGLK-WDD--GLSDYLSG-QLNL----EQVIKP----TAVD--G-LSVITR--G
A0A2P2C6F5      PQIATTFEID-GTV--GLTQALAG-DVDV----RDVIVG----SGMA--N-LSVLPA--G
A0A3R2Y861      GALHRRFHVD-RGP--GLSEVVAG-THRL----EDVVRR----DVSY--G-LDLLST--G
A0A3R3WRK8      GALHRRFHVD-RGP--GLSEVVAG-THRL----EDVVRR----DVSY--G-LDLLST--G
A0A3R3W423      GYLNKMFRMD-VNS--GLSDLLAG-KIDL----NKATHS----TEVD--N-LHVITR--G
A0A3R5NV43      GYLNKMFRMD-VNS--GLSDLLAG-KIDL----NKATHS----TEVD--N-LHVITR--G
A0A3R2VV23      GYLHDLLGVP-YKN--GVSDILVN-RCDV----ATAIHK----TEIE--G-FDFMSR--G
A0A3R3PPN7      GYLHKILGTD-EQN--GLSDLLTK-RCDF----DTAARK----TDVD--G-FFFIPR--G
A0A404ALK7      PTLAKNFKFP-VGTP-GLANLIAG-TAKV----DECIKT------IE--G-IDMLCA--G
A0A3R4HE49      PTVHTIFGLR-SDI--GVTSVLAG-DLPL----EEAIQN----TEAE--T-LQVLTC--G
K1S5Q5          PAVAKLLGIN-ASEDGGVYGVING-EKTL----AEAIKY----SEKY--N-LFLLVS--G
A0A0W8FVN7      PRVHKIFNDE-RYP--GFIDYFFG-QATF----DELIRK----TEQA--N-LFYITG--G
A0A407LWW7      GQLNRYFGLP-KED--GLFEVLSG-TIPL----NRVRKH----SVSE--G-VDFIAT--G
A0A409DV79      GQLNRYFGVP-KED--GLFEVLSG-TIPL----TRVRKH----SVSE--G-VDFIAT--G
X0S5W7          PGLTRLLDLK-SKP--GLSDLLNA-DDEV----SDMISDYLASTDAP--N-LDVLPA--G
A0A404N310      PKVHLGLNVP-NEK--GISNLIIK-QVTL----EECIRK----SEIE--N-LDFISA--G
A0A408M394      PKVHLGLNVS-NEK--GISNLIIK-QVTL----EECIRK----SEIE--N-LDFISA--G
A0A3B1DSI5      PRIHEIFGLP-NDV--GLATTITEGIDGE----PLAYVQ---NTEIP--N-LWCMTC--G
A0A3R4U3E9      GTLHKILGVS-PQK--GLSDVLGG-KLSV----DEVIHP---VSGLD--N-MHYMVR--G
A0A3R1HJ57      GYTHELLGTT-NNN--GLAEVLTG-QAEI----TRCAQK---TS-VP--N-FDLIPR--G
A0A3R2KDK8      GYSHTLLGVG-WQN--GLSDILSQ-QTTF----ENAIRK---TE-IE--G-MDFIPR--G
A0A3R4U8W0      GYTHELLGTN-NVN--GLSEILLG-KGEI----SQSAKP---TS-IT--N-FDLVPR--G
A0A404C9H2      GYAHSLLNCE-LGL--GLSDVLSG-QATA----QQAIKK----TSIE--N-LSFISR--G
A0A408ANB0      GYLNRHFGKA-REP--GLSDVLAG-SAGI----EQVIHR----DVVE--G-VDLISA--G
X0T0M9          PVIHRIFNLN-IEP--GVTHYLTGFPRDI----RPLIKQ----TEIK--N-LQVITA--G
A0A3R4ZJ07      GHLHKSLATP-ISN--GLSDLLTK-RCSI----EQAINK----LEVD--N-LHFISR--G
A0A409P464      GHLHKTLDTP-ITN--GLSDLLVK-RCSI----EQAINK----VEID--N-LHFISR--G
A0A3R3EEA8      GYLHDLLGVP-YKN--GVSDILVN-RCDV----ATAIHK----TEIE--G-FDFMSR--G
A0A3R5AYY7      GYLHDLLGVP-YKN--GVSDILVN-RCDV----ATAIHK----TEIE--G-FDFMSR--G
A0A408AG77      GALHRRFHVD-RGP--GLSEVVAG-THRL----EDVVRR----DVSY--G-LDLLST--G
A0A406QJE9      GTLHKILGVS-PQK--GLSDVLGG-KLSV----DEVIHP---VSGLD--N-MHYMVR--G
A0A3R5CIW6      GYLNKMFRMD-VSN--GLSDLLAG-KIDL----NKATHS----TEVD--N-LHVITR--G
A0A3R2KDF2      GYLNKMFRMD-VSN--GLSDLLAG-KIDL----NKATHS----TEVD--N-LHVITR--G
A0A3R3PAM0      GYLNKMFRMD-VSN--GLSDLLAG-KIDL----NKATHS----TEVD--N-LHVITR--G
A0A3R3G320      GYLNKMFRMD-VSN--GLSDLLAG-KIDL----NKATHS----TEVD--N-LHVITR--G
A0A404NRH5      GYLNKMFRMD-VSN--GLSDLLAG-KIDL----NKATHS----TEVD--N-LHVITR--G
A0A3R1RKC9      GYLHKMLGAP-VEN--GLSDVLAK-RCNL----ETAIHK----TAIA--G-FEFMSR--G
A0A3R4GVU7      GYLHKVFGTP-AEN--GLSDLLVK-RCDL----ATAINK----TEFE--H-LDVIGR--G
A0A3R1GW93      GYLHKVFGTP-AEN--GLSDLLVK-RCDL----ATAINK----TEFE--H-LDVIGR--G
A0A3R5DAG0      GYLHKVFGTP-AEN--GLSDLLVK-RCDL----ATAINK----TEFE--H-LDVIGR--G
A0A406DTV4      GYLHKVFGTP-AEN--GLSDLLVK-RCDL----ATAINK----TEFE--H-LDVIGR--G
                                .    .                                      

A0A3R1QQP6      QRVPHSSELLTSAQMHKLLAEASNAF--D--YIIVDLPPLGPVVDARAMAGRIDGFIFVT
A0A3R5TF76      QRVPHSSELLTSAQMHKLLAEASNAF--D--YIIVDLPPLGPVVDARAMAGRIDGFIFVT
A0A382GX28      KLPSSSMGILSSAKMKEFVTEMKSRY--D--YVFLDAPPIMGVSDASVLASMVDMCVLVV
A0A0F9BMP5      YRDAYSPDHLSRSAFAEIIRELKTRY--D--YVLVDTPPVLAVADTGLLASHCDQTYMVV
A0A1J5SIM8      NAVKNSSEILSSKKIGDLITDLRERY--KSRIVIFDLPPLLVTDDAIALLPKIDCVLLVV
A0A3B0VRL8      PRPMNPAELLDSKRVGEMFDELSNRY--DDRFIIIDTPPLPMAAETTVLAEQVDGIIIVV
K1SQJ7          ENPPNPSELLGGERMKELLTTLRSRY--D--CIIIDLPPVGIVTDALLLSYEVTAYLLVV
A0A3R4S1T4      RQVTHTSELLASSGMSQFLESIKDTF--D--VIVVDLAPLIPVIDAKAFEPYADAFVFVT
A0A3B0VF49      TKPPNPADILGTPQVDQLIATLQEKA--D--IILFDAPPVNVVTDAAVLGAKVDGVLLVL
K1RRH4          PTPPNPIELLASENNQKLLNELRKLY--D--IIILDCPPVIGLSDTMIMTKFSDANIIVV
A0A3R3TMZ8      PVPPNPSEILGSKKMGKILEDLKNYF--D--VILLDSPPVIVVSDLHVLASTLDGILLVA
A0A405KPI1      PVPPNPSEILASKRLALLLEELKGIY--D--IIFIDTPPAIAVTDAQIVATKCDGVLLVV
A0A404XVD4      RIPPNPSELLMKVNFAELLDEVSKDY--D--LIILDTPPLLAVTDAAIVGRQSGTNLIVT
A0A3B0Z1H7      KLMHHSSEILSSPKMKRLVEEVKSRY--ESRYVIFDLPPMLASDDAMGFAPLVDATLLVV
W1Y9X6          GVPSNTSILLNSQSMKDLVSKLREEY--D--YVFIDSPPICRLNDACIITQYVDGTIIVN
X1MSI7          PIPPNPSELLGSEKMKVVIEELKERA--D--TLIFDSAPVIGFADSLVLANQVDGVVLIL
J9H061          TIPPNPTELLFDERLQAAIGNLKQQY--D--FVLIDCPPIELVADTQIIEKLAHRTIFVV
A0A3R5S6P1      QIPPNPSELLMHANFTALLEEASKHF--D--LVILDTPPLLAVTDAAIVGRQAGTSLIVA
A0A3R2EVW0      AVPPNPSELLMHPRFKALLDWASEHY--D--FVIVDSPPILAVTDAAIVGQHVGASLLVA
A0A3R5HKR2      AVPPNPSELLMHPRFKALLDWASEHY--D--FVIVDSPPILAVTDAAIVGQHVGASLLVA
A0A404X108      AVPPNPSELLMHPRFKALLDWASERY--D--FVIVDSPPILAVTDAAIVGQHVGASLLVA
A0A405D7C3      AVPPNPSELLMHPRFKALLDWASERY--D--FVIVDSPPILAVTDAAIVGQHVGASLLVA
A0A404A688      QYPPNPSELLMHSRFREFMRWASEHY--D--MVIVDTPPILAVTDAALVGGIAASTLLVA
A0A409R088      QVPGNPSELLIGDGFQQLLRWANEHY--D--MVIVDTPPILAVTDASLVGRLAGTTLLVA
A0A3R4T9I0      AYPFNPANMMLSSALGELLNDFSERY--D--LVVIDSPPVLVAADAAAVAAHAGAVLLVA
A0A3R5C7Q1      AYPFNPANMMLSSALGELLDAFSERY--D--LVVIDSPPVLVAADAAAVAAHAGAVLLVA
A0A3R2KBB7      PIPPNPAEMMASNRMSAVLQELRQRY--D--MILFDTPPLLAVTDAQIVASKSDGVIMVV
A0A3R3NKS5      PIPPNPAEMMASNRMSAVLQELRQRY--D--MILFDTPPLLAVTDAQIVASKSDGVIMVV
A0A3R3PBR3      PIPPNPAEMMASNRMSTLLQDLRQIY--D--VILIDTPPLLAVTDAQIMASKSDGVIMVV
W1YAG3          TIPPNPAEVLSSKKMSEFIESIKDEY--D--YIFIDSPPVGVVSDASIISAYSDGVIFVV
X1SDZ3          SVPSDSSELLGSTQMRSLVEQLTKEY--N--YVVFDTPPLMSVSDTAVLASQVDGVLMII
A0A0F9CMN4      SVPSNPSELLGSSGMKALMEQVTKEY--D--YVVFDTPPLISVSDGAILASQADGILMVV
A0A3R5TDH0      AVPPNPLELLSSERFAKLIEQLKSRY--D--RVIIDSPPIQAVSDATILATHADAQIYVI
A0A409P6G9      TVPPNPQELLASPLFSQLLEQLSERY--Q--RIVIDTPPCLAVSDALLMSTLADFVLYVV
A0A3R3YDR2      AVPPNPLELLSSARFEKVLEFLRSKY--D--RVVIDSPPTQAVSDATVLATHANALLYVI
A0A3R4BTI6      AVPPNPLELLSSARFEKVVEFLRSKY--D--RIVIDSPPTQAVSDALVLGTLANALIYVV
A0A3B1CXE3      LPPENPAELLSSERMKTLVNELKIRHGGG--YVIFDSSPVLLTSDPLSLGSLMDGVIFII
A0A3B1CYP8      FPPENPAELLSSERMKNLVNELKIRHRGG--YVIFDSSPVLLTSDPLSLGSLMDGVLFII
A0A382PKY1      IIPPNPSELLGSKRMTELVKQLENDW--D--MVLFDSPPMIAVTDATMISKEIDQVVLIV
A0A3B1DET2      EVPENPAELLSSNKMKQFLSQTRAQF--D--FVIIDTPPIIAVTDSGIIGAQADGIIMVV
A0A3B1D1Y9      RKVSNPGELLSSNRMKEIVKELKHRY--PDRYVIFDAPPVLPFAEVLSVGALLDGIIFVV
A0A3R1GI32      QVPPNPSELLMSERFSQLVEWASKHY--D--LVLIDTPPILAVTDAAIVGRHAGTTLMVA
K1ULC5          IQPPNPSEMLLSQRMEELIAELKLHY--D--YIIIDSTPAMAVADAIITDRLADLSIYVV
A0A3B0VG16      LPPDNPAELIGSERMAGLLNEAVNGYVDG--FVLLDCPPFQAVSESAVLAQLVDKVVLVV
A0A3R2TTF1      MEAPNPVELLLSKRLDQLISDLRNRY--D--YIIIDGVPTGIVADATVVDRVSDLTLFVI
A0A408BKC9      DVPPNPAELLISDKMDELISQLKEVA--D--IIIFDAPPGLVVTDAAILSRYVDSTIIVT
A0A409SIT6      QVPPNPSELLMHQRFADFLRWAGQNY--D--LVLIDTPPVLAVTDAAIVGHHAGTALMVV
A0A3R3BMP0      QIPPNPSELLMHANFSAFLEQVSQKY--D--LVILDTPPLLAVTDAAIVGRQSGTSMIVT
A0A3R4HSN4      QLPPNPSELLMHSRLADLLNWAGGKY--D--LILIDTPPVLAVTDASIIGRLAGTSLMVA
A0A3R1RAJ9      KREFTPHEVFNTPAMHDLLKQLRAQF--D--LVILDTAPLLAIAETRVLASQSDAVVFLT
A0A406EFX4      KREFTPHEVFNTPAMHDLLKQLRAQF--D--LVILDTAPLLAIAETRVLASQSDAVVFLT
A0A408LKC9      DVPPNPSELLMHANFTKLLSEAAPAY--D--LVIVDTPPILAVTDAAIIAHHAGTCLMVA
A0A3R5KFR9      QAPTNPSELLIGDGFQQLLKWANEHY--E--MVIVDTPPILAVTDASLVGRRAGTTLLVA
A0A404MRF7      QAPTNPSELLIGDGFQQLLKWANEHY--E--MVILDTPPILAVTDASLVGTRAGTTLLVA
A0A3R4D168      PVPPDPVQTLHADAFKRMVEKLRKDY--D--AIFFDSPPINLFTDAAVLGRMTDSVLMVV
A0A0F9HWF5      HIPPNPAELLSSDGIASFMDIFKSRY--D--RIVIDSPPILSATDPVIISTFVDEVLMVI
A0A2H9T3X6      LLPPNPSELLMSHGFTELLENVSPLY--D--IVLVDTPPILAVTDAAIIGRKCGRTFMVT
A0A380TAR7      SAARDPSDLLGSKAVKAFLDQACESF--D--LVVLDSSPLMSVSDACNLAPLAEETVFVI
A0A407YHX1      NQFAHSSELLSSSGMRKFIDSAREAC--D--YIIVDLAPVVPVIDAKAFAPQVDGFVFVT
A0A3R4QZA0      KNPANPSELLSSNQFKNLLEQMSEKF--D--HVIIDTPPVLAVTDGIIISQYTGVNLVIA
A0A3R5GLV2      QRVPHSSELLTSAQMHKLLAEASNAF--D--YIIVDLPPLGPVVDARAMAGRIDGFIFVT
A0A3R4UA41      AYPFNPANMMLSAALGELLNDFSERY--D--LVVIDSPPVLVAADAAAVAAHAGAVLLVA
A0A0F9C030      PRPINPTELLVGDRFSELLCWAESRY--D--QILVDSPPAL-VSDTAIIGRLVDGVLLTV
A0A0F9G9C6      QIPPNPSELLMHSNFSKLVAEVSAAY--D--IVIVDTPPILAVTDPAIVSAHTGTTLLVT
A0A2P2C6F5      RIPPNPSELLGSLRMKQFIDDLSQDH-----LVILDAPPLLPVTDAGLLSAFCDGALLVQ
A0A3R2Y861      LHMAGPSELLLQPELAALIQRVSAQY--D--MVVLDGPPLLPVADALVLGRMAGTVLMVA
A0A3R3WRK8      LHMAGPSELLLQPELAALIQRVSAQY--D--MVVLDGPPLLPVADALVLGRMAGTVLMVA
A0A3R3W423      QIPPNPSELLMHSNFTQFLEQVSSQY--D--LVIIDTPPILAVTDAALVGRQAGTSLIVT
A0A3R5NV43      QIPPNPSELLMHSNFTRFLEQVSSQY--D--LVIIDTPPILAVTDAALVGRQAGTSLIVT
A0A3R2VV23      ERPPNPSELLMRSSFTELLNKVSSMY--D--LVILDTPPLLAVTDAAIVGRQCGTSLIVA
A0A3R3PPN7      QIPPNPSELLMHANFTALLEEASKHF--D--LVILDTPPLLAVTDAAIVGRQAGTSLIVA
A0A404ALK7      AVPPNPLELLSSERFTKLIEQLKDSY--D--RVIIDSPPIQAVSDATILAIHADAQIYVI
A0A3R4HE49      PIPPNPAELLESNRFQALIEELKERY--D--VVLFDAPPIIAVTDASILAAKLDGLILLL
K1S5Q5          KPVFDPSELLSTDAMSDIIKSAEKEF--D--YIIIDTAPCGVVADASILSSYADGILLVV
A0A0W8FVN7      TIPPNPAEILGSHKMEEFLAKLETHF--D--LIVIDSPPIIAVTDSEILSQIVDGVMLVI
A0A407LWW7      AVTFDPSELLASPVFGETLRELATQY--D--MVILDTAPVLSSPDAAVVGTHAAAVMVVV
A0A409DV79      AVTFDPSELLASPVFGETLRELATQY--D--MVILDTAPVLSSPDAAVVGTHAAAVMVVV
X0S5W7          PRRQNPSELLASDRLAQIFAWAETKY--D--QILVDCPPTLVASDAVLVGRIVDGMVLIV
A0A404N310      PIPPNPSELILSDSFQEILETLKATY--D--IVIIDNPPVGLVTDGVQILAKADVPIYIF
A0A408M394      PIPPNPSELILSDSFLEILETLKATY--D--IVIIDNPPVGLVTDGVQILAKADVPIYIF
A0A3B1DSI5      KLPPNPSELLSSSIFEQFLEVAREKY--D--YVIVDTPPLLAVTDPSTVAARVDAVLITL
A0A3R4U3E9      DIPPNPAELLMHPRFAQLLQDMSGKY--D--LVIVDTPPILAVTDPALVATHAGSSLLVT
A0A3R1HJ57      VVPSNPSELLMSERFAELIAWASKNY--D--LVLIDTPPILAVTDAAVVGRHAGTTLMVA
A0A3R2KDK8      QIPPNPSELLMRARLKEMIDWASKNY--D--IVLVDTPPILAVTDAAIIGHHVGTALMIA
A0A3R4U8W0      QVPPNPSELLMSERFTQLVKWASENY--D--LVLIDTPPILAVTDAAVVGRHAGTTLMVA
A0A404C9H2      KIPPNPSELLMHNRLSEFLEWAGKEY--D--IVLVDTPPILAVTDAAIVARNVGTTLLVA
A0A408ANB0      TVPPNPADLLLSERIVQLLDAVSGRY--D--LVLIDTPPVLAVTDAVILAAQCGTVFLVS
X0T0M9          ATPPDPSVLISSKRMHEFIKSLEIGW--D--IILFDAPPAIAVTDTSLLAKEINQFIIVV
A0A3R4ZJ07      QVPPNPSELLMHANFRELLAELSKLY--D--VVIIDTPPLLAVTDAAIVGREAAINLIVT
A0A409P464      QVPPNPSELLMHANFRELLAQLSERY--D--LVIIDTPPLLAVTDAAIVGRDAGISLIVT
A0A3R3EEA8      ERPPNPSELLMRSSFTELLNKVSSMY--D--LVILDTPPLLAVTDAAIVGRQCGTSLIVA
A0A3R5AYY7      ERPPNPSELLMRSSFTELLNKVSSMY--D--LVILDTPPLLAVTDAAIVGRQCGTSLIVA
A0A408AG77      LHMAGPSELLLQPELAALIQRVSAQY--D--MVVLDGPPLLPVADALVLGRMAGTVLMVA
A0A406QJE9      DIPPNPAELLMHPRFAQLLQDMSGKY--D--LVIVDTPPILAVTDPALVATHAGSSLLVT
A0A3R5CIW6      QIPPNPSELLMHSNFTRFLEQVSSQY--D--LVIIDTPPILAVTDAALVGRQSGTNLIVT
A0A3R2KDF2      QIPPNPSELLMHSNFTRFLEQVSSQY--D--LVIIDTPPILAVTDAALVGRQAGTSLIVT
A0A3R3PAM0      QIPPNPSELLMHSNFTQFLEQVSSQY--D--LVIIDTPPILAVTDAALVGRQAGTSLIVT
A0A3R3G320      QIPPNPSELLMHSNFTRFLEQVSSQY--D--LVIIDTPPILAVTDAALVGRQAGTSLIVT
A0A404NRH5      QIPPNPSELLMHSNFTRFLEQVSSQY--D--LVIIDTPPILAVTDAALVGRQAGTSLIVT
A0A3R1RKC9      QIPPNPSELLMHANFSALLEQVSGMY--D--LVILDTPPILAVTDAAIVGRQSGTNMIVT
A0A3R4GVU7      QIPPNPSELLMHANFSAFLEQVSTQY--D--LVILDTPPLLAVTDAAIVGRQSGTSLIVT
A0A3R1GW93      QIPPNPSELLMHANFSAFLEQVSAQY--D--LVILDTPPLLAVTDAAIVGRQSGTSLIVT
A0A3R5DAG0      QIPPNPSELLMHANFSAFLDQVSAQY--D--LVILDTPPLLAVTDAAIVGRQSGTSLIVT
A0A406DTV4      QIPPNPSELLMHANFSAFLDQVSAQY--D--LVILDTPPLLAVTDAAIVGRQSGTSLIVT
                     .   :        .             :..*  *     :               

A0A3R1QQP6      EWGKTARRAVRNTVENEVHIRKKCLGVILN----KVDTEKLKL-------------YRAY
A0A3R5TF76      EWGKTARRAVRNTVENEVHIRKKCLGVILN----KVDTEKLKL-------------YRAY
A0A382GX28      QYRKYPQMMTQRAKEMVTKVGGELVGVVLN----NINISQDS------------------
A0A0F9BMP5      RWRKTRHAQIRDVFERLYDLDINVTGTILN----FVNPKKEA-------------NYRGI
A0A1J5SIM8      ANGMSTKREIEDSLRLLPAE--NLIGTILN----KAD---VE------------------
A0A3B0VRL8      RWGRAAREQVKQMTENLNKD--KIIGVLYN----AFEKYILR------------------
K1SQJ7          RAGVSHMSREKSAVTLLEQVDADICGILFN----GLPPKSKDC-NYRLQQYWQ-------
A0A3R4S1T4      EWGATPAKAVQSVLQSEPQIAAKTIGVILN----KTDLSELHK--YADPGAPE-------
A0A3B0VF49      SAGKTRREHAERAKEILKKARVNIIGATLT----NAPTDSSMEAYYG-------------
K1RRH4          SNKKTKIESLDRAKKIFAQANAKITGVVIN----KASVKGSSY-YS------Y-------
A0A3R3TMZ8      TYGVTEKNAILRAKESIIKVGGKVLGVVEN----KIPQDAKGY-GYGGYGYGK-------
A0A405KPI1      DSGNVKREIALKAKNNMEHVKARILGVILN----NVDRRNKDS-YY--------------
A0A404XVD4      RFGLNPAHEIELTIRRFAQNGIELKGAIFN----GVEKRASAY-GYGSYGY---------
A0A3B0Z1H7      EDGVANIDELKSSIELLED--ANLIGTVLN----KSREPVKDY-----------------
W1Y9X6          AAKAIDSKGAKITLDKLNKVGANIIGVVLN----KFKAEKYSY-----YSNYY-------
X1MSI7          NAGMVTRDAAKQAKALLEKAKAKILGVVLN----NVDIKREGY-------YHY-------
J9H061          RAGLLERSMLPELEHIYQEKKYKNMSLILN----ATEGSGGRY------GYRY-------
A0A3R5S6P1      RFGLNPVREVDLTMRRFAQNGIELKGAIFN----GVEKRASAYYGYGGYGY---------
A0A3R2EVW0      RFAKTAVKEVEVAIRRFEQNGVVIKGILLN----AVEKKASSY--YGNYGY---------
A0A3R5HKR2      RFAKTAVKEVEVAIRRFEQNGVAIKGILLN----AVEKKASSY--YGNYGY---------
A0A404X108      RFAKTAVKEVEVAIRRFEQNGVAIKGILLN----AVEKKASSY--YGNYGY---------
A0A405D7C3      RFAKTAVKEVEVAIRRFEQNGVVIKGILLN----AVEKKASSY--YGNYGY---------
A0A404A688      RFNVTSVREMQVSYRRLQQMGVNIKGAILN----DVMKSAASY--YSS-GY---------
A0A409R088      RFGMTSVKEMQACVKRLHLAGVSIEGAILN----DVVKSAAIY--YTT-GY---------
A0A3R4T9I0      RDNLTQLGELNESIKRLAHAGQQVNGVVFN----GMDLSRRHY------GS---------
A0A3R5C7Q1      RDNLTQLGELNESVKRLAHAGQQVNGVVFN----GMDLSRRHY------GS---------
A0A3R2KBB7      SYGKVKRDIAAKAKANLDRVGAKMLGVVLN----NVK-RKASE------GY---------
A0A3R3NKS5      SYGKVKRDIAAKAKANLDRVGAKMLGVVLN----NVK-RKASE------GY---------
A0A3R3PBR3      SYGKVKRDIAVKAKANLDRVGAKMLGVVLN----NVK-RKASE------GY---------
W1YAG3          GANEVDSNLAKIAKERLDNVKANIVGVILN----KFKTDTNSE-------Y---------
X1SDZ3          RPGKLRREMARRTKELLNRVGTPVLGCVLN----GVEPRDSSY-------Y---------
A0A0F9CMN4      SPGKVKGEIGRHTKELLERIGTPVLGCVFN----GVEL--SHRNYYYYYNY---------
A0A3R5TDH0      KSEATPIPLAQKGVGQLLQTNSPVTGVVLN----QVDVKRAQKHGYHYGGY---------
A0A409P6G9      KSDATAVPLVHKGIGQLLQGNAPVKGIVLN----QVDVTAAGSKGGRYDGY---------
A0A3R3YDR2      KSEATPIPLAQKGVGQLLQNNAPVTGVILN----QVDIKKAQKQGYSYGGY---------
A0A3R4BTI6      KSEATPIPLVQKGIGQLLQNNAPVTGIVLN----QVDIKKAQKQGYSYGGY---------
A0A3B1CXE3      HAALTSEKSAAQAISLIK--GCNILGIVFN----DVQNYPAK------------------
A0A3B1CYP8      HAALTSEKSASQAISLIK--GCNILGIVFN----EVQNYPAK------------------
A0A382PKY1      KVGQTDKKAFHHTINNLRNINAPLGGIIMN----AVTSKSSY-----------GSYY---
A0A3B1DET2      QAGRTQRGIVRRAQELLYQSHSKVLGQVLT----NIEYHLPE------------------
A0A3B1D1Y9      REGVTPEDNMKDAVTMLKDNNI--LGVVYN----AAETVPLS-----------DY-----
A0A3R1GI32      RYAVNTLKEVETSLSRFEQNGIAVKGVILN----SIFRRASG-----------YQDY---
K1ULC5          REGLLDRRQLPDIERLYREKKFHNMAIILN----GASSTKRH-----------GYGY---
A0A3B0VG16      RWGRAGRENVKKLVEQIGRD--KIIGIVFNSFEMNILDRKMQDV----------------
A0A3R2TTF1      RAGKMDKRQLPEIQKIYAEKRLSNLAIILN----GLKLGQSG--------YGYGYGY---
A0A408BKC9      AANDTKMEALEKVKKAIENVGGKVSGVVIN----KVPMNTRK--------------Y---
A0A409SIT6      RFEVNTVRQIETSIRRFEQNGVTIKGVILN----GMVKKTAT------------D-A---
A0A3R3BMP0      RFAMNPAREIELTIRRFAQNGIILRGAILN----GVEKRSSA-------YYGENG-Y---
A0A3R4HSN4      RFGVNTVKEVDFSIRRFDQNGINIKGVILN----AVEKRASN-------YYG--G-Y---
A0A3R1RAJ9      RWRKTPAKASNAALQTLRQSDAKIAGVVLT----LVDVNEQA-------RYGYGDP----
A0A406EFX4      RWRKTPAKASNAALQTLRQSDAKIAGVVLT----LVDVNEQA-------RYGYGDP----
A0A408LKC9      RFGLNQAKELALAKRRFEQNNVRIKGAIFN----AVERRATG------------------
A0A3R5KFR9      RFGMTSVKEMQACVKRLHLAGVSIDGAILN----DVVKSAAI------------------
A0A404MRF7      RFGMTSVKEMQACVKRLHLAGVSIDGAILN----DVVKSAAI------------------
A0A3R4D168      DVRSTTRQATVAAKELLIKAKVPLAGMVVK----NTAATTNR------------------
A0A0F9HWF5      KMGETSRELVQTAIGKLHHVKANLIGTVLN----GVDT----------------GQG---
A0A2H9T3X6      RAEKNTASEISYAAKRLQQAKVNVKGCILN----GMVYTSS-----------CYGQY---
A0A380TAR7      QWGKTGREVVKLALEKLTETQGVPRGIVLS----RVDTAKIR-------LY-GYGDA---
A0A407YHX1      EWGKTPIQMVQNLMANEPQIANKTLGIVLN----KTDMTELQ-------RYAGPGGS---
A0A3R4QZA0      RYAKTQMKELELTLNRFEQAGVKVNGFILN----DIQRSAGS-------------GY---
A0A3R5GLV2      EWGKTARRAVRNTVENEVHIRKKCLGVILN----KVDTEKLK------LYRAYGS-S---
A0A3R4UA41      RDNLTQLGELNESIKRLAHAGQQVNGVVFN----GMDLSRRH---YGSYGYKYGG-Y---
A0A0F9C030      QPHKNRRRTVIRAAESFSNLGINVLGIVIN----RLATEKSDDYYGYGYGYGYGY-G---
A0A0F9G9C6      RFGQNHIKEIELTRNRFEQNGTDVKGVVFN----GVIKKASN---------AYGY-Y---
A0A2P2C6F5      AAGRTQIEQSQQCRRILDQVGSRLLGVVLN----KAPVKGASAIAYGGGYSGYGG-Y---
A0A3R2Y861      RHRVTTVDQIDESTRRLAQANVAVQGVIFN----DFT----------------GT-L---
A0A3R3WRK8      RHRVTTVDQIDESTRRLAQANVAVQGVIFN----DFT----------------GT-L---
A0A3R3W423      RFGVNAAKEIAVTKRRFEQNGIVVKGAIFN----AVERKASA--------YGYGS-Y---
A0A3R5NV43      RFGVNAAKEIAVTKRRFEQNGIVVKGAIFN----AVERKASA--------YGYGS-Y---
A0A3R2VV23      RFGLNPAREIELTINRFAQNGIKLAGAIFN----GVERRASA-------NYGYSG-Y---
A0A3R3PPN7      RFGLNPVREVDMTMRRFAQNGIELKGAIFN----GVEKRASA-------YYGYGG-Y---
A0A404ALK7      KSESTSVPLARRGVGQLLQSNSPVTGVVLNQV--DIKKAQKH-------GYHYGGYY---
A0A3R4HE49      GVNKVTRKAAKHALQLLARAKVKVWGMVVR----GVRPDNDG-------YY-----Y---
K1S5Q5          RNDMVASRRIKRAVENLENSGTKLVGCIYNDTESGMPKRFMS-------SYNKKYGY---
A0A0W8FVN7      SAGVTEYDILYKSLDVLKMAKSQFLGAVLN----KFAYRP-----------GYGSYY---
A0A407LWW7      RSGMNTVGEIRETAKRLIQAGAPVDGVLFN----GLKLLPER--------FGFRSKY---
A0A409DV79      RSGMNTVGEIRETAKRLIQAGAPVDGVLFN----GLKLLPER--------FGFRSKY---
X0S5W7          RPDKNRRKLVFRATQNLTEMKIPLLGLVAN----GVGAENNK-------GYSFGEGE---
A0A404N310      KAHYSKRIFAGRVRELFEMNQISHLNIILN----GTKAYKGK----------YGYGY---
A0A408M394      KAHYSKRIFAGRVRELFDMNQISHLNIILN----GTKAYKGK----------YGYGY---
A0A3B1DSI5      KLKKNSRTMATRAREMLTAVNANLIGIVVN----GAGHLEHY-------SYGYTG-YGSS
A0A3R4U3E9      RFGVNQAKEIELTLQRFEQNGVQIKGAIFN----AVEKRATG--------YYS---Y---
A0A3R1HJ57      RYAVNTLKEVETSLSRFEQNGINVRGVILN----SIFRRAAG--------YED---Y---
A0A3R2KDK8      RFSMNTVKEIEVSVRRFEQNGIDIKGVILN----AVEKRASS-------YYGG---Y---
A0A3R4U8W0      RYAVNTLKEVETSLSRFEQNGIEVKGVILN----SIFRRATG--------YQD---Y---
A0A404C9H2      RYGVNSLKEIEVSIRRFEQNGMEIKGIILN----AVEHKSGS-------A------Y---
A0A408ANB0      RFGKTTIEDIAEAENQLRHANADVKGVIFN----ALDPRAFR--------YGYGNKY---
X0T0M9          KSGQTDKFAFDRAIQMLESVNAPIAGAIMN----AVSPKTSY-------ESYYYY-H---
A0A3R4ZJ07      RFGVNPAKEIELTIRRFAQNGIELKGAIFN----GVEKRASS-------YYGNGS-Y---
A0A409P464      RFGVNPAKEIELTIRRFAQNGIELKGAVFN----GVEKRAAS-------Y---GT-G---
A0A3R3EEA8      RFGLNPAREIELTINRFAQNGIKLAGAIFN----GVERRASA-------NYGYSG-Y---
A0A3R5AYY7      RFGLNPAREIELTINRFAQNGIKLAGAIFN----GVERRASA-------NYGYSG-Y---
A0A408AG77      RHRVTTVDQIDESTRRLAQANVAVQGVIFN----DFT----------------GT-L---
A0A406QJE9      RFGVNQAKEIELTLQRFEQNGVQIKGAIFN----AVEKRA----------TGYYS-Y---
A0A3R5CIW6      RFGVNAAKEIAVTKRRFEQNGIVVKGAIFN----AVERKASA--------YGYGS-Y---
A0A3R2KDF2      RFGVNAAKEIAVTKRRFEQNGIVVKGAIFN----AVERKASA--------YGYGS-Y---
A0A3R3PAM0      RFGVNAAKEIAVTKRRFEQNGIVVKGAIFN----AVERKASA--------YGYGS-Y---
A0A3R3G320      RFGVNAAKEIAVTKRRFEQNGIVVKGAIFN----AVERKASA--------YGYGS-Y---
A0A404NRH5      RFGVNAAKEIAVTKRRFEQNGIVVKGAIFN----AVERKASA--------YGYGS-Y---
A0A3R1RKC9      RFALNPVREVELTIRRFAQNGIDLKGAIFN----GVEKRASA-------KYGYGG-Y---
A0A3R4GVU7      RFALNPVREIELTMRRFAQNGIELKGAIFN----GVEKRASA-------KYGYAD-Y---
A0A3R1GW93      RFALNPVREIELTMRRFAQNGVDLKGAIFN----GVEKRASA-------KYGYAD-Y---
A0A3R5DAG0      RFALNPAREIELTMRRFAQNGIELKGAIFN----GVEKRASA-------KYGYAD-Y---
A0A406DTV4      RFALNPVREIELTMRRFAQNGIDLKGAIFN----GVEKRASS-------KYGYSD-Y---
                                                                            

A0A3R1QQP6      GSSEYYHSRYTRYYHD--------------------------------------------
A0A3R5TF76      GSSEYYHSRYTRYYHD--------------------------------------------
A0A382GX28      -----YYYYYSGYYYDNYYKSREKEGSAEDDTKSRKKTKLLASAKTGEEDEKPKY-----
A0A0F9BMP5      PYASYNEYRHV-------------------------------------------------
A0A1J5SIM8      ----PKAYYYD-------------------------------------------------
A0A3B0VRL8      ----AKLTCYE-------------------------------------------------
K1SQJ7          ----EYKQQNGEAV----------------------------------------------
A0A3R4S1T4      ----RLRSNYLSYYRDYKEVAAE-------------------------------------
A0A3B0VF49      ------------------------------------------------------------
K1RRH4          ----YSDEYYRDTDSKKKRKR---------------------------------------
A0A3R3TMZ8      ----YQGYYSSDTEE---------------------------------------------
A0A405KPI1      -------YYYYGANE---------------------------------------------
A0A404XVD4      -----YHYDYKSDNA---------------------------------------------
A0A3B0Z1H7      -----YYGKY--------------------------------------------------
W1Y9X6          ----GYSNYYGEHKHKLFGRKKKRRRKTS-------------------------------
X1MSI7          ----YHYYNYSKYYNTEE------------------------------------------
J9H061          ----GYHYGYGNGYHYGNSTKTN-------------------------------------
A0A3R5S6P1      -----YQYEYKSDKA---------------------------------------------
A0A3R2EVW0      -----YQYSYGDKAKA--------------------------------------------
A0A3R5HKR2      -----YQYSYGDASFE--------------------------------------------
A0A404X108      -----YQYSYGDKTKA--------------------------------------------
A0A405D7C3      -----YQYSYGDKTKA--------------------------------------------
A0A404A688      -----DAYGYSAAQNEGAQTARR-------------------------------------
A0A409R088      -----SQYVYSQAADK--------------------------------------------
A0A3R4T9I0      -----YGYKYGGYRYTEYKYKEAGAASE--------------------------------
A0A3R5C7Q1      -----YGYKYGGYRYTEYKYKEAGAASE--------------------------------
A0A3R2KBB7      -----YYYYYGN------------------------------------------------
A0A3R3NKS5      -----YYYYYGN------------------------------------------------
A0A3R3PBR3      -----YYYYYGN------------------------------------------------
W1YAG3          ----YNYYYNENK-----------------------------------------------
X1SDZ3          ----YYYHSYAGAEG---------------------------------------------
A0A0F9CMN4      ----YRYYAGSAGEKKVGKREKKESNVLD-------------------------------
A0A3R5TDH0      ----YDYYGYTKPQKAEAQATQGSQA----------------------------------
A0A409P6G9      ----YDYYSYSDSPT---------------------------------------------
A0A3R3YDR2      ----YDYYGYSNDAQKA-------------------------------------------
A0A3R4BTI6      ----YDYYGYSSDAQKA-------------------------------------------
A0A3B1CXE3      ----DP-YPYY---SADEAQSGQG------------------------------------
A0A3B1CYP8      ----DP-YPYN---FPEDKDAGRIAGKTKTQGA---------------------------
A0A382PKY1      ----YYYYQYY---HYYGSEKESD------------------------------------
A0A3B1DET2      -------YIYR---YL--------------------------------------------
A0A3B1D1Y9      -------YNYS---HYYQNR----------------------------------------
A0A3R1GI32      ----GY-YEYE---YKSDSK----------------------------------------
K1ULC5          ----GYGYGYG---YGLDEEETTT------------------------------------
A0A3B0VG16      ----GY-HNYYSERY---------------------------------------------
A0A3R2TTF1      ----GYGYGREEGQNSWRKIARSIRAIFTRKIKH--------------------------
A0A408BKC9      ----GY-YGNY---YGSTATFKKGRGKNKHHLAMSQREAARPENQPKREVKTGFDEIYAF
A0A409SIT6      ----GY-YAFA---YPSHQEKVQ-------------------------------------
A0A3R3BMP0      ----AY-YQYE---YKSDKN----------------------------------------
A0A3R4HSN4      ----GY-YQYS---YTSDKKQ---------------------------------------
A0A3R1RAJ9      ----GYYYSSYKNYYAT-------------------------------------------
A0A406EFX4      ----GYYYSSYKNYYAT-------------------------------------------
A0A408LKC9      ----YYSYGY--YEYKSTT-----------------------------------------
A0A3R5KFR9      ----YYTAGYSPYEYRQAAEK---------------------------------------
A0A404MRF7      ----YYTAGYSPYEYRQAAEK---------------------------------------
A0A3R4D168      -----Y-HTRYYERYYMDRLKQLADE----------------------------------
A0A0F9HWF5      ----NY-YQYQ---YYGDRQPETEQGVFGRLRKPFLMRK---------------------
A0A2H9T3X6      ----GY-YHYKYGSES--------------------------------------------
A0A380TAR7      ----AY-YDRTVREYY------TRGSA---------------------------------
A0A407YHX1      ----EH-YHEKFSAYYGDAKPPVKEEA---------------------------------
A0A3R4QZA0      ----GYNYAYA---YKANKELD--------------------------------------
A0A3R5GLV2      ----EY-YHSR---YTRYYHD---------------------------------------
A0A3R4UA41      ----RY-TEYK---YKEEAA----------------------------------------
A0A0F9C030      ----SG-YGYG---HDDEPQSDAGLSEGSTDDMPMEIVRRVA------------------
A0A0F9G9C6      ----GY-YNYE---YKSNEKS---------------------------------------
A0A2P2C6F5      ----GG-YRAE---EATREAYSTAGKGRRRKLVKSSSDKD--------------------
A0A3R2Y861      ----HR-YSYA---YGVNAEPQAPRPATPGSSPSEPT-----------------------
A0A3R3WRK8      ----HR-YSYA---YGVNAEPQAPRPATPGSSPSEPT-----------------------
A0A3R3W423      ----SY-YQYE---YASDKK----------------------------------------
A0A3R5NV43      ----SY-YQYE---YASDKK----------------------------------------
A0A3R2VV23      ----GY-YHYE---YKDEKAKA--------------------------------------
A0A3R3PPN7      ----GY-YQYE---YKSDKA----------------------------------------
A0A404ALK7      ----DY-YGYTNPQKTDAQTTQGSKA----------------------------------
A0A3R4HE49      ----AYYHRYYGTMERDRKKADKKAKREATATVAQAPDTQAAPGSVTIDINKLKKG----
K1S5Q5          ----GYGYGYG---YGSNQK----------------------------------------
A0A0W8FVN7      ----KY-YYYY---YNTGNGKEDKKKLLKV------------------------------
A0A407LWW7      ----GG-YRYSRAAYYGDFKQNGPK-----------------------------------
A0A409DV79      ----GG-YRYSRAAYYGDFKQNGPK-----------------------------------
X0S5W7          ----GYGYGYG---YGDDENNDEDEGEIEQQGNGDSYQGISFQSKTSDQSENDQENLPAN
A0A404N310      ----GYGYGYD---YYDEEDKKKKKK----------------------------------
A0A408M394      ----GYGYGYD---YYDEEDKDKKKKKSN-------------------------------
A0A3B1DSI5      SYEQGY-YGYD---YAYSVKNDHNTTQPLPVMYDSQKKGHLQEALYQNENNDDV------
A0A3R4U3E9      ----GY---YE---YKSDGKE---------------------------------------
A0A3R1HJ57      ----GY-YEYE---YKSDAK----------------------------------------
A0A3R2KDK8      ----GY-YQYE---YRSSDKA---------------------------------------
A0A3R4U8W0      ----GY-YEYE---YKSDSK----------------------------------------
A0A404C9H2      ----GY-YAYE---YK--------------------------------------------
A0A408ANB0      ----ER-YRHA---YYGNAAIDGRSK----------------------------------
X0T0M9          ----EY-YHYY---GKDKNK----------------------------------------
A0A3R4ZJ07      ----AY-YNYE---YASDKS----------------------------------------
A0A409P464      ----GY-YNYE---YASDKS----------------------------------------
A0A3R3EEA8      ----GY-YHYE---YKDEKAKA--------------------------------------
A0A3R5AYY7      ----GY-YHYE---YKDEKAKA--------------------------------------
A0A408AG77      ----HR-YSYA---YGVNAEPQAPRPATPGSSPSEPT-----------------------
A0A406QJE9      ----GY-YEYK---SDGKE-----------------------------------------
A0A3R5CIW6      ----SY-YQYE---YASDKK----------------------------------------
A0A3R2KDF2      ----SY-YQYE---YASDKK----------------------------------------
A0A3R3PAM0      ----SY-YQYE---YASDKK----------------------------------------
A0A3R3G320      ----SY-YQYE---YASDKK----------------------------------------
A0A404NRH5      ----SY-YQYE---YASDKK----------------------------------------
A0A3R1RKC9      ----GY-YQYE---YSSDKT----------------------------------------
A0A3R4GVU7      ----GY-YNYE---YKSESV----------------------------------------
A0A3R1GW93      ----GY-YNYE---YKSENV----------------------------------------
A0A3R5DAG0      ----GY-YNYE---YKSESV----------------------------------------
A0A406DTV4      ----GY-YNYE---YKSESV----------------------------------------
                                                                            

A0A3R1QQP6      ------------------------------------------
A0A3R5TF76      ------------------------------------------
A0A382GX28      ------------------------------------------
A0A0F9BMP5      ------------------------------------------
A0A1J5SIM8      ------------------------------------------
A0A3B0VRL8      ------------------------------------------
K1SQJ7          ------------------------------------------
A0A3R4S1T4      ------------------------------------------
A0A3B0VF49      ------------------------------------------
K1RRH4          ------------------------------------------
A0A3R3TMZ8      ------------------------------------------
A0A405KPI1      ------------------------------------------
A0A404XVD4      ------------------------------------------
A0A3B0Z1H7      ------------------------------------------
W1Y9X6          ------------------------------------------
X1MSI7          ------------------------------------------
J9H061          ------------------------------------------
A0A3R5S6P1      ------------------------------------------
A0A3R2EVW0      ------------------------------------------
A0A3R5HKR2      ------------------------------------------
A0A404X108      ------------------------------------------
A0A405D7C3      ------------------------------------------
A0A404A688      ------------------------------------------
A0A409R088      ------------------------------------------
A0A3R4T9I0      ------------------------------------------
A0A3R5C7Q1      ------------------------------------------
A0A3R2KBB7      ------------------------------------------
A0A3R3NKS5      ------------------------------------------
A0A3R3PBR3      ------------------------------------------
W1YAG3          ------------------------------------------
X1SDZ3          ------------------------------------------
A0A0F9CMN4      ------------------------------------------
A0A3R5TDH0      ------------------------------------------
A0A409P6G9      ------------------------------------------
A0A3R3YDR2      ------------------------------------------
A0A3R4BTI6      ------------------------------------------
A0A3B1CXE3      ------------------------------------------
A0A3B1CYP8      ------------------------------------------
A0A382PKY1      ------------------------------------------
A0A3B1DET2      ------------------------------------------
A0A3B1D1Y9      ------------------------------------------
A0A3R1GI32      ------------------------------------------
K1ULC5          ------------------------------------------
A0A3B0VG16      ------------------------------------------
A0A3R2TTF1      ------------------------------------------
A0A408BKC9      KQREEELKDITKDSISVDKAQDVLNQINTYLSEEKKKLKGDS
A0A409SIT6      ------------------------------------------
A0A3R3BMP0      ------------------------------------------
A0A3R4HSN4      ------------------------------------------
A0A3R1RAJ9      ------------------------------------------
A0A406EFX4      ------------------------------------------
A0A408LKC9      ------------------------------------------
A0A3R5KFR9      ------------------------------------------
A0A404MRF7      ------------------------------------------
A0A3R4D168      ------------------------------------------
A0A0F9HWF5      ------------------------------------------
A0A2H9T3X6      ------------------------------------------
A0A380TAR7      ------------------------------------------
A0A407YHX1      ------------------------------------------
A0A3R4QZA0      ------------------------------------------
A0A3R5GLV2      ------------------------------------------
A0A3R4UA41      ------------------------------------------
A0A0F9C030      ------------------------------------------
A0A0F9G9C6      ------------------------------------------
A0A2P2C6F5      ------------------------------------------
A0A3R2Y861      ------------------------------------------
A0A3R3WRK8      ------------------------------------------
A0A3R3W423      ------------------------------------------
A0A3R5NV43      ------------------------------------------
A0A3R2VV23      ------------------------------------------
A0A3R3PPN7      ------------------------------------------
A0A404ALK7      ------------------------------------------
A0A3R4HE49      ------------------------------------------
K1S5Q5          ------------------------------------------
A0A0W8FVN7      ------------------------------------------
A0A407LWW7      ------------------------------------------
A0A409DV79      ------------------------------------------
X0S5W7          FRKT--------------------------------------
A0A404N310      ------------------------------------------
A0A408M394      ------------------------------------------
A0A3B1DSI5      ------------------------------------------
A0A3R4U3E9      ------------------------------------------
A0A3R1HJ57      ------------------------------------------
A0A3R2KDK8      ------------------------------------------
A0A3R4U8W0      ------------------------------------------
A0A404C9H2      ------------------------------------------
A0A408ANB0      ------------------------------------------
X0T0M9          ------------------------------------------
A0A3R4ZJ07      ------------------------------------------
A0A409P464      ------------------------------------------
A0A3R3EEA8      ------------------------------------------
A0A3R5AYY7      ------------------------------------------
A0A408AG77      ------------------------------------------
A0A406QJE9      ------------------------------------------
A0A3R5CIW6      ------------------------------------------
A0A3R2KDF2      ------------------------------------------
A0A3R3PAM0      ------------------------------------------
A0A3R3G320      ------------------------------------------
A0A404NRH5      ------------------------------------------
A0A3R1RKC9      ------------------------------------------
A0A3R4GVU7      ------------------------------------------
A0A3R1GW93      ------------------------------------------
A0A3R5DAG0      ------------------------------------------
A0A406DTV4      ------------------------------------------
                                                          

© 1998-2019