BYKdb

Dataset for cluster tadcd of phylum metagenomes

[Download (right click)] [Edit] [Sequences] [Repertoires]

112 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1C250      ---------------------MPGYNKDENSGGYVEPYQNSSDADGDE-------INLSE
A0A1J5RCY3      -------------------------------------------------MQGQALVELHD
A0A1J5RUE5      -----------------------------------------------------MPVELDE
A0A0F9JKD8      -------------------------------------------MQQQE-------IHLRD
A0A0F9XPI6      --------------------------------MTETPFNLDYDQKQDR-------FDLGE
A0A2H9TBF4      ----------------------------MQQSTDVSAQGTAASQDEDI-------IDLRS
A0A3R2R3E8      ------------------------------------------------------------
A0A1J5SM24      ---------MESPEKQQTPSKSSNYGGYAGYGAPYGYGYGPSEGGAGQ-------RTFQD
A0A3B1C7A9      -----------------------------------MDNEFDNNIQEET-------HSIKD
A0A1J5SPZ5      --------------------------MSDVPQQTPPPKPPPPPAAAREEDEIVERRTLRD
A0A409NWS0      ------------------------------------------------------------
A0A3R1PE73      -------------------------------MTEKTKPSAAPISGSDE-------IDIGR
A0A3R3CX96      -------------------------------MTEKTKPSAAPISGSDE-------IDIGR
A0A408NUV2      ------------------------------------------------------------
A0A3R5LMR4      -------------------------MTISSTSSTSSSRQNNAAVENDE-------IDLGR
A0A3R5Q2V2      -----------------------------MTTSSVSSRQNSAAVENDE-------IDLGR
A0A404B052      -----------------------------MTTSSVSSRQNSAAVENDE-------IDLGR
A0A3R1PAA4      -------------------------------MMKNNALPIVMAEQDDK-------LEWER
A0A3R2C7H5      -------------------------------MMKNNAMPIVMAEQDEK-------LEWER
A0A405AF34      -------------------------------MMKNNAMPIVMAEQDEK-------LDWER
A0A3R2D8P2      -------------------------------MANPKNNSTQAAESSNE-------IDLAR
A0A3R2C102      -------------------------------MTEKNRAVSTASKENEE-------IDLGR
A0A3R2GYI6      -------------------------------MTDNTKAGLSTANDNDE-------IDLNR
A0A3R2EM25      -------------------------------MTDNTKPGLSTANNHDE-------IDLSR
A0A3R3FNT7      -------------------------------MTDNTKPGLSTANNNDE-------IDLSR
S0DG33          ----------------------------MDDYPMNSLYPAASTERGQLSASGMLTLMRDH
A0A3R2V5T0      --------------------------MHHKTFKSNIGFPESGKDSDTF-------IDLDR
A0A405JUY6      --------------------------MDQANFRPMTIFPPEPKDHDTF-------IDLDK
A0A445V3X4      MHQPTPDNQPVDRAHDLMQHEYLPQPRQQAPHYDTVEPQWYERDDEDS-------IDLRE
A0A445VBS2      MHQPTPDNQPVDRVPDLMQHEYFPQPRQQSPHYDTVEPQWYERDDEDT-------IDLRE
A0A407V607      -----------------------------------------MPLKSEL-------HSDQG
T0ZG59          ------------------------------------------------------------
A0A3R3TCJ4      ----------------------------------MSTTIEIPAARSET-------FGLRN
A0A3R4EU13      ----------------------------------MSTTIEIPAARSET-------FGLRN
A0A3B1AK25      ----------------------------------MQENKAQQPLEEDE-------IDLRE
A0A3R4E576      --------------------MQLHNRDFQRNWRVDDTDDDNSPRG----------IDFEA
A0A404I461      --------------------MQLHNRDFQRNWRVDDTDDDNSPRG----------IDFEA
A0A408J920      --------------------------MLQRHDPLTMADYDKSGLTAEF-------IDIDA
A0A3R1N912      --------------------------MLQRHDPLTMADIDKNAFAADF-------IDIDA
A0A405ZIS9      ---------------------------MQRHDPLTMADYDKSGLTAEF-------IDIDA
A0A380TGM5      -----------------------MQMDRPNLTPAYPSVW----AAERS-------YDIRE
A0A3P5W345      -----------------------MQMDRANLTPAYPSVW----AAERS-------YDIRE
A0A380TDI0      -----------------------MDQRLTTATQSEPAEPRRRPLAALD-------SELRE
A0A380TDN3      -----------------------MDQRLTTATQSEPAEPRRRPLAALD-------SELRE
A0A3P5WKD3      -----------------------MDQRLTTATQSEPAEPRRRPLAALD-------SELRE
A0A3R2WIS1      ------------------------------------------------------------
A0A3R5EJ70      -----------------------MTPSASTSAPLTPNTIRPRDDDDDV-------INLSE
A0A3R3UIB9      -----------------------MDMTVSARERNWIAQR----LANDA-------PDILQ
A0A409NVE8      -----------------------MDKTSQHPEPAKLPQRLPQGLASDI-------PDLLQ
A0A0F9U8M8      ----------------------------------MNTSSNTFLETNNT-------LDLKR
A0A381Y0U7      ----------------------------MDKIPSTEQSLPSTEQSSDK-------LHILD
A0A381Z3K5      ----------------------------MDKT-------PSTDQSSDR-------LHIMD
A0A0F9UWR4      -------------------------MNSSIRPDRQWQPMPSDDDTDY--------IDLKK
A0A3R1X0V0      -------------------------MQSNLLSRK--PNPPGLEMSDE--------IDLLK
A0A0F9LFA5      ----------------------------------MNQTNENLSNNEEI-------IDLGS
A0A1J5R1Y0      -------------------------MDTPTANPAHTTIQGAAQLSEEK-------LELLT
A0A160TC29      -------------------------------------MNNAAAVEVID-------LT--H
A0A3R2TSB1      -------------------------MNARWYPPLPAPYSPEPERPHSR-------FK--E
A0A3R3XUC2      -------------------------MNARWYPPLPAPYSPEPERPHSR-------FK--E
A0A407WVH8      ------------------------------------------------------------
A0A408G2L4      ------------------------------------------------------------
A0A405APZ8      -------------------------------MLDKELPQG-QKEQSEE-------IDLHR
A0A3R1LUZ7      --------------------------------MPSETPIKNTTQQKTE-------IDIGR
A0A3R2BGD8      ------------------------------MMKNNALPIV-MAEQDDK-------LEWER
A0A3R2U6C3      ------------------------------MSLPIETFEPSVPARQQE-------TPLSS
A0A3R3W6C3      ------------------------------MSLPIESFEPNVPARQQE-------TPLSS
A0A407XAA6      ------------------------------MSLPIESFEPNVPARQQE-------TPLSS
A0A3R5H8M2      -------------------------------------MNQNSSTSEDT-------IDLKE
A0A3R2H5L1      -------------------------------------MNQNTNT-EDT-------IDLKE
A0A3R1PLZ2      -------------------------------------MNQNTNT-EDT-------IDLKE
A0A406JUR4      -------------------------------------MNQNTNT-EDT-------IDLKE
A0A409MU65      -------------------------------------MNQNTNT-EDT-------IDLKE
A0A3R2CMW0      -------------------------------------MSQNSNT-EDT-------IDLKE
A0A407T0V1      -------------------------------------MSQTTNT-EDT-------IDLKE
A0A0F9VQU4      --------------------------MTESVAIEPMSDLSQKSLPEET-------IDLSR
A0A1W1DYN8      ------------------------------MDTLINTSSNLSTDSNEE-------IDLQE
A0A1W1E4Z5      ------------------------------MDTLINTSSNLSTDSNEE-------IDLQE
A0A3R1GLT3      ---------------------------------MTTNTRIPAQDDTDE-------IDLRQ
A0A3R3DWA3      ------------------------------MEVMTKEAGTRVSRDEDE-------IDLRE
A0A2H9T6C5      -------------------------------MPNEMTQSRPTVADDDV-------ISLSE
A0A3R2W4Z8      ------------------------------------------------------------
A0A3R5D942      --------------------------MTPSASTSPLSAALARDDDDDA-------INLSE
A0A0F9KY21      -------------------------MVKLMNSKPIAPTNDQNKSSAQE-------IDLLA
A0A404TF61      ------------------------------MQQTPALTSHD---DDDE-------IDLMG
A0A406MXU2      ------------------------------MQQTPALTSHD---DDDD-------IDLMG
A0A3R4Q9I0      ------------------------------MQSPNSLPIQEHRDDDDD-------IDLLA
A0A407TZB0      ------------------------------MQSPNSLPIQEHRDDDDD-------IDLLA
A0A0F9W5Q6      -------------------------------MQTTSAPTAN--ETSDE-------IDLLA
A0A404IBN2      ------------------------------MQQTPALTSHD----DDE-------IDLMG
A0A406Y387      ------------------------------MQQTPALTSHD----DDE-------IDLMG
A0A3R1X9G0      ------------------------------MQQSHV--QQD--IDNDE-------MDLLG
A0A3R3ZKH7      ------------------------------MQQSHV--QQD--IDNDE-------MDLLG
A0A3R2WMV4      ------------------------------------------------------------
A0A3R3BQL7      ------------------------------MQLPSVVSDRD--KDRDE-------IDLLG
A0A3R4AM40      ------------------------------MQLPSVVSDRD--KDRDE-------IDLLG
A0A3R2HMB7      ------------------------------------------------------------
A0A3R4QTV3      ------------------------------------------------------------
A0A3R4YGM2      ------------------------------MQLPSVIGTRD--NDQDS-------IDLLG
A0A3R1WG16      ------------------------------MQLPSVIGTRD--NDQDS-------IDLLG
A0A3R3R2K7      ------------------------------MQLPSVIGTRD--NDQDS-------IDLLG
A0A3R3TSL3      ------------------------------MQLPSVIGTRD--NDQDS-------IDLLG
A0A3B0VME9      -------MNNQTEPIDNAGEDRQTMVPAGDTHLPSTRVHEIMPPVEEE-------INLRD
A0A3B1DSR1      -----------------------------MNTQNNLSEFDQTGLTESS-------GFEID
A0A0F9I1G8      ---------------DLPIAPAPVRRDNEEMLPSTEFRQAAPDWEGEE-------VHLRD
J9FGR8          ---------------------------------MTDQKKLAQNAANEF-------AWVTD
A0A0W8FS74      -----------------------------MTPNVSIPPSQPLLRSGEN-------AHIYD
A0A3B0V744      ----------------HDYPLNFGVKIMVQFNQNIGNNPPALEEENHD-------IDWIK
A0A405V7W6      ------------------------------------------------------------
A0A1W1D4H7      ---------------------------------MNTMDNKYNDEFDDE-------IDLRE
A0A3B1CUQ0      ---------------------------------MSQLEHT-DDVEERE-------IHLND
A0A1W1BK27      --------------------------------------MQNIQIEEDE-------IDLSQ
A0A1W1CD04      ----------------------------------------MNEIEEDE-------IDLRE
                                                                            

A0A3B1C250      YWYTIKRNKWGILGLAFVATLIGVLTAFSMKPIYRASVTILIE-----------------
A0A1J5RCY3      YLTIVRKRWVSILVATALSLVVAIGVTLLATPTYQASAQVFVS-----------------
A0A1J5RUE5      YVLALRKRWLIIAALALVGAVTGWLYAHSMTPNYRATANVFVS-----------------
A0A0F9JKD8      YFRILRKRRHVVLTFFFITLALVILFTFTASPLYKADTRLLIE-----------------
A0A0F9XPI6      ILKKYIKYWPWFAASFLLTLAFAVFYLLSTAKIYESVAKIKIV-----------------
A0A2H9TBF4      LFTTLFHYRWAILGFTLIVTLLTVLVVFSITPKYQATAVLLIE-----------------
A0A3R2R3E8      -------------------MSIAFFYLRYTKPVYDSSMLIQLA-----------------
A0A1J5SM24      YVLILRERAWYIVAVFLVVFSTALIITLSKTKIYESSASVQIF-----------------
A0A3B1C7A9      YFNLIRINIIPILLIGLTGLAVSVIYAFTARDIYTASTALKIQ-----------------
A0A1J5SPZ5      YYIILRERFWIAFPLALLVSLGVGYYQSRQTPMYMSTATMQFE-----------------
A0A409NWS0      ------------------------------------------------------------
A0A3R1PE73      LVGTVVEAKWWVLGITAVFALAAVIYTLFATPIYSADALVQIE-----------------
A0A3R3CX96      LVGTIIEARWWVLGITAVFALAAVIYTLFATPIYSADALVQIE-----------------
A0A408NUV2      ------------------------------------------------------------
A0A3R5LMR4      LLGYLIDGRWWIVTITALFMVLGVAYALLATPVFKANALLQVE-----------------
A0A3R5Q2V2      LLGYLIDGRWWIVTITSLFMVLGVAYALLATPVFKANALLQVE-----------------
A0A404B052      LLGYLIDGRWWIVSITGLFMVIGVAYALLATPVFKANALLQVE-----------------
A0A3R1PAA4      LIGPLWDNRWRILLVTGVAGILGCAYALMATPIYQATALVQVE-----------------
A0A3R2C7H5      LIGPLWDNRWRILLVTGVAGALGCAYALMATPIYQATALVQVE-----------------
A0A405AF34      LIGPLWDNRWRILLVTGVAGVLGCAYALMATPIYQATALVQVE-----------------
A0A3R2D8P2      TFGTLIDHCWLIVGVTCMFTVLGIIYSLFATPIYQSDALIQVE-----------------
A0A3R2C102      LVGTLIDHRWLIIGITALFAVMGIIYSLFATPIYQADATVQVE-----------------
A0A3R2GYI6      LLGVLLDHRWLITGVITLFAVVGIIYSIFSTPVYQADAMVQVE-----------------
A0A3R2EM25      LLGTLLDHRWLIIGITALFSVTGIIYSLFATPVYQADAMVQVE-----------------
A0A3R3FNT7      LLGTLLDHRWLIIGVTALFSVAGIIYSLFATPVYQADAMVQVE-----------------
S0DG33          IWEIVV--------TTVVVLTLAVAYLLIATPIYSADVLIRVD-----------------
A0A3R2V5T0      LWAAVVRRANVIAASVIAAVVLAGLYLVLATPVYTAMTQVLLD-----------------
A0A405JUY6      LWSAAMRRLGVIGACVAAMVVLAGLYLVFAQPMYTSMTNILMD-----------------
A0A445V3X4      YWRILVRRRWTVFSVLVLAFVGGLLVHFLTTPIFRATLLLQIE-----------------
A0A445VBS2      YWQILVRRRWTVFSVLVLAFVGGLLVHFLTTPIFRATLLLQIE-----------------
A0A407V607      LVALGLRRWKTMAIVFTVVVATGAVVVQAMPRAYEASAKVLIM-----------------
T0ZG59          -----------IALILTLLATP----------IFRADTTLQIN-----------------
A0A3R3TCJ4      LLAIFRRRLRLFAAIVLIVFLAALVVTARMTPRYTAQAQVMLN-----------------
A0A3R4EU13      LLAIFRRRLRLFAAIVLIVFLAALVVTARMTPRYTAQAQVMLN-----------------
A0A3B1AK25      YWRVIMRHKSSIFGLAFLAAILSALVVFAMKPIYSSTVTLLIE-----------------
A0A3R4E576      IFAIVRRQWLVVAVCIAVALALGVVNIITAVPLYTASTKILID-----------------
A0A404I461      IFAIVRRQWLVVAVCIAVALALGVVSIITAVPLYTASTKILID-----------------
A0A408J920      ALAIIRRQWRIVLAAIAVAGAIGLAFAATAVPIYSATATLLID-----------------
A0A3R1N912      ALATIRRQWRIVLATIAIAGTIGLAYAATAVPIYSATATLLID-----------------
A0A405ZIS9      ALAIIRRQWRIVLAAIAVAGAIGLAFAATAVPVYSATATLLID-----------------
A0A380TGM5      LTRIVRRRKSIVIGTVTLILALTVFFLSQLTPTYRAEALVIVE-----------------
A0A3P5W345      LTRIVRRRKSIVIGTVTLILALTVFFLSQLTPTYRAEALVIVE-----------------
A0A380TDI0      TIRSFWRHKWAILGVVVLLTGIAVLYVQTATPRYTAELQVVFE-----------------
A0A380TDN3      TIRSFWRHKWAILGVVVLLTGIAVLYVQTATPRYTAELQVVFE-----------------
A0A3P5WKD3      TIRSFWRHKWAILGVVVLLTGIAVLYVQTATPRYTAELQVVFE-----------------
A0A3R2WIS1      --------------------------------------MIQVE-----------------
A0A3R5EJ70      YFDILLDRKWLVAGVTAVALGLGLAYALLATPIYESNLLIQVE-----------------
A0A3R3UIB9      IWQILWRRKWSILALVLIVMMVTALGTFVITPTYRATSTLLIE-----------------
A0A409NVE8      MWHPIWRRKWSILALMLAIMLVTALATFAITPTYRATTTLLIE-----------------
A0A0F9U8M8      YLHACMEYKWRLIFISSLISVIAAFVVMQIKPTYESTATLLIE-----------------
A0A381Y0U7      YWRIIRVRFVVILLVFLITAVTTTVVTFLLPPTYMSLSRISVE-----------------
A0A381Z3K5      YWRIIRVRFVVILLVFLITAVTTTVVTFLIPPTYMSLSRISIE-----------------
A0A0F9UWR4      IWYAIWSRKWSIISLVVVVSMLATLAVMQMTPVYRASTTMMIE-----------------
A0A3R1X0V0      FWKALWRRKWAIVGFSMLPSLLVGLSLLTVTPTYRAETTVLIE-----------------
A0A0F9LFA5      YLNVIKRAKWRILGFATVVTLLAIMVALTLIPKYVATATLLIE-----------------
A0A1J5R1Y0      YWRTFVKHKLTIFSLALAVGILAAVVVYMMRPIYRATAMIQLE-----------------
A0A160TC29      YWHVIRRQMRKIMALSVIATIVAVLVALVMTPIYRATATLLIE-----------------
A0A3R2TSB1      YVDLMLDNRWLIASVTAAVLVLGAGYALFGPRVYEANVLIQLEDAERSPGGAGDAAVNGV
A0A3R3XUC2      YVDLMLDNRWLIASVTAAVLVLGAGYALFGPRVYEANVLIQLEDAERSPGGAGDAAVNGV
A0A407WVH8      ----MLDNRWLIASVTAAVLVLGAGYALFGTRVYEANVLIQLEDAERSPGGAGDAAVNGV
A0A408G2L4      ----MIDQKWLIGALTGAFMVTGVAYAVLATPVYLANALVQVE-----------------
A0A405APZ8      LFAELLTNRWLITGITGVFAAISLIYVIFATPVYKSTALIQVE-----------------
A0A3R1LUZ7      LVGEVIDHRKLIISVVAIFATISLVYVLFATPVYQANALVQVE-----------------
A0A3R2BGD8      LIGPLWDNRWRILLVTGVAGILGCAYALMATPIYQATALVQVE-----------------
A0A3R2U6C3      HVDAIFSNRWMIIAITMVALLGALAYVMVTPSVYSADIIVQVE-----------------
A0A3R3W6C3      HVDAIISNRWMIIAITLLAFLGALAYVMVTPSVYSADIIVQVE-----------------
A0A407XAA6      HVDAIISNRWMIIAITLLAFLGALAYVMVTPSVYSADIIVQVE-----------------
A0A3R5H8M2      LFFSLIAQWKLIALCTIFSLICALLYLRVTQPVYSTDALILVE-----------------
A0A3R2H5L1      LFFSLIAQWKLIALCVILSLVCALLYLRVTPNTYSVDALVQVE-----------------
A0A3R1PLZ2      LFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVE-----------------
A0A406JUR4      LFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVE-----------------
A0A409MU65      LFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVNALVQVE-----------------
A0A3R2CMW0      LFFSLIVQWKLIALCVILSLVCALLYLRTTPDTYAVDALVQVE-----------------
A0A407T0V1      LFFSLISQWKLIALCILLSLICALLYLRATPDTYSVDALVQVE-----------------
A0A0F9VQU4      LFGALFRKKWLIIGVTLLFAFIGIVHGMLSTPVYRADALVQVE-----------------
A0A1W1DYN8      LFGTLVEKKWLIAIITSIIFMASVFYVLIATPVYRADTVLQVE-----------------
A0A1W1E4Z5      LFGTLVEKKWLIAIITSIIFMASVFYVLIATPVYRADTVLQVE-----------------
A0A3R1GLT3      LLGTLIDHKWWIAAITGGFFVAAAAYALLATPIYRADAIVQVE-----------------
A0A3R3DWA3      LLGLLLDRKWWIIGATLLFCVIGAAYALLVTPVHQAQAMVQVE-----------------
A0A2H9T6C5      ILDILIKGKWWIAGATLFFAVCSLAYLWVATPVFQSDALVQVE-----------------
A0A3R2W4Z8      -----------MAGVTAVALVIGTAYALLATPIYQSNLLIQVE-----------------
A0A3R5D942      YLDILLDRKWLVAGVTAVALAIGTAYALLATPIYQSNLLIQVE-----------------
A0A0F9KY21      LLGTLLDRKYFIVLFTAVFAVIGVAVAIFSTPIYKATALIQVE-----------------
A0A404TF61      LLGTLVDHKWLIAGITAASMAVGTAYAVLANPVYQATALIQVE-----------------
A0A406MXU2      LLGTLVDHKWLIAGITAASMAVGTAYAVLANPVYQATALLQVE-----------------
A0A3R4Q9I0      LFGTLIDSKWIIVGITAFFCAVGVAYALLSTPIYQANALVQVE-----------------
A0A407TZB0      LFGTLIDSKWIIVGITAFFCAVGVAYALLSTPIYQANALVQVE-----------------
A0A0F9W5Q6      LLGALIDHKLTIIACTLVFAVCGIAYALLSTPIYQANAVIQIE-----------------
A0A404IBN2      LLGTLVDHKWLIAGITAASMAVGTAYAVLATPVYEATALIQVE-----------------
A0A406Y387      LLGTLVDHKWLIAGITAASMAVGTAYAVLANPVYQATALIQVE-----------------
A0A3R1X9G0      LFGAVVDHKWMIAAITGAFMVAGASYAILATPIYQANALVQVE-----------------
A0A3R3ZKH7      LFGAVVDHKWMIAAITGAFMVAGASYAILATPIYQANALVQVE-----------------
A0A3R2WMV4      ------------------------------------------------------------
A0A3R3BQL7      LLGTLIDHKWLIGAITGAFMVTGAAYSILSSPVYLANALVQVE-----------------
A0A3R4AM40      LLGTLIDHKWLIGAITGAFMVTGAAYSILSSPVYLANALVQVE-----------------
A0A3R2HMB7      -------------------MVTGAAYSILSSPVYLANALVQVE-----------------
A0A3R4QTV3      -------------------MVTGAAYSILSSPVYLANALVQVE-----------------
A0A3R4YGM2      IFGSLIDQKWLIGALTGAFMVTGVAYAVLATPVYLANALVQVE-----------------
A0A3R1WG16      IFGSLIDQKWLIGALTGAFMATGVAYAVLATPVYLANALVQVE-----------------
A0A3R3R2K7      IFGSLIDQKWLIGALTGAFMATGVAYAVLATPVYLANALVQVE-----------------
A0A3R3TSL3      IFGSLIDQKWLIGALTGAFMVTGVAYAVLATPVYLANALVQVE-----------------
A0A3B0VME9      YLDVILRRRWVIILTLLVTFSLVAVFTFSSTPLFLAQGTLKAS-----------------
A0A3B1DSR1      LLSLASRHWKLLLLGLIVGLVLGELYYRKAGPEYDATARILVE-----------------
A0A0F9I1G8      YLEVIARRKWLIFGFLALVFISTLIFTLTATKIYKANAVIEAN-----------------
J9FGR8          LWGMFAPRWIWFLASVLLFMSGAVLYLMSTPAVYTRTASILIK-----------------
A0A0W8FS74      YLSVILRRRKLFTLAFCAVLFSVVLYTYFMKPIYEASSTLHIK-----------------
A0A3B0V744      LRLILRKGIPWFITIFVLLILVAALYLRYTKPMYQSNSEIKLD-----------------
A0A405V7W6      MSVIFRRYWWWVILLVLFFMSIAFFYLRYTKPVYESSMLIQLA-----------------
A0A1W1D4H7      LYKTLLKHKISIFLITFLFFIGSLIFAYYKPNIYSSNMSLEIL-----------------
A0A3B1CUQ0      YIEVLLRKKWIVISCFVVIVLATGIGTYLATPIYEATTSILID-----------------
A0A1W1BK27      LFSTLKKNFFTIVFITLFITSLVVVYSYFLPPIYSSDVKISFS-----------------
A0A1W1CD04      LIDKLKNSLTTIVIITVLFMIGAGGYIYFSKPVYKSSVTISLD-----------------
                                                                            

A0A3B1C250      -------------------PEQPKFVSVIPMESGSNINYFYAT--------QYKIIRSR-
A0A1J5RCY3      ------VNSAGTTADLLQGSNYSQQQVAS----------------------YTDLVTSP-
A0A1J5RUE5      ------VNGGGTAGELVQGSTFVQNSVES----------------------FAKLASMP-
A0A0F9JKD8      -----------------------------KSEQYTITEYGFTVYDPEFYSTQYKIIKSR-
A0A0F9XPI6      ----------DNSTDIGLQSNAMSLFTNGSTINLDN---------------QIEILTSY-
A0A2H9TBF4      ------QEQ----------AKVVSIEEVYGIDGGGDSYLNT----------QHEVLKSR-
A0A3R2R3E8      --------EKDQGKELLEIDNVNKRVDIST---------------------EIELLRSQL
A0A1J5SM24      ------RRD----------PVIMQTQAVMDNEVRSAEDLNT----------QVKILESE-
A0A3B1C7A9      ------KPQAGGILSSPLLPEISDF----GNDRFIAN--------------EIEILKSRR
A0A1J5SPZ5      --------------------KPDRIVTTEGVTNPAVQSEIDINT-------NIEILKSD-
A0A409NWS0      ------------------------------------------------------------
A0A3R1PE73      ----------QNS-GNSLVQDIGSALANK---PPASDA-------------EIQLIQSR-
A0A3R3CX96      ----------QNS-GNSLVQDIGSALANK---PPASDA-------------EIQLIQSR-
A0A408NUV2      ------------------------------------------------------------
A0A3R5LMR4      ----------KKASGAALLGDMADVLGGE---QPDAAA-------------EIELLTSR-
A0A3R5Q2V2      ----------KKASGAALLGDMADVLGGE---QPDAAA-------------EIELLTSR-
A0A404B052      ----------KKVSGAALLGDMADVLGGE---QPEAAA-------------EIELLTSR-
A0A3R1PAA4      ----------KQLSGDSLLRETLDSSIGGVGQNSATQD-------------EVSLAKSR-
A0A3R2C7H5      ----------KQLSGDSLLRETLDNSLGSAGQNSATQD-------------EVSLAKSR-
A0A405AF34      ----------KQLSGDSLLRETLDNSMGSMGQNSATQD-------------EVSLAKSR-
A0A3R2D8P2      ----------QNV-GNSLLNNLSEILPNN---QPPSAA-------------EIQLIQSR-
A0A3R2C102      ----------QNE-GNSLVNNISQMLPNS---QPASST-------------EIELITSR-
A0A3R2GYI6      ----------QNA-GNSILSDFSQMLPSS---QPGSAT-------------EIELISSR-
A0A3R2EM25      ----------QNV-GNSLVNDLSQMLPSS---QPGSST-------------EIELIKSR-
A0A3R3FNT7      ----------QNV-GNSLVNDLSQMLPNS---QPGSST-------------EIELIKSR-
S0DG33          -------------------PPEPNALGLALQDQEALPPPAPAPVT------EMAVMKSR-
A0A3R2V5T0      -------------------ESLSRYAEEE-SPVPAAQIVDNRIAS------AVEILKSK-
A0A405JUY6      -------------------DNLSRYAEENASDNQSAQMLDNRMSS------AVEILKSK-
A0A445V3X4      ------PEI----------SKLLKYENILAT-DDENNFYET----------QYRLLRSR-
A0A445VBS2      ------PEI----------SKLLKYENILAT-DDESDFYET----------QYRLLRSR-
A0A407V607      ------RTD----------QRLGGLNVMNDTLPELTNLTNPLY--T-----QVELLRIY-
T0ZG59          ------RDT----------VNV----VQVQGFQPVESLNDQTFYQT-----QYDLLKSH-
A0A3R3TCJ4      ------TRQ----------EQVVDTKAVLSNLPAESGVIDT----------EVEVLQSR-
A0A3R4EU13      ------TRQ----------EQVVDTKAVLSNLPAESGVIDT----------EVEVLQSR-
A0A3B1AK25      ------PGS----------ANVVSIEDVYGD-SDTSTYYKT----------QHEILESR-
A0A3R4E576      ------RGN----------SEVVQQLSTIGGVTDDEPTVLS----------QVELLMSD-
A0A404I461      ------RGN----------SEVVQQLSTIGGVTDDEPTVLS----------QVELLMSD-
A0A408J920      ------RNN----------SQIVEQLSTIGGVIEDEASILS----------QVEVLQSE-
A0A3R1N912      ------RNN----------SQVVEQLSTIGGVIEDEASILS----------QVEVLQSE-
A0A405ZIS9      ------RNN----------SQIVEQLSTIGGVIEDEASILS----------QVEVLQSE-
A0A380TGM5      ------SRK----------ANIADLREILTDVSANQETTRN----------EIEVIRSR-
A0A3P5W345      ------SRK----------ANIADLREILTDVSANQETTRN----------EIEVIRSR-
A0A380TDI0      ------NKT----------GPLFDFQAAVAGAPQDEASILT----------EIEVIRSR-
A0A380TDN3      ------NKT----------GPLFDFQAAVAGAPQDEASILT----------EIEVIRSR-
A0A3P5WKD3      ------NKT----------GPLFDFQAAVAGAPQDEASILT----------EIEVIRSR-
A0A3R2WIS1      ------DSA----------PDSKNFLGDTANLFDVKTPAIG----------EIQIIRSR-
A0A3R5EJ70      ------DSA----------PDSKNFLGDTANLFDVKTPAIG----------EIQIIRSR-
A0A3R3UIB9      ------HKS----------ANVVSIEQVYDPEGMGNEYLLT----------QFELLKSR-
A0A409NVE8      ------QKK----------SNVVSIEQVYGSEWGGNEYLQT----------QFELLMSR-
A0A0F9U8M8      ------PEQ----------KNVVSIDEMYGFNTAKREFYST----------QFEILQSK-
A0A381Y0U7      ------KET----------SDIAPLLGMQSGPTAFDPYFIQT---------EFEKIQSQ-
A0A381Z3K5      ------KDT----------SDIAPLLGMQSGPMAFDPYFIQT---------EFEKIQSQ-
A0A0F9UWR4      ------GKG----------NQLVAFQQVYDNTGQLNEYLQT----------QIGLISSR-
A0A3R1X0V0      ------GKP----------SSVGSIEHVYGRDTVSSEYLPT----------QLELFKSR-
A0A0F9LFA5      ------AEQ----------TKAVSFDEIYGLDSTKKEYYLT----------QFEVIKSD-
A0A1J5R1Y0      ------DNN----------AKVLSIEQVYSSLAHGSEHVQT----------QADILRSR-
A0A160TC29      ------SEE----------AKILSIEEVYGLSGQSSEYFLT----------QFEILKSR-
A0A3R2TSB1      GVKTPTSGE----------AEILKSRMVLGQAIENTKLFIKARPHYIPVVGAFMARHSK-
A0A3R3XUC2      GVKTPTSGE----------AEILKSRMVLGQAIENTKLFIKARPHYIPVVGAFIARHSK-
A0A407WVH8      GVKTPTSGE----------AEILKSRMVLGQAIENTKLFIKARPHYIPVVGAFIARHSK-
A0A408G2L4      ------PK-KNDMLGFSDLNSMLGG------QSPSVT--------------EIGIIKSR-
A0A405APZ8      ------KN-AGNSL----LTDISSML--PDSQPQSDA--------------EIELIQSR-
A0A3R1LUZ7      ------QK-QGNAI----LDSLTQAL--PTTQPKSDP--------------EISLLLSR-
A0A3R2BGD8      ------KQLSGDSLLRETLDSSIGGS--IGQNSATQD--------------EVSLAKSR-
A0A3R2U6C3      ------EEM-PNGQARSLLGDVSSMF---DTKAETSG--------------EMEVLRSR-
A0A3R3W6C3      ------EEA-PNGQARSLLGDVSSMF---DTKAETSG--------------EMEVLRSR-
A0A407XAA6      ------EEA-PNGQARSLLGDVSSMF---DTKAETSG--------------EMEVLRSR-
A0A3R5H8M2      ------DGKSAASAALLG--ELSQLSGGVGQKSPADA--------------EIEVLKSR-
A0A3R2H5L1      ------DSK-GASAALLG--DLSNM---MEQKSPAQA--------------EIEILKSR-
A0A3R1PLZ2      ------DSK-GASAALLG--DLSQM---MEQKSPAQA--------------EIEILKSR-
A0A406JUR4      ------DSK-GASAALLG--DLSQM---MEQKSPAQA--------------EIEILKSR-
A0A409MU65      ------DSK-GASAALLG--DLSQM---IEQKSPAQA--------------EIEILKSR-
A0A3R2CMW0      ------ENK-GTSAALLG--DLSSM---IEQKQPAQA--------------EIELLKSR-
A0A407T0V1      ------ENK-GASAALLG--DLSSM---VEQKQPAQA--------------EIEILKSR-
A0A0F9VQU4      ------RRN-----TVSPFGNVDNVTGSGSGELNTSA--------------ELQILQSR-
A0A1W1DYN8      ------DKS-N---NMLNLSDLTNF----SASSPTST--------------EIEIIKSR-
A0A1W1E4Z5      ------DKS-N---NMLNLSDLTNF----SASSPTST--------------EIEIIKSR-
A0A3R1GLT3      ------SKV-P---SLPGLSDLSQSLGIGAGSAEATT--------------EIALITSR-
A0A3R3DWA3      ------SRM-P---SIPGLADLTSL--TGGGSSASTT--------------EVALLTSR-
A0A2H9T6C5      ------SQK-S---PVGALVDMSDML---GSESPSEA--------------EIEVIRSR-
A0A3R2W4Z8      ------DSA-PDAKNFLG--DTANLF---DVKTPATG--------------EIQIIRSR-
A0A3R5D942      ------DSA-PDAKNFLG--DTANLF---DVKTPATG--------------EIQIIRSR-
A0A0F9KY21      ------ESS-P---SVPGLDDMAGMF---ESSSEAVT--------------EIELLKSR-
A0A404TF61      ------AKK-N---DMLGFSDINSML---GKESPSAT--------------EIELIKSR-
A0A406MXU2      ------AKK-N---DLLGFSDINSML---GKESPSAT--------------EIELIKSR-
A0A3R4Q9I0      ------EKK-GGMAALGGMGEMSEMF---GGTSPAVT--------------EIELLKSR-
A0A407TZB0      ------EKK-GGMTALGGMGEMSEMF---GGTSPAVT--------------EIELLKSR-
A0A0F9W5Q6      ------EKS-QGIGSLLGDAAGGEMF---SSASAATT--------------EIELLKSR-
A0A404IBN2      ------AKK-N---DMLGFSDINSML---GKESPSAT--------------EIELIKSR-
A0A406Y387      ------AKK-N---DMLGFSDINSML---GKESPSAT--------------EIELIKSR-
A0A3R1X9G0      ------AKK-N---DLLGFSDVSSML---GKESPSVT--------------EIELIKSR-
A0A3R3ZKH7      ------AKK-N---DLLGFSDVSSML---GKESPSVT--------------EIELIKSR-
A0A3R2WMV4      ------------------------ML---GGQSPAAT--------------EIGIIKSR-
A0A3R3BQL7      ------PKK-N---DMLGFSDISSML---GGQSPAAT--------------EIGIIKSR-
A0A3R4AM40      ------PKK-N---DMLGFSDISSML---GGQSPAAT--------------EIGIIKSR-
A0A3R2HMB7      ------PKK-N---DMLGFSDISSML---GGQSPAAT--------------EIGIIKSR-
A0A3R4QTV3      ------PKK-N---DMLGFSDISSML---GGQSPAAT--------------EIGIIKSR-
A0A3R4YGM2      ------PKK-N---DMLGFSDLNSML---GGQSPSVT--------------EIGIIKSR-
A0A3R1WG16      ------PKK-N---DMLGFSDLNSML---GGQSPSVT--------------EIGIIKSR-
A0A3R3R2K7      ------PKK-N---DMLGFSDLNSML---GGQSPSVT--------------EIGIIKSR-
A0A3R3TSL3      ------PKK-N---DMLGFSDLNSML---GGQSPSVT--------------EIGIIKSR-
A0A3B0VME9      ------PRVASITSFKGIAQGMDESFMQSKEFIAT----------------QVKLLKNE-
A0A3B1DSR1      ------KKVSVQLKDGDA---------KIYGDRAE----------------HIKLIMSP-
A0A0F9I1G8      ------RDAPR----VTKFEEVTAALASAREFYQA----------------QVSMLKST-
J9FGR8          ------DDSKSGSSSNAMSEFSDLGIFKNNTNIQN----------------ELLTLKSP-
A0A0W8FS74      ------KEKGPGVLVDMNF--------DSSNSIDA----------------ELEIIKSR-
A0A3B0V744      ------QEDQSNVLGLPQYEQS-----SNMGLLSS----------------EMEIIQSR-
A0A405V7W6      ------EKDQAKELLAIDNI-------NKRDDIST----------------EIELLRSQ-
A0A1W1D4H7      ------KENKGGMESSIALNQML--LGSDQVNLEN----------------EKVVLQSR-
A0A3B1CUQ0      ------DSKGGGQALFTELAGL-----PQTSEIPS----------------QIELIKSR-
A0A1W1BK27      ------NEEKSSMSSLIPNALADF-TATTEKKLET----------------VKLTLETR-
A0A1W1CD04      ------SEKKSKLGDMLQDPFSQ--AGLGKERLKL----------------AKVTLMSK-
                                                                            

A0A3B1C250      ---SVAESVIDKLNLAE-------------------------------------------
A0A1J5RCY3      ---RVLIPVIEKLALGV-------------------------------------------
A0A1J5RUE5      ---VVLDPVIEDLQLDT-------------------------------------------
A0A0F9JKD8      ---PVARKVYDSLKD-NELFI---------------------------------------
A0A0F9XPI6      ---RILSEVVKELQLDVTYYLKGKLKDKQVWDAPFIVVKETSEE---------------L
A0A2H9TBF4      ---ALVEKVVKKLNLIDHPEFNHALREEP-------------------------------
A0A3R2R3E8      LFEVAIAKMNMNVSLFSKGKILTEEKYHQ------------------------SSFTILP
A0A1J5SM24      ---AIIQKVADRLTGND-------------------------------------------
A0A3B1C7A9      LRDIIASALIDSFNT-----VNNPDSFYVLLDHSFDLEDNGVKL----------------
A0A1J5SPZ5      ---RLRERVIHSLTP-EEVKILQRPYLKD-------------------------------
A0A409NWS0      --------------------------------------MGRQND----------------
A0A3R1PE73      ---LVLGKTVDDLDL-D---IGVTKDTFPIFGAGWDRLMGRQND----------------
A0A3R3CX96      ---MVLGKTVDDLDL-D---IAVTKNTFPVFGAGWDRLMGRQND----------------
A0A408NUV2      ---MVLGRTVQELNL-D---TVVTPDFFPLVGRGLSRLMGHPYP----------------
A0A3R5LMR4      ---MVLGRTVQELHL-D---TVVTPDFFPLVGRGLSRLMGHPYP----------------
A0A3R5Q2V2      ---MVLGRTVQELHL-D---TVVTPDFFPLIGRGMSRLMGHPYP----------------
A0A404B052      ---MVLGRTVQELHL-D---TVVTPDFFPLVGRGMSRLMGQPYP----------------
A0A3R1PAA4      ---YVIGKTVDDLGL-T---VRISPDYFPLFGKGIARLSGEVTP----------------
A0A3R2C7H5      ---YVIGKTVDDLGL-T---VRISPDYFPLFGKGLARLSGEPPP----------------
A0A405AF34      ---YVIGKTVDDLGL-T---VRISPDYFPLFGKGLARLSGEPPP----------------
A0A3R2D8P2      ---MVIGKTIDDLKL-D---ISVKQSFMPVFGKGFNRLLGRSEY----------------
A0A3R2C102      ---MIVGKTVQDLNL-D---TVVNQKYFPMFGRGWARLTGEVPG----------------
A0A3R2GYI6      ---MVIGKTVDDLNL-D---IAVNQDYFPMFGRGWERLSGKEPS----------------
A0A3R2EM25      ---MVTGKTVDDLNL-D---TVAQQKYFPVFGRGWARLTGVEPG----------------
A0A3R3FNT7      ---MVTGKTVDDLNL-D---TVTQQKFFPVFGRGWARLTGVEPG----------------
S0DG33          ---SVLEPVIDKFRF-D---VSVTPHKVP-------------------------------
A0A3R2V5T0      ---EMALTVVDKAKF-DENDIIVNPPMSP-------------------------------
A0A405JUY6      ---ELALSVVDKAKL-DQNALIVDPPKSP-------------------------------
A0A445V3X4      ---TLARRVME--EL-N---LTNSENFLP-------------------------------
A0A445VBS2      ---TLARRVME--EL-N---LTNSENFLP-------------------------------
A0A407V607      ---PVFAEAVQ--RL-D---LRDEAG------------------------QPL-------
T0ZG59          ---SLARRVVV--AM-D---LQHDAAFQG-----------LLRP------SPLARLLGFL
A0A3R3TCJ4      ---DLARQVAE--KL-Q---LERDPEFNW-------------------------------
A0A3R4EU13      ---DLARQVAE--KL-Q---LERDPEFNW-------------------------------
A0A3B1AK25      ---LLITKVIA--KL-N---LQENPEFLP-------------------------------
A0A3R4E576      ---TVALTVVD--KL-D---LSNDPTFMT------------ARP------SLIQTIMGTV
A0A404I461      ---TVALTVVD--KL-D---LSNDPTFMT------------ARP------SLIQTIMGTV
A0A408J920      ---TIGLAVVD--SL-K---LTENQEFRA------------TRA------SLLSSIFGTI
A0A3R1N912      ---TIGLAVVD--NL-N---LTENQEFRA------------TRA------SLLSSMLGTV
A0A405ZIS9      ---TIGLAVVD--SL-K---LTENQEFRA------------TRA------SLLSSIFGTI
A0A380TGM5      ---TLARRVIE--QL-G---LAERDEFTS------------SRS------RSLLEIASKA
A0A3P5W345      ---TLARRVIE--QL-G---LAERDEFTS------------SRS------RSLLEIASKA
A0A380TDI0      ---KLADRVIK--AL-Q---LDQDPEFNG-----------KLRP------PS--AFATFF
A0A380TDN3      ---KLADRVIK--AL-Q---LDQDPEFNG-----------KLRP------PS--TLATFF
A0A3P5WKD3      ---KLADRVIK--AL-Q---LDQDPEFNG-----------KLRP------PS--TLATFF
A0A3R2WIS1      ---MVIGGAVEAMRL-Y---INAQPRYVPVIGEWLSRRSTELSN------PGFLGMGGYV
A0A3R5EJ70      ---MVIGGAVEAMRL-Y---INAQPRYVPVIGEWLSRRSTELSN------PGFLGMGGYV
A0A3R3UIB9      ---ALAERVVK--KL-N---LTTHPEFDP-----------RQQP------EPLIDIGGLL
A0A409NVE8      ---ALAERVVR--KL-E---LTTHPEFDP-----------RQQA------APLIDIGSLL
A0A0F9U8M8      ---YIAEAVIE--KL-N---LIKHPEFND-------------------------------
A0A381Y0U7      ---KVLDKVVT--KC---------------------------------------------
A0A381Z3K5      ---KVLDKVVA--KC---------------------------------------------
A0A0F9UWR4      ---GVAERVVR--EL-N---LVEHPEFDP-------------------------------
A0A3R1X0V0      ---ALAERVVR--QL-N---LVAHPEFFA-------------------------------
A0A0F9LFA5      ---SIAREVIT--KL-N---LKAHTD----------------------------------
A0A1J5R1Y0      ---TIAELVLT--KL-D---LVHNPE----------------------------------
A0A160TC29      ---ELAKRVVL--QL-G---LVDNPE----------------------------------
A0A3R2TSB1      ---TLSRPGFL--GMRG---YVSGTERIA-------------------------------
A0A3R3XUC2      ---TLSRPGFL--GMRG---YVSGTERIA-------------------------------
A0A407WVH8      ---TLSRPGFL--GMRG---YVSGTERIA-------------------------------
A0A408G2L4      ---AVIGKTVDDLRL-D---IDVTPNTFPMIGGFLARRYRGETE--TSVAAPRFGLNSYA
A0A405APZ8      ---MVVGKTVQDLGL-E---TQVTQEYFPIFGKGWARLTAQKP-----------------
A0A3R1LUZ7      ---MILGKTVDDLNL-Q---AQIEEKHFPLFGKGLSRISGGSD-----------------
A0A3R2BGD8      ---YVIGKTVDDLGL-T---VRISPDYFPLLGKGIARLSGETP-----------------
A0A3R2U6C3      ---MVVGPAVDKFLL-Y---IHAKPRYFPVVGEWLAQRYESLPY------PSSFPRGGYA
A0A3R3W6C3      ---MVVGPAVDKFLL-Y---IHAKPRYFPVVGEWLAQRYEALPY------PSSLPRGGYA
A0A407XAA6      ---MVVGPAVDKFLL-Y---IHAKPRYFPVIGEWLAQRYEALPY------PSSLPRGGYA
A0A3R5H8M2      ---MVLGQVIQDLNL-N---IKIKDSADSVLNRLVSTKQSQVNYTPNEVI--------YQ
A0A3R2H5L1      ---LVLGSVIKDLHL-N---IQVSSTENTLSHRLLSDTHYKTEYNKKSVI--------FK
A0A3R1PLZ2      ---LVLGSVIKELHL-N---IQVSSTENTLTHRLLSDTEYKTEYTKKSVL--------FK
A0A406JUR4      ---LVLGSVIKELHL-N---IQVSSTENTLTHRLLSDTEYKTEYTKKSVL--------FK
A0A409MU65      ---LVLGSVIKDLHL-N---IEVSSTENTLTHRLLSDTEYKTEYTKKSVL--------FQ
A0A3R2CMW0      ---LVLGSVIQNLNL-D---LKISGTENSFFNRLLSPHDYQSTYNKNAVV--------FK
A0A407T0V1      ---LVLGNVIQHLNL-D---LKISGTENSFTDRLLSPHHYQTQYQPKSVV--------FK
A0A0F9VQU4      ---MVLGQVVDRVSS-D---LIISPVQVPFIGGFVLRRGIPRPA--------FLQGYPHI
A0A1W1DYN8      ---NIIGQTVDQLKL-D---ILVKPDYFPIIGAAIARRNNDKNITKDN------SRTGYA
A0A1W1E4Z5      ---NIIGQTVDQLKL-D---ILVKPDYFPIIGAAIARRNNDKNITKDN------SRTGYA
A0A3R1GLT3      ---AVVGSAVNALRL-D---IEVEPNRFPLFGGYFARKAERSAP--DALADTRFGMTRFG
A0A3R3DWA3      ---TVVGTAVDQLQL-D---IKAEPKRFPSVGGFFARRFEAGVA--DAVASPVLGLARYG
A0A2H9T6C5      ---FVLGEVVDDLTL-D---IVAKPDYFPIIGQAVARRFSPDAEANEPLNSPWLWFSGYA
A0A3R2W4Z8      ---MVIGGAIEAKQL-Y---IDAQPRYLPFIGEWLSRRAKELS------SPGFLGMGGYV
A0A3R5D942      ---MVIGGAVEAKQL-Y---IDAQPRYLPIIGEWLSRRAKELS------NPGFLGMGGYV
A0A0F9KY21      ---SVIGEAVDSLKL-D---ITAEPKLFPIIGGKFYIEFTAEKP--NDIAEPMLGASSYA
A0A404TF61      ---AIIGKVVDNLSL-D---ITVEPNHFPVIGDFIARRFKPDAV--NTVATPWLGMNSFA
A0A406MXU2      ---AIIGKVVDNLSL-D---ITVEPNRFPVIGDFIARRFKPDAV--NTVATPWLGMNSFA
A0A3R4Q9I0      ---AILGKAVENLKL-D---ILIEPNYFPFIGHFLSRRFEPASE--HQVAAPLLGLDSYT
A0A407TZB0      ---AILGKAVENLKL-D---ILIEPNYFPFIGHFLSRRFEPASE--HQVAAPLLGLDSYT
A0A0F9W5Q6      ---KVIGQAVDNLKL-D---IVAEPKLMPVIGSFFYRRFSPTSD--EPLANSFLGFDSYA
A0A404IBN2      ---AIVGKVVDNLSL-D---ITVEPNRFPVIGDFIARRFKPDAV--NTVATPWLGMNSFA
A0A406Y387      ---AIIGKVVDNLSL-D---ITVEPNRFPVIGDFIARRFKPDAV--NTVATPWLGMNSFA
A0A3R1X9G0      ---SIIGEAIDSLGL-N---ITVRPNYFPIVGHFLARRYVKKNP--DSVSDPLLPLSGFA
A0A3R3ZKH7      ---SIIGEAIDSLGL-N---ITVRPNYFPIVGHFLARRYVKKNP--DSVSDPLLPLSGFA
A0A3R2WMV4      ---AVIGKTVDDLRL-D---IVTTPKTFPIVGGFIARRYKSTPT--QSVSPPLFGLNSFA
A0A3R3BQL7      ---AVIGKTVDDLRL-D---IVTTPKTFPIVGGFIARRYKSTPA--QSVSPPLFGLNSFA
A0A3R4AM40      ---AVIGKTVDDLRL-D---IVTTPKTFPIVGGFIARRYKSTPA--QSVSPPLFGMNSFA
A0A3R2HMB7      ---AVIGKTVDDLRL-D---IVTTPKTFPIVGGFIARRYKSTPA--QSVSPPLFGLNSFA
A0A3R4QTV3      ---AVIGKTVDDLRL-D---IVTTPKTFPIVGGFIARRYKSTPA--QSVSPPLFGMNSFA
A0A3R4YGM2      ---AVIGKTVDDLRL-D---IDVTPNTFPMIGGFLARRYRGETE--TSVAAPRFGLNSYA
A0A3R1WG16      ---AVIGKTVDDLRL-D---IDVTPNTFPLIGGFLARRYRGETE--FSVAAPRLGLNSYA
A0A3R3R2K7      ---AVIGKTVDDLRL-D---IDVTPNTFPIIGGFLARRYRGETE--FSVAAPRLGLNSYA
A0A3R3TSL3      ---AVIGKTVDDLRL-D---IDVTPNTFPIIGGFLARRYRGETE--FSVAAPRLGLNSYA
A0A3B0VME9      ---GLLIKLIKKMDLQDNILFVGKKDNDTGHGILGGVKEAFASLKNMIRPRLDSDP----
A0A3B1DSR1      ---LIVNIAIENQNLD--------------------------------------------
A0A0F9I1G8      ---TLIQRVIDKMNL-------------------GEHPVLSLAKDGKEKKSARASIKEFV
J9FGR8          ---ELIAEVVSRLQLNETYTVRQQLKRVDLYKHTPCLLIGAAQTDA-----------SFS
A0A0W8FS74      ---TNLEHVAKRLHLDWQVTKKS-----------KDLDFKLLDFSS--------TAKNPS
A0A3B0V744      ---LFFNKVVETVNLNPQYFTYGNILDDEKYLN-PPFKVSYKILNA--------SIYNIP
A0A405V7W6      ---LLFEMAIARMNINVSMFSKGKILTEE-------------------------KYHQST
A0A1W1D4H7      ---FIVQKALEKLDLDTKYYVINRFFKKIELYKDAPFDVKIISLDD--------MMYGKT
A0A3B1CUQ0      ---TIAEEVVRKLKYDQRVFDIS-----------GDLDPRVTNLQ---------------
A0A1W1BK27      ---KFINSVIKELDINQRYF-IEHNYRKDELYAFDNLEVSLNIHDDNFKEKYDGTLYDKL
A0A1W1CD04      ---KFIGTIIDKVDIAKEFF-IQRNFRKVELKNFSNLKIDIKYNNN--------SLYGKF
                                                                            

A0A3B1C250      -----------------------------KEGFADLVSKKKTGFIEEYLP----------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A0F9JKD8      ----------------------------------------------------KHFEESPG
A0A0F9XPI6      KKAQSLSVNFMANDIEVTDSNGNNFTLFYKQSENALKTSPFRILMIDTLQ----------
A0A2H9TBF4      ----------------------WYVSMMNWRQWLGLALPQDTVSGETILN----------
A0A3R2R3E8      YSLSDSALCDVPIWIETSGNRRIKLSYTLNNKNYSVKSDVNKPIKTKHFE---------I
A0A1J5SM24      ------------------------------LAMFKAPYEKDGALSHVPIT----------
A0A3B1C7A9      ------------------------------KSKYDLMEMLDKVKIEQKRG----------
A0A1J5SPZ5      ------------------------------------------------------------
A0A409NWS0      ----MVKVTTFELPKGAGDQV---FTLEVLGPKQYQLTSDAGFSARGEVG--QMLTKN--
A0A3R1PE73      ----MVKVTTFELPKGAGDQV---FTLEVLGPKQYQLTSDAGFSARGEVG--QMLTKN--
A0A3R3CX96      ----TVKVTTFTLPKGTAKDV---FTLTVLGPKQYELKSDAGFSARGEVG--QMLTKN--
A0A408NUV2      ----KMAVSRFEVTPELLGTP---LTLTVDDNTHFTLEVEGR-VLEGQVG--KLLEKE--
A0A3R5LMR4      ----KMAVSRFEVAPELVGTP---LTLTVDADKHFTLEIEGR-VLEGQVG--KLLEKD--
A0A3R5Q2V2      ----KMAVSRFEVAPELVGVP---LTLTLGEDKHFTLEVEGR-VLEGQVG--KLLEQD--
A0A404B052      ----KMAISRFEVAPELIGTP---FTLTLTGESRFTLEIEGR-VLEGQVG--KLLEKE--
A0A3R1PAA4      ----VLRISSMKVPAVMQGQE---LTLTVDDPQHYSLGHDGKTLFSGVVG--QTLQQG--
A0A3R2C7H5      ----VLLISGMTVPAAMQGQE---LTLTVQDKQRYSLSHDGKNLFSGTVG--QPLKQG--
A0A405AF34      ----VLLISGMTVPAAMQGQE---LTLTVQDKQRYSLSHDGKNLFSGTVG--QPLKQG--
A0A3R2D8P2      ----DVVVSKFDVPKINYDKE---YTLKIVDSKTYILSLDGEEILTGKVG--QLEHNS--
A0A3R2C102      ----QIAVSRVTISESMAEQP---LELTVIDKNNYSVEFDGVEIIKGKVG--VYATGN--
A0A3R2GYI6      ----EISINRLKVPEYVVEKP---LELKALGGKQYSLSYDGNEILKGTAG--VLAAGK--
A0A3R2EM25      ----RIALSRLTVPSNTDDTA---LELKVIDDKNYVLSKDGTEIIKAKVG--ELASGR--
A0A3R3FNT7      ----RIALSRLSVPSNADDTE---LELTVIDDKNYVLSKNGTEIIKGKVG--ELASAQ--
S0DG33          ----------------------I--LGDIAEKFATPGEPSAPWLGLKSFA----------
A0A3R2V5T0      ----------------------VELVKTSVRGILDLVLPGDPPVSEAAIR----------
A0A405JUY6      ----------------------VDLVKGMLRGVTSIFSADAPALTEEQIA----------
A0A445V3X4      ---------------------------------------LSEQSFFGSIR--ESITNTIT
A0A445VBS2      ---------------------------------------LSEQSFFGSIR--ESITNTIT
A0A407V607      ------------------------------------------------------------
T0ZG59          HGASARKPSQTDQLRA--------------------------------------------
A0A3R3TCJ4      ------------------------ALRPP-TGLKALIARMQGKSVAPLPP--PTTPNEIL
A0A3R4EU13      ------------------------ALRPP-TGLKALIARMQGKSVAPSPP--PTTPNEIL
A0A3B1AK25      ------------------------------DESEPLISIDWRAWIKELLP--DNTIPEEP
A0A3R4E576      RSLVTVT-----------------------------------GWLGSK-P--AEIPTSEE
A0A404I461      RSLVTVT-----------------------------------GWLGSK-P--AEIPTSEE
A0A408J920      RSLVNVS-----------------------------------QWFSPAKK--ESVIDDGT
A0A3R1N912      RSLVNVS-----------------------------------QWFSPA-K--EAVVDDGT
A0A405ZIS9      RSLVNVS-----------------------------------QWFSPAKK--ESVVDDGT
A0A380TGM5      AALGGKD-----------------------------------DTNPGSAD--RQALEARA
A0A3P5W345      AALGGKD-----------------------------------DTNPGSAD--RQALEARA
A0A380TDI0      KDTLGLNLFPARAPNET-------------------------DPTQLTVE--ELRDKENN
A0A380TDN3      KDTLGLDLLLAKAPDET-------------------------DPTQLTVE--ELRDKENN
A0A3P5WKD3      KDTLGLDLLLAKAPDET-------------------------DPTQLTVE--ELRDKENN
A0A3R2WIS1      SGTEAIDIAKFDVPSALEDQQPFTITAQA-DDHYTVSHPGLPEPLTGTAG--KMLSQQVP
A0A3R5EJ70      SGTEAIDIAKFDVPSALEDQQPFTITAQA-DDHYTVSHPGLPEPLTGTAG--KMLSQQVP
A0A3R3UIB9      ASF-SIG-----------------------------------EAIPVILP--EDLEEGVD
A0A409NVE8      GSIKNIA-----------------------------------KTITGTLP--EDL-NAVP
A0A0F9U8M8      --------EENNLFGLKALFSSFFGEGGT-D------------------D--ELDLEYKM
A0A381Y0U7      -------------------------------------NLTESLVLGKTLN--EREARKIL
A0A381Z3K5      -------------------------------------SLTESLVLGEVLN--DRAARKIL
A0A0F9UWR4      --------RQQDQPLIDIRG---IIKSLQ--------GMVLGEDPSDGAE--PMTEAQIM
A0A3R1X0V0      --------KEQEGTFALLKK---LLSALD-IRKLVPSGAALEPPTPEELE--VLR----F
A0A0F9LFA5      -----------------------------------------------FIA--KPSVLGEL
A0A1J5R1Y0      ------------------------FSPGR-D----LTWLAKAKIALGIAH--PPTVSDQP
A0A160TC29      -----------FNPYHEANGKSF----------------SLREFILGAKE--PPTADEVL
A0A3R2TSB1      --------VAQMDVPPALEGKKFLLTAGK-DGTYTLTHPDLDTPLHGRVG--EPQDSSVP
A0A3R3XUC2      --------VAQMDVPPALEGKKFLLTAGK-DGTYTLTHPDLDTPLHGRVG--EPQDSSVP
A0A407WVH8      --------VAQMDVPPALEGKKFLLTAGK-DGTYTLTHPDLDTPLHGRVG--EPQDSSVP
A0A408G2L4      WGGERLEFARLNLPKELLGK-KLTLIAGE-QKHFQLLDDNDNLLVEGVAG--EAFAQD--
A0A405APZ8      ---AEIALSRLSVPDRLINE-ELVLTVLD-DNHYLLESDGDKLF-EGQVG--KLASAD--
A0A3R1LUZ7      ---GRISVSNFNLISLNKNHPKIELEVID-NKSFVITNDAEEI--KGNVG--ELIDNG--
A0A3R2BGD8      ---PLLNVSGMKVPAVMQGQ-ELTLTAED-QQRYSLSHDGKKLF-SGSVG--QALQQG--
A0A3R2U6C3      WGGEAVAISQLDVPNEWLGKP-LRLTTLG-EGRYTLSDKLTGATFTGTVGKPEHFLLP-G
A0A3R3W6C3      WGGETIAISHLDVPNEWLGKP-FIVTTQG-EGRYTVTDKFTGATFSGAVGKPEQFRLP-G
A0A407XAA6      WGGETIAISHLDVPNEWLGKP-FIVTTQG-EGRYTVTDKFTGATFSGAVGKPEQFRLP-G
A0A3R5H8M2      NGATSVQIKHLNIPAFYLDKP-LQLNFNT--PN-TFQIHYNDAVVFEGKT--NIKNQVPS
A0A3R2H5L1      DGLKSFEIRTLEIPAYYLDKT-LHLNFDK--QSLRLTDPATEEVVLNVPL--NQLNQVAG
A0A3R1PLZ2      DDLKSFEVREFEVPAFYLDKN-LLLNFDK--QSLRLTDPTTEEVILTVPL--NQANHVTG
A0A406JUR4      DDLKSFEVREFEVPAFYLDKN-LLLNFDK--QSLRLTDPTTEEVILTVPL--NQANHVTG
A0A409MU65      DDLKSFEVREFEVPAFYLDKN-LLLNFDK--QSLRLTDPKTKKVALTIPL--NQANHVRG
A0A3R2CMW0      DDAKSFDVRKFEIPTYYLDKN-LLLNFNG--NKYTLTDAKTKQVVFSAAT--NQESQHTS
A0A407T0V1      DDEKAFDIRQFNVPSNFRDKN-LELRFND--KQFSLTDKETEQVILTAKI--NQANILRT
A0A0F9VQU4      WGDESINVARFTTLDSSRGRS-FIVERGA-GDSYHIMQGD-SRLGTGTLGQPEVFLDG--
A0A1W1DYN8      WGGERIQIEQFTLSRSLQEDG-ITLIAQD-NQTYKLIDTEGGVLLIGKVG--ELAQAN--
A0A1W1E4Z5      WGGERIQIEQFTLSRSLQEDG-ITLIAQD-NQTYKLIDTEGGVLLIGKVG--ELAQAN--
A0A3R1GLT3      WGGEKLDVFQLDVPRKLIDRP-LTLVAGD-NSSYELFDEQDNLLVRGEIG--KVAAGQ--
A0A3R3DWA3      WGGESLLIHRFDVPATLLDEP-LILVAGEISGSFELLGDGGETLLKGAIG--QPSEAN--
A0A2H9T6C5      WGGEAVKIERFETPDSQIGKT-YTLVTGE-NNRYELYDEDDEKILVGKVG--LSAVSR--
A0A3R2W4Z8      SGTEAVNIAKFDVPSTFEDQKPFTITALA-GDQYSLSHPDLAEPLTGTVG--KVLNREAP
A0A3R5D942      SGTEAIDIAKFNVPPTLEEQKPFTITALA-GDQYTLTHPDLAESLTGTVG--KVLSQQLP
A0A0F9KY21      WGGEFISVFRFVVPKALEGEE-FELLVKQ-NSQYELLNPNGDVVLNGTVG--KDEKDG--
A0A404TF61      WGGETLKIFQLELPQELLGQE-LTFVSGE-SGHFTLLDEDDNVLIEGQVG--QAYDKD--
A0A406MXU2      WGGETLKIFQLELPQELLGQE-LTFISGE-SGHFTLLDEDDNVLIEGQTG--QAYDQD--
A0A3R4Q9I0      WGGEKLDIFQLEVPDAYLGKG-LKLRSEG-NGTFTLLNDD-EVLLHGQTG--EKLEQN--
A0A407TZB0      WGGEKLDIFQLEVPDAYLGKG-LKLRSEG-NGTFTLLNDD-EVLLHGQTG--EKLEQN--
A0A0F9W5Q6      WGGEQLKIFQLEVPRAYEGEE-LVLRAEE-NNGYTLLNEDGETLVSGTVD--QPLDEQ--
A0A404IBN2      WGGETLKIFQLELPQELLGQE-LTFITGE-SGHFTLLDEDDNVLIEGQAG--QAYDQD--
A0A406Y387      WGGETLKIFQLELPQELLGQE-LTFITGE-SGHFTLLDEDDNVLIEGQAG--QAYDQD--
A0A3R1X9G0      WGGETLKIGTLQLPDSLLGTK-LALIVED-KGGYIILNEDGDKIAESKVG--ELYSNN--
A0A3R3ZKH7      WGGETLKIGTLQLPDSLLGTK-LVLIVED-KGGYIILNEDGDKIAESKVG--ELYSNN--
A0A3R2WMV4      WGGERLEIEKLTLPDELLGEK-LTLIAAE-QNRFQLYDEDGGLLADGTTG--ATVMEN--
A0A3R3BQL7      WGGERLEIEKLTLPDELLGEK-LTLIAAE-QNRFQLYDEDGGLLADGTTG--ATVMEN--
A0A3R4AM40      WGGERLEIEKLKLPDELLGEK-LTLIAAE-QNRFQLYDEDGGLLADGTTG--ATVMEN--
A0A3R2HMB7      WGGERLEIEKLTLPDELLGEK-LTLIAAE-QNRFQLYDEDGGLLADGTTG--ATVMEN--
A0A3R4QTV3      WGGERLEIEKLKLPDELLGEK-LTLIAGE-QNRFQLYDDDGALLADGTTG--TTVIEN--
A0A3R4YGM2      WGGERLEFARLNLPKELLGKK-LTLIAGE-QKHFQLLDDNDNLLVEGVAG--EAFAQD--
A0A3R1WG16      WGGERLEINRLNLPKALLGKK-LTLIAGE-QHRFRLFDENDNLLVEGVAG--EAFKQD--
A0A3R3R2K7      WGGERLEINRLNLPKALLGKK-LTLIAGE-QHRFRLFDENDNLLVEGVAG--EAFKQD--
A0A3R3TSL3      WGGERLEINRLNLPKALLGKK-LTLIAGE-QHRFRLFDENDNLLVEGVAG--EAFKQD--
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      RSLIPQKKEE--------------------------------------------------
J9FGR8          CTLQPVSAEQCQLTEWSVNG------------------DETDETYTVAFG--DSVATSFG
A0A0W8FS74      YKIEMTGADTFTVKD-----------------------EDGKLIGEGISG--RLMQAKGF
A0A3B0V744      IDVIVINQKTFQLNYTV---------------------REKEYSLNARFE--DSVKTELI
A0A405V7W6      FTILPYALRDSSLCDVPIWIETLEHHKIRLSYTL----NNKTYSKVSDIN--TKISTVHF
A0A1W1D4H7      FELIPIDSVSFRLEIKPLSKYSIKGILATLNIISLDEKDKISYNQIHHYN--ELIKTPYF
A0A3B1CUQ0      ---IPQKFIDEEIKVEFTDSKG--------NFTVTKEGESLGRGIVGTPF--KSDSGLYF
A0A1W1BK27      FTIKPIDKKHFLLSV-----------------------DAMEYNRTCSYN--KLVSNAYF
A0A1W1CD04      FKIVPYGNQRFLLII-----------------------KGINYKKVHSYS--EEIKTKFF
                                                                            

A0A3B1C250      ----------------------------ASWFPEKREATEEEKKRRLIAYFSSNLR----
A0A1J5RCY3      ----------------------------------------------RPETLANSVT----
A0A1J5RUE5      ----------------------------------------------TAKALGRSIS----
A0A0F9JKD8      EGGLAAMIKGLLPGG---------------GPEDEGADPEAAKRKLIVETILENIS----
A0A0F9XPI6      ----------------------------NLNLIGQEYEVVISPIKNTVLGLINKME----
A0A2H9TBF4      ---------------------------------------------RTIDAFAENVR----
A0A3R2R3E8      GFKVENWEVLKQ------------------DDEANELYFTFNNQKTLASRLIANLE----
A0A1J5SM24      ----------------------------------------------TILRLNRKVV----
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      --------------------------------------LPPGASPPSAAAAMPNVD----
A0A409NWS0      --GVTMMVSDIK------------------AAEGGKFTVSKFSMLGMINNLQGNLT----
A0A3R1PE73      --GVTMMVSDIK------------------AAEGGKFTVSKFSMLGMINNLQGNLT----
A0A3R3CX96      --GVTMMVSDIQ------------------AADGGEFTVSKFSMLGMINNLQNNLT----
A0A408NUV2      --DVTLLLSDVA------------------ADEGQVFTLVKQPALDVIAELQRDLQ----
A0A3R5LMR4      --DVTLLLSDVA------------------ADEGQVFTLVKQPVLDVIAELQRDLQ----
A0A3R5Q2V2      --DVTLLLSDVA------------------AQDGQVFTLLKQPVLDVIAELQSGLQ----
A0A404B052      --GVTLLVTDVA------------------AQDDQVFTLIKQPLLDVIGELQRDLQ----
A0A3R1PAA4      --GWSVNVSELE------------------AQPGTTFTVVNVPRQKAVDDLRNILD----
A0A3R2C7H5      --AWAMNVTALE------------------ALPGTEFSVVNVPRQQAVDDLRNLLD----
A0A405AF34      --AWAMNVTALE------------------ALPGTEFSVVNVPRQQAVDDLRNLLD----
A0A3R2D8P2      --GVEILITDTN------------------AVPGTNFSLVKRPVLAVIKDLLENLR----
A0A3R2C102      --GVSLLVSDVV------------------AKPGTVFEVSKLSKLAATLQLLDELN----
A0A3R2GYI6      --DIQIFVSDIK------------------AEPGTTFQVVKRLKLNVINDLLRNLT----
A0A3R2EM25      --GVTLLVSEIS------------------AQPGTVFEVAKLQRLVATNNLLDALT----
A0A3R3FNT7      --GVALLVSEIS------------------AEPGTVFEVAKLQRLVATNNLLDALT----
S0DG33          ----------------------------------------WGGERVQIGTLEVPIE----
A0A3R2V5T0      ----------------------------------------AGRREKAAAVLQQSLT----
A0A405JUY6      ----------------------------------------AGRREKAAAIIQQWLT----
A0A445V3X4      GDRRSRVGKNPI----------------------------------SEEIIQRNLT----
A0A445VBS2      GDRRSRVGKNPI----------------------------------SEEIIQRNLT----
A0A407V607      ----------------------------------------------DAQALAQRLK----
T0ZG59          ----------------------------------------------DADALLHMVS----
A0A3R3TCJ4      MGRER-----------------------------------------AASALQGGLA----
A0A3R4EU13      MGRER-----------------------------------------AASALQGGLA----
A0A3B1AK25      GIDEYEAFNAE-----------------------------------LIKDFSARLS----
A0A3R4E576      KRRA------------------------------------------AADAVLANMS----
A0A404I461      KRRA------------------------------------------AADAVLANMS----
A0A408J920      LKRS------------------------------------------LSDQLLNGLS----
A0A3R1N912      LKRA------------------------------------------LSDRLLQGLS----
A0A405ZIS9      LKRS------------------------------------------LSDQLLNGLS----
A0A380TGM5      ARAASLDE--------------------------------------VVDEFLKHLD----
A0A3P5W345      ARAASLDE--------------------------------------VVDEFLKHLD----
A0A380TDI0      K---------------------------------------------IIDAVLEDVQ----
A0A380TDN3      K---------------------------------------------IIDAVLEDVQ----
A0A3P5WKD3      K---------------------------------------------IIDAVLEDVQ----
A0A3R2WIS1      GGTITLMVSRID------------------GKPGAEFLVSRASSLATTESLQKRVQ----
A0A3R5EJ70      GGTITLMVSRID------------------GKPGAEFLVSRASSLATTESLQKRVQ----
A0A3R3UIB9      PTEAKIFDE-------------------------------------VTKTFMKRVS----
A0A409NVE8      DQEALILAE-------------------------------------VTEKFMRRIS----
A0A0F9U8M8      AH--------------------------------------------LINDFRQRLS----
A0A381Y0U7      EK--------------------------------------------SID-----------
A0A381Z3K5      EK--------------------------------------------SID-----------
A0A0F9UWR4      DN--------------------------------------------VTQQFMQRVS----
A0A3R1X0V0      DE--------------------------------------------VTRAFMTRIK----
A0A0F9LFA5      KA--------------------------------------------TVKEQLPFLNKKEV
A0A1J5R1Y0      GT--------------------------------------------VLGELRAHLT----
A0A160TC29      AK--------------------------------------------TIENFWQAIS----
A0A3R2TSB1      GG--------------------------------------------TVHLLVASIDARPG
A0A3R3XUC2      GG--------------------------------------------TVHLLVASIDARPG
A0A407WVH8      GG--------------------------------------------TVHLLVASIDARPG
A0A408G2L4      --GVEGQITQLL------------------ANPGTRFEVVRNPRIVTIQGYQDALD----
A0A405APZ8      --GVTLLVSGIK------------------AEEGTKFSVVKRSELRVLEDMGQNLT----
A0A3R1LUZ7      --NLSIKVNSID------------------ALPGSVFEITYLSKLDAINNIQNSFK----
A0A3R2BGD8      --GWAMNVTALE------------------ALPGTTFTIVNVPRQKAVDDLRNMLD----
A0A3R2U6C3      GGAMDVHVDALA------------------GRPGTEFTVSRSSRLAAIEGVQSRMG----
A0A3R3W6C3      GGVMDVHIDALT------------------GRPGTQFTISRSSRLAAIENVQSHMG----
A0A407XAA6      GGVMDVHIDALT------------------GRPGTQFTISRSSRLAAIENVQSHMG----
A0A3R5H8M2      QYGLWEVYVAKD------------------RTSTPELEVTKYSLPTAMKNLTLDYA----
A0A3R2H5L1      PYGSWKIAIFTK------------------DQFDTTYNIRNLSLPAAVNAISSNYS----
A0A3R1PLZ2      PHGLWKVAIFTK------------------DQLDATYNISNLSLPAAVDAISSNYS----
A0A406JUR4      PHGLWKVAIFTK------------------DQLDATYNISNLSLPAAVDAISSNYS----
A0A409MU65      PHGLWKVAIFTK------------------DQLDATYNITNLSLPAAVDAISSNYS----
A0A3R2CMW0      EYGTWNIALYTQ------------------DQFKNTYNIEKMSLPAAMGSITNNYS----
A0A407T0V1      TDGLWNISIYTQ------------------DQLNDIYLIQKQSLPAAVDSMLVNYS----
A0A0F9VQU4      --ELELTVESFN------------------AAEGAQYVLTRLQKTSAIRGIAGRLQ----
A0A1W1DYN8      --GVTIFISELV------------------ARIGTEFSLSKDNRAEIVDDLKKIIK----
A0A1W1E4Z5      --GVTIFISELV------------------ARIGTEFSLSKDNRAEIVDDLKKIIK----
A0A3R1GLT3      --GVTMQVAEIR------------------AHPGMRFEVTRHRHLAVVNDLQKKVS----
A0A3R3DWA3      --GIVLEVAALR------------------ANPGMRFEVTRLRRLDVIAGLQKDIK----
A0A2H9T6C5      DNQVRLFVSELI------------------ARPQTRFNVIRQPMVTAINHLSKRLS----
A0A3R2W4Z8      EGAITLVVSRLD------------------GKPGAEFLVSRASLLTTVEDLQRRLQ----
A0A3R5D942      AGTITLVVSRLD------------------GKPGAEFLVSRASLLATTEDLQKRLQ----
A0A0F9KY21      --FYELTVRELN------------------ARPDTIFTLVKNNRYRTVVKLQQEIS----
A0A404TF61      --GIKLQVEVLQ------------------ANPGTTFSIVRDPRLTSILKYQKVLD----
A0A406MXU2      --GIKLQVEVLQ------------------ANPGTTFSIVRDPRLTSILKYQKVLD----
A0A3R4Q9I0      --GFKLQVSTLN------------------ANAGALFNVTKQRRLNTILQYQDDVS----
A0A407TZB0      --GFKLQVSTLN------------------ANAGALFNVTKQRRLNTILQYQDDVS----
A0A0F9W5Q6      --GFRIQIETLS------------------AHPGTEFLVTKRNDLSTILDYQRRVG----
A0A404IBN2      --GIKLQVEVLQ------------------ANPGTTFSIVRDPRLTSILKYQKVLD----
A0A406Y387      --GIKLQVEVLQ------------------ANPGTTFSIVRDQRLTSILKYQKVLD----
A0A3R1X9G0      --DISVNVEQIR------------------AKPGTKFFIVCSPRLTSILDYQDALD----
A0A3R3ZKH7      --DISVNVEQIR------------------ANPGTKFFIVCSPRLTSILDYQDALD----
A0A3R2WMV4      --GVEVLVAHMD------------------ANPGAKFEVVRNPRIVTIQNYQDILE----
A0A3R3BQL7      --GVEVLVAHMD------------------ANPGAKFEVVRNPRIVTIQNYQDVLE----
A0A3R4AM40      --GVEVLVAHMD------------------ANPGAKFEVVRNPRIVTIQNYQDILE----
A0A3R2HMB7      --GVEVLVAHMD------------------ANPGAKFEVVRNPRIVTIQNYQDVLE----
A0A3R4QTV3      --GVEVLVAHMD------------------ANPGAKFEVVRNPRIVTIRNYQDILE----
A0A3R4YGM2      --GVEGQITQLL------------------ANPGTRFEVVRNPRIVTIQGYQDALD----
A0A3R1WG16      --EVEGQIAQLS------------------ANPGTRFEVVRNPRIVTIQSYQDALD----
A0A3R3R2K7      --EVEGQIAQLS------------------ANPGTRFEVVRNPRIVTIQSYQDALD----
A0A3R3TSL3      --EVEGQIAQLS------------------ANPGTRFEVVRNPRIVTIQSYQDALD----
A0A3B0VME9      ------------------------------ANKMNRKVQENITLDNNLGKIKNSLT----
A0A3B1DSR1      --------------------------------KLPSLLGEENPAGEILDTLVVKRT----
A0A0F9I1G8      ------------------------------TAKRPVIPKETLKQQGLIGFVNGNL-----
J9FGR8          TFILTKTPAFTE------------------QWVGRSIRFAKTNPQACADVYAESLV----
A0A0W8FS74      SLLLNDLK----------------------GEKGDSFRLKLLPLQNIAVSLKGGFK----
A0A3B0V744      NLKIELNESWA-------------------IEDGSRFYFRINSREVLINYVESNLS----
A0A405V7W6      DIGL-KVQNWEMLQH---------------DDEANELYFTFNNQKNLAARLISNLQ----
A0A1W1D4H7      TIMVDKLKHIDGLKYNFS------------FIKQDKLY------DFYKD--NLSVK----
A0A3B1CUQ0      -----DLKEVNPYKGASF------------KIKRSRFY------EAVEDLQKKVTV----
A0A1W1BK27      SIKVIKKS----------------------YLEDTNYYISQSNPQLLADHILENMK----
A0A1W1CD04      TLRVIKVDGENPYKTIAMNENPIESFIASLGLEEESYYFRSFDRDTQENMIIKNMS----
                                                                            

A0A3B1C250      -------------------------VVG----YKNSQIAIINYEAYNPQLAADIANAVAA
A0A1J5RCY3      -------------------------ASS----PPNSVLIDITVTDTVARRASDIANAIAG
A0A1J5RUE5      -------------------------ANN----PLNTVILQISTTDSQPQRAADISNAVAR
A0A0F9JKD8      -------------------------VNP----EVDTRLVTVSYLSGNPDLARLVVNTLAN
A0A0F9XPI6      -------------------------IQT---TTKDSDVLAISLSGNYPTKSELILNTLIK
A0A2H9TBF4      -------------------------IEP----VRKTQVARIHVMSEDPQLAATAANAMGE
A0A3R2R3E8      -------------------------VNP---VDANAKTIELRYNGNNPELCKDIIQSVAQ
A0A1J5SM24      -------------------------------PQRLSLVIDVQYDHPDPVVAAKVANLFVD
A0A3B1C7A9      -----------------------------------LDIVEISVESPVPYEAQMIANCYAQ
A0A1J5SPZ5      -------------------------VSA----VRNSLLIRITTTDRDPEAAKIIADKYVD
A0A409NWS0      -------------------------VTE---NGKDTGVLSMTFTGEDKDKIRDILNSITR
A0A3R1PE73      -------------------------VTE---NGKDTGVLSMTFTGEDKDKIRDILNSITR
A0A3R3CX96      -------------------------VTE---NGKDTGVLSLTFTGEDKDMIRNVLNSITR
A0A408NUV2      -------------------------VSE---KGKNTGIISLALEGEDKGRIRAVLDNISQ
A0A3R5LMR4      -------------------------VSE---KGKNTGIISLALEGEDKGRIRAVLDNISQ
A0A3R5Q2V2      -------------------------VSE---KGKNTGIILLALEGEDKGRIRSVLDNISQ
A0A404B052      -------------------------VSE---KGKNTGIISLALEGEDKGRIRAVLDNISQ
A0A3R1PAA4      -------------------------VAP---GGKESGIMTFSLAGEDPQRAEAVLKSITD
A0A3R2C7H5      -------------------------VAP---GGKESGIMTFNLAGEDPQRAEAVLKSITD
A0A405AF34      -------------------------VAP---GGKESGIMTFNLAGEDPQRAEAVLKSITD
A0A3R2D8P2      -------------------------VAD---KGKDTGVLALSLEGSNPKEIQAILDSISK
A0A3R2C102      -------------------------VED---KGKDTGVLSLSIMGDDPTQIKKIIDSISN
A0A3R2GYI6      -------------------------AED---KGKDTGVLALSLTGENQTRIREVLDSITK
A0A3R2EM25      -------------------------VED---KGKDTGVLALSLVGDDPVLVRKILDSISK
A0A3R3FNT7      -------------------------VED---KGKDTGVLALSLIGDDPILVRKILDSISK
S0DG33          -------------------------LEE----EK-LTLIALQDGAYE-------LRGPAD
A0A3R2V5T0      -------------------------VER---VGR-SSVIAISTRSTDRQLAAQIAKTYAQ
A0A405JUY6      -------------------------VER---VGR-SSVIAVSVRSPDKLLSAQITRTYAE
A0A445V3X4      -------------------------IQP---VRR-SRLVRIHYDGPNPREAALIVNAVAE
A0A445VBS2      -------------------------IQP---VRR-SRLVRIHYDGPNPREAALIVNAVAE
A0A407V607      -------------------------VGP---VGK-TDLIGVSYTGPDPEEARRVVQAVCE
T0ZG59          -------------------------VQP---VLN-SKLVDVSVDTPDPRLSAQIANVYAD
A0A3R3TCJ4      -------------------------VRR---SGL-TYIIVIAYTALNPEKAAQIANAYAE
A0A3R4EU13      -------------------------VRR---SGL-TYIIVIAYTALNPEKAAQIANAYAE
A0A3B1AK25      -------------------------VAP---VRK-SQLVKISFEANNRKLAAQVANTLAN
A0A3R4E576      -------------------------VMR---VDR-TYVLEVSYRSPSADMAARVANAIGD
A0A404I461      -------------------------VMR---VDR-TYVLEVSYRSPSADMAARVANAIGD
A0A408J920      -------------------------VKR---IGR-TYALELTYNSTSPVLAAQIVNAVAS
A0A3R1N912      -------------------------VKR---IGR-TYALELTYNSTSPALAAQIVNAVAA
A0A405ZIS9      -------------------------VKR---IGR-TYALELTYNSTSPVLAAQIVNAVAS
A0A380TGM5      -------------------------VRP---TKA-SRVISVRFQSRDAQLAADVANAVAD
A0A3P5W345      -------------------------VRP---TKA-SRVISVRFQSRDAQLAADVANAVAD
A0A380TDI0      -------------------------AKQ---IPR-SRAVVINFTSESPRTAARVLNTLSE
A0A380TDN3      -------------------------AKQ---IPR-SRAVVINFTSESPRTAARVLNTLSE
A0A3P5WKD3      -------------------------AKQ---IPR-SRAVVINFTSESPRTAARVLNTLSE
A0A3R2WIS1      -------------------------LSE---QGKQSNVINVTLEGSDRGRLRRTLNEIGA
A0A3R5EJ70      -------------------------LSE---QGKQSNVINVTLEGSDRGRLRRTLNEIGA
A0A3R3UIB9      -------------------------IAP---LGK-SQLVQLQVEMADPRMAAKAANAMAN
A0A409NVE8      -------------------------VEP---IAK-SQLVKVQVDMADPDLAARAANTIAR
A0A0F9U8M8      -------------------------VKP---IQG-TQLVHITYQASDRKLAAKIANAIGE
A0A381Y0U7      -------------------------VRQ---YRN-TSIIELRAYDRKPTKAQEIAQALAS
A0A381Z3K5      -------------------------VRQ---YRN-TSIIELRAYDRKQKKAQEIANALAE
A0A0F9UWR4      -------------------------VSV---EGK-SQLVRISVEMADRLTAAQAANSVAN
A0A3R1X0V0      -------------------------VIR---QGN-STLVKVQVEMSDPHMAAKAANALAK
A0A0F9LFA5      TVYAPEEQAEREMLGLLAVFKSRLSVSP---IRK-TQLVQVSFESSDPKLAALVANTVGE
A0A1J5R1Y0      -------------------------IAP---VPR-SNLIQVSYDSPDPRMAALIANTFAE
A0A160TC29      -------------------------IEP---VRK-TQLVKISVESQSPELAYTAANAVAE
A0A3R2TSB1      GAFELTRHSTQ--LTMLELQRELRVIEK---GKQ-SSVIDVSWQTDDREHLANLLNEVAR
A0A3R3XUC2      GAFELTRHSTQ--LTMLELQRELRVIEK---GKQ-SSVIDVSWQTDDREHLANLLNEVAR
A0A407WVH8      GAFELTRHSTQ--LTMLELQRELRVIEK---GKQ-SSVIDVSWQTDDREHLANLLNEVAR
A0A408G2L4      -------------------------ISE---QGKESGIIKLALASSDAAEAVKILNKIAA
A0A405APZ8      -------------------------VAD---KGKDTGVLGLNYTGEDPVLIKKILSSISH
A0A3R1LUZ7      -------------------------VED---QGRDTGMLSLTLTGEDPILIKRILDSISK
A0A3R2BGD8      -------------------------VAP---GGKESGIMTFSLAGEDPQRAEAVLKSITD
A0A3R2U6C3      -------------------------IFE---RGRASGVIGVTLEGNDPALTTAVLNQIGQ
A0A3R3W6C3      -------------------------IFE---RGRASGVIGVTLEGNDPALTTAVLNQIGQ
A0A407XAA6      -------------------------IFE---RGRASGVIGVTLEGNDPALTTAVLNQIGQ
A0A3R5H8M2      -------------------------VAE---RGKMTGVIGLNYQGTDKEHITKVLNHILS
A0A3R2H5L1      -------------------------VAE---QGKLTGVLGLNYQGQDKEHITKVLNAILA
A0A3R1PLZ2      -------------------------VGE---RGKLTGVLGLNYQGQDKEHITNVLNAILA
A0A406JUR4      -------------------------VGE---RGKLTGVLGLNYQGQDKEHITNVLNAILA
A0A409MU65      -------------------------VAE---RGKLTGVLGLNYQGQDKEHITKVLNAILA
A0A3R2CMW0      -------------------------VAE---KGKMTGILGLNYQGQDKEHITNVLNSILV
A0A407T0V1      -------------------------VAE---KGKLTGILGLNYQGTDKTHITQVLNAILV
A0A0F9VQU4      -------------------------VAEVGGAGTTTGMIRLMMFGEDPSEITRSLDAVAQ
A0A1W1DYN8      -------------------------VTE---RGKKTGILNISLEGKDRVLISRIIENIAN
A0A1W1E4Z5      -------------------------VTE---KGKKTGILNISLEGKDRVLISRIIENIAN
A0A3R1GLT3      -------------------------VSE---SGKDSGILTLAFENADPELAQNFLQQVAQ
A0A3R3DWA3      -------------------------ASE---QGKESGILRVSYEDTDALRAEMLVQKVVE
A0A2H9T6C5      -------------------------VSE---KGKKTGVLSLSLSGPSSVHNSHILEAIIQ
A0A3R2W4Z8      -------------------------LGE---QGKQSNVISVSLEDSDRDRLRSTLNEIGA
A0A3R5D942      -------------------------LAE---QGKQSNVISASLEDSDRDRLQRTLNEIGA
A0A0F9KY21      -------------------------ASE---KGKDSGIITLAYEHKNASHAEKVLDKVSD
A0A404TF61      -------------------------VSE---RGKESGMIGLALESEKPAEAIQILNEIAK
A0A406MXU2      -------------------------VSE---RGKESGMIGLALESEKPAEAIQILNEIAK
A0A3R4Q9I0      -------------------------ASE---RGKESGIIALSLENEDPAKANKVLDEINR
A0A407TZB0      -------------------------ASE---RGKESGIIALSLENEDPAKANKVLDEINR
A0A0F9W5Q6      -------------------------ASE---KGKDSGIISMSLASPHPAKATATLDEISR
A0A404IBN2      -------------------------VSE---RGKESGMIGLALESEKPAEAIQILNEIAK
A0A406Y387      -------------------------VSE---RGKESGMIGLALESEKPAEAIQILNEIAK
A0A3R1X9G0      -------------------------ISE---RGKESGIIGLSLESEDPNLAIKTLNEIAD
A0A3R3ZKH7      -------------------------ISE---RGKESGIIGLSLESEDPNLAIKTLNEIAD
A0A3R2WMV4      -------------------------VSE---QGKESGIISLALASTDYALAVKILNKISS
A0A3R3BQL7      -------------------------VSE---QGKESGIISLALASTDYALAVKILNKIAS
A0A3R4AM40      -------------------------VSE---QGKESGIISLALASTDYALAVKILNKIAS
A0A3R2HMB7      -------------------------VSE---QGKESGIISLALASTDYALAVKILNKIAS
A0A3R4QTV3      -------------------------VSE---QGKESGIISLALASTDYALAVKILNKIAS
A0A3R4YGM2      -------------------------ISE---QGKESGIIKLALASSDAAEAVKILNKIAA
A0A3R1WG16      -------------------------ISE---QGKESGIIRLALASTDAAEAVKILNKIAS
A0A3R3R2K7      -------------------------ISE---QGKESGIIRLALASTDAAEAVKILNKIAS
A0A3R3TSL3      -------------------------ISE---QGKESGIIRLALASTDAAEAVKILNKIAS
A0A3B0VME9      -------------------------ITP---VRGT-QLIKISFQSPHSGLAADIVNNLMK
A0A3B1DSR1      -------------------------AGR---DRSFSNVLDLSYRNRYKEDAKTILSAIIE
A0A0F9I1G8      -------------------------TPI---LQRNSNLISISFTSPDRHLSQDVVNTLIE
J9FGR8          -------------------------AAL---SNKEASVITLTINNPSIAKAEDFLNTLIE
A0A0W8FS74      -------------------------ATE---VGNRTNIVRISYSSTDPVRARDLVNTLVQ
A0A3B0V744      -------------------------VEP---LNFQANTFQISFTDHNLNKAHALVSAIDT
A0A405V7W6      -------------------------VNA---IDANAKTIELRYNGNNFEMCRDIIQSVAI
A0A1W1D4H7      -------------------------NML---KSSS--VLELTYQDTVSLRAKEILDAIST
A0A3B1CUQ0      -------------------------SPV---RNTN--IVYIKVQDSDPRMAAAIANSIVK
A0A1W1BK27      -------------------------TTI---LSDN--VLQITYTDTVAKRAKEIVQEIAN
A0A1W1CD04      -------------------------VSD---LSEN--ILKIEYSDNIPQQTKEIAEEIAR
                                                                            

A0A3B1C250      AYIETGMESRLMMAKQATSWLTEKLSLLRTKLEESEKTLQRYQAREGV-VDTKSQKSIIN
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A0F9JKD8      AYIEALFELRMDSSQRALQWMSRKVEEERNKLDDSESGLQAYMKANDI-VTLEDRIAIVP
A0A0F9XPI6      KFNQDGINDRQQVSKRTLDFIDERFVYLSTELDSIEGGKQAFKTRNNL-SYIEADAGVSL
A0A2H9TBF4      AYIESWLEAKLSLTTNATRWMQDRLQDLSEKLKTAESQLHKFRVSEDL-VDIEGVLTIST
A0A3R2R3E8      TFFNYDEEAKRKSADNILNFIQIQLDSISGELKDSKDSLTDFQRKSHL-SDPENEGGNLS
A0A1J5SM24      EYIAYNARMRIDESMKAVEDLKVRAEQQRSKVNELALALQAYREKNNL-VSLDQRKDIVT
A0A3B1C7A9      SYEKLNLKYTRQQLSKVVAFLQKQRTKKYQELLVVEEKMKKFQVEGRI-IALDDQAKALI
A0A1J5SPZ5      QFMQYLLENVGGKNEYAVDWLTSRAEQLRRESEAAALKLQNFMQAQGM-VSLDDSTNLIT
A0A409NWS0      NYLEQNVERKSAEAAKSLAFLAKQLPEVRAHLDEAENKLNAYRQDKDS-VDLPLEAKSVL
A0A3R1PE73      NYLEQNVERKSAEAAKSLAFLAKQLPEVRAHLDEAENKLNAYRQDKDS-VDLPLEAKSVL
A0A3R3CX96      NYLEQNVERKSEEAAKSLAFLAKQLPEVRTRLDDAENKLNAYRQQKDS-VDLPLEAKSVL
A0A408NUV2      NYLQQNVVRKTEEAQKSLDFLQVHLPQVKDELNRSEELLNVYRQQNES-VDLSLEAKAAL
A0A3R5LMR4      NYLQQNVVRKTEEAQKSLDFLQTHLPQVKGELNRSEELLNVYRQQNES-VDLSLEAKAAL
A0A3R5Q2V2      NYLQQNVVRKTEEAQKSLDFLQVHLPQVKDELNRSEELLNVYRQQNES-VDLSLEAKAAL
A0A404B052      NYLQQNVVRKTEEAQKSLDFLQTHLPQVKDDLNRSEELLNAYRQQNES-VDLSLEAKAAL
A0A3R1PAA4      NYLQQNVDRKTEEAQRMLAFLHEQLPRTQTSLNNAENQLNQFRQQNDS-VDLSLEAKSVL
A0A3R2C7H5      NYLQQNVDRKTEEAQRMLAFLHEQLPRTQTSLNNAENQLNQFRQQNDS-VDLTLEAKSVL
A0A405AF34      NYLQQNVDRKTEEAQRMLAFLHEQLPRTQTSLNNAENQLNQFRQQNDS-VDLTLEAKSVL
A0A3R2D8P2      NYLLQNVERKSAEAEKSLVFLKEQLPEVQAKLDSSENELNHFRQQNES-VDLSLEAKSAL
A0A3R2C102      NYLVQNVERKSEEAAKSLAFLKDQLPLVRDSLNTAEDKLNSFRQANDS-VDLSLEAKSVL
A0A3R2GYI6      NYLLQNVERKSEEAGKSLTFLKEQIPDVRAKLDASEDLLNKYRQKNDS-VDLSLETKAVL
A0A3R2EM25      NYLLQNVERKSEEAAKSLDFLKEQLPEVRSSLDSAEDKLNRFRQANDS-VDLSLEAKSVL
A0A3R3FNT7      NYLLQNVERKSEEAAKSLDFLKEQLPEVRSSLDSAEEKLNRFRQANDS-VDLSLEAKSVL
S0DG33          QLLVKGVVGTTAQDNGVSILVKELDARPGTKFEVIRWNALDAVKRFGD-LVKVGDKVKD-
A0A3R2V5T0      AYLTEQLNANFDASERASVWLQERMTDLNQRAQAAELAVQKYRSDNNI-VSSRGELMSE-
A0A405JUY6      SYLTEQLNANFDATERASIWLQERLNDLNTRSQQASLAVEQFKRDKGL-ISPRGELLSA-
A0A445V3X4      NYIDTTLERRFGASSYAKAFLDERIQQVRRDLEDSERRLVAYAREREI-VSPDNKMATLA
A0A445VBS2      NYIDTTLERRFGASSYAKAFLDERIQQVRRDLEDSERRLVAYAREREI-VSPDNKMATLA
A0A407V607      AYLQQGDRHRREGVADGLKLVDDQLETARKRLVKAENNLLAFKRQSGS-VALNEEISASV
T0ZG59          QFIRSNLDRRMAASGYAKQYLQDRLQQLKLRLEDSDKELVAFAQKHQI-VNISDRQSLVG
A0A3R3TCJ4      QYVQNQIQAKYAANNQANTFLDSRLNQLRSEVLAAEAAVEQYRSANNL-LTTSGATLTE-
A0A3R4EU13      QYVQNQIQAKYAANNQANTFLDSRLNQLRSEVLAAEAAVEQYRSANNL-LTTSGATLTE-
A0A3B1AK25      TYIESDMEARLEMTSTASNWLTERLVTLKSNLQQSENELQAYREKEEL-LEAGGVSTLST
A0A3R4E576      SYLVDKLNSKYDATRRASDWLQDRIAELRQKALDSDLAVQKFRGEHGL-VAAG-SVLMSD
A0A404I461      SYLVDKLNSKYDATRRASDWLQDRIAELRQKALDSDLAVQKFRGEHGL-VAAG-SVLMSD
A0A408J920      AYLLDKLNSKYEATRRASDWLSDRIAELRQRALDTDLAVQKFRAEHNL-ISTGNNSLLSD
A0A3R1N912      AYLVDKLNSKYEATKRASDWLSDRIAELRQRALDTDLAVQKFRAEHNL-IETGNNGLLSD
A0A405ZIS9      AYLLDKLNSKYEATRRASDWLSDRIAELRQRALDTDLAVQKFRAEHNL-ISTGNNSLLSD
A0A380TGM5      TYTNRFIETKIAIAEKATGWLKGQVKALREAVARSEKAVEAFRTQSGL-LR-GSQVTLIS
A0A3P5W345      TYTNRFIETKIAIAEKATGWLKGQVKALREAVARSEKAVEAFRTQSGL-LR-GSQVTLIS
A0A380TDI0      LYLVARLEDKFDNAQRASSWLAGRIQVLREKVEASEREIEAYRKRHGL-FE-GRATSLVT
A0A380TDN3      LYLVARLEDKFDNAQRASSWLAGRIQVLREKVEASEREIEAYRKRHGL-FE-GRATSLVT
A0A3P5WKD3      LYLVARLEDKFDNAQRASSWLAGRIQVLREKVEASEREIEAYRKRHGL-FE-GRATSLVT
A0A3R2WIS1      QYVRQNVERKAAEAEKTIEFLDQQLPEFKRQLEDSEDVYARFRNKNGT-VAFDEEAKAVL
A0A3R5EJ70      QYVRQNVERKAAEAEKTIEFLDQQLPEFKRQLEDSEDVYARFRNKNGT-VAFDEEAKAVL
A0A3R3UIB9      GFIEGQLDATMEMSMTATNWMNTRMLELRTKLKEAEDKLQAFREKENL-VDIGGVSTINA
A0A409NVE8      GFIEAQLETAMEMSVTATTWMNSRIVELRTKLKESEDRLQTFREKENL-VDIDGVASISA
A0A0F9U8M8      VYIETHLEAKLGVTRRASAWMSEKMAGLTKQLERSETAFESFRQKNNI-VDIDSAVLRID
A0A381Y0U7      EYQDHRSSLHKVAVQKGIDSLKSRMGEMNTEISDMQSNVDKFRTDLGI-SDAAGEESYSI
A0A381Z3K5      EYQSHRTDLHKERVTKGINALNKRMEEINEDITGMQSKVDRLRTDLGI-SDAAGDESYSL
A0A0F9UWR4      SYIEGQLEAQMEMSMAATTWMNSRLSELRTSLKEAENRLQAYREQEGL-VDVDGVGTVSA
A0A3R1X0V0      ELIESQMEAAVEVSAGASAWMNGRLVSLREQLKVSEERLQRYREAENL-VDVGGVSTISA
A0A0F9LFA5      VYIESQMRAKMGITQQASSWLNTRLSQLRIQLDNSEVRLQEYRELQKL-VDIEGIAGLVT
A0A1J5R1Y0      QYIRNDMENKFRMTQEANSWLNEHLAGLKAKLEASEQRLQTYRNQQNI-IDVNGSALSGT
A0A160TC29      GYIESQMEARVGLTQQAAVWLSDRLGGLKDKLSESERKLQTYREQNDL-VDIEGVNTLVA
A0A3R2TSB1      LYMRQNIDQKTAQAERTLNFLGTELPKFKQQLEQSEEAYNQYRNQNGT-ISLDDEARNAL
A0A3R3XUC2      LYMRQNIDQKTAQAERTLNFLGTELPKFKQQLEQSEEAYNQYRNQNGT-ISLDDEARNAL
A0A407WVH8      LYMRQNIDQKTAQAERTLNFLGTELPKFKQQLEQSEEAYNQYRNQNGT-ISLDDEARNAL
A0A408G2L4      LYVDQNVRRTSAEAAQSLAFLQSQLPQVKRDLAKASDALNAYQTHGKT-VNISLETQSVL
A0A405APZ8      NYLQQNVERKSEEAAKSLKFLEQQLPLVRFQLDEAENKLNAYREEKDS-VDLSLEAKSLL
A0A3R1LUZ7      NYLEQNIDRQAAQDAKSLEFLGKQLPKVRNDLDKAENILNAYRQKKDS-VDLSLEAKSVL
A0A3R2BGD8      NYLQQNVDRKTEEAQRMLAFLHEQLPRTQSSLNNAENQLNQFRQQNDS-VDLSLEAKSVL
A0A3R2U6C3      EYVQQNVNRKSAQAEKSLAFLEQQLPQLKGELDAAETKYNALRNKRGT-IDLSEEAKLIL
A0A3R3W6C3      EYVQQNVNRKAAQAEKSLGFLEQQLPLLKSELDAAETKYNALRNKRGT-IDLSEEAKLIL
A0A407XAA6      EYVQQNVNRKAAQAEKSLGFLEQQLPLLKSELDAAETKYNALRNKRGT-IDLSEEAKLIL
A0A3R5H8M2      VYHKQNIERKSLESTQTLAFLDKQLPVLKQQLEDSEIQFNKFREKYNT-VDVTQESELLL
A0A3R2H5L1      TYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNT-VDVTKESELYL
A0A3R1PLZ2      TYSAQNIERRSAESAQTLKFLDEQLPELKKQLDDAERQFNKFRQQYNT-VDVTKESELYL
A0A406JUR4      TYSAQNIERRSAESAQTLKFLDEQLPELKKQLDDAERQFNKFRQQYNT-VDVTKESELYL
A0A409MU65      TYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNT-VDVTKESELYL
A0A3R2CMW0      AYSQQNIERRSAETAQTLKFLDEQLPELKQQLDIAEREFNKFRQQYNT-VDVTKESELYL
A0A407T0V1      SYSQQNIERRSAETAQTLKFLDEQLPELKQQLDVAEREFNKFRQQYNT-VDVTKESELFL
A0A0F9VQU4      TFLTQNIERQSEQAQQSLEFLQRQAPELREQLDLAEQNLNDYRANLDS-VDLSSEAQAAI
A0A1W1DYN8      LYLRQNIERTSVEAERSLVFLQKQTPLIKDEMEAAEVELNNYKGYKNS-VNLTLETQSLL
A0A1W1E4Z5      LYLRQNIERTSVEAERSLVFLQKQTPLIKDEMEAAEVELNNYKGYKNS-VNLTLETQSLL
A0A3R1GLT3      AYVRQNVERNSAEASAQLTFVKEQLPNVRSQVDAAQKSLSSYQMRANS-VDLTLQTKGLL
A0A3R3DWA3      AYVRQNVDRSSAEAASQLQFVKDQLPTVRKQVESAQAAMATYQSRANS-VDITLQTKGLL
A0A2H9T6C5      RYVRQNVERVSAEAQNSLKFLEHQLPDMKKDVELAESKLHRFQQENQT-VDLTMETQAVL
A0A3R2W4Z8      QYVRQNVERKAAEAEKTIEFLDRQLPEFKQQLEDSEDAYARFRNQNGT-VAFDEEAKAAL
A0A3R5D942      QYVRQNVERKAAEAEKTIEFLDRQLPEFKRQLESSEDAYARFRNQNGT-VAFDEEAKAAL
A0A0F9KY21      IYVRRNVERNSAEAKKSLDFLEVQLPEVKKQLEGSEQRFNDYQKQRKS-VNITLETQAIL
A0A404TF61      LYVRQNVERTSAEAAQSLEFLKDQLPQVRQDLEKAENALNKYQIRSKS-IDISLEAKAIL
A0A406MXU2      LYVRQNVERTSAEAAQSLEFLKDQLPQVRKDLEKAENALNKYQIRSKS-IDISLEAKAIL
A0A3R4Q9I0      LYVLQNVQRNSAEAAQSLEFLRTQLPDVRKQLEKAEGQLNAYQSSARS-VDITIETKAVL
A0A407TZB0      LYVLQNVQRNSAEAAQSLEFLRTQLPDVRKQLEKAEGQLNAYQSSARS-VDITIETKAVL
A0A0F9W5Q6      LYVRQNVERKSAEAQQSLDFLKEQLPEVRRQLEAAENALNEYQASAGS-VDITLETQAVL
A0A404IBN2      LYVRQNVERTSAEAAQSLEFLKDQLPQVRQDLEKAENALNKYQIRSKS-IDISLEAKAIL
A0A406Y387      LYVRQNVERTSAEAAQSLEFLKDQLPQVRQDLEKAENALNKYQIRSKS-IDISLEAKAIL
A0A3R1X9G0      IYVRQNIERTSAEAAKSLGFLNEQLPKVRRDLEKAEDALNSYQTRSKS-VDITLETKAIL
A0A3R3ZKH7      IYVRQNIERTSAEAAKSLGFLNEQLPKVRRDLEKAEDALNSYQTRSKS-VDITLETKAIL
A0A3R2WMV4      LYVEQNVQRTSAEAAQSLDFLQAQLPQVKEDLAKASNALNSYQTHGNT-VNISLETKSVL
A0A3R3BQL7      LYVEQNVQRTSAEAAQSLDFLQAQLPQVKEDLAKASNALNSYQTRGNT-VNISLETKSVL
A0A3R4AM40      LYVEQNVQRTSAEAAQSLDFLQAQLPQVKEDLAKASNALNSYQTRGNT-VNISLETKSVL
A0A3R2HMB7      LYVEQNVQRTSAEAAQSLDFLQAQLPQVKEDLAKASNALNSYQTRGNT-VNISLETKSVL
A0A3R4QTV3      LYVEQNVQRTSAEAAQSLDFLQAQLPQVKEDLAKASNALNSYQTHGNT-VNISLETKSVL
A0A3R4YGM2      LYVDQNVRRTSAEAAQSLAFLQSQLPQVKRDLAKASDALNAYQTHGKT-VNISLETQSVL
A0A3R1WG16      LYVQQNVQRTSAEAAQSLEFLQGQLPQVKRDLAKASDALNGYQTRGKT-VNISLETQSVL
A0A3R3R2K7      LYVQQNVQRTSAEAAQSLAFLQGQLPQVKRDLAKASDALNGYQTRGKT-VNISLETQSVL
A0A3R3TSL3      LYVQQNVQRTSAEAAQSLQFLQGQLPQVKRDLAKASDALNGYQTRGKT-VNISLETQSVL
A0A3B0VME9      EFIQVNAEQKLAAFHSSGVFLDKQVNASKIKLEKSEQELNGYARRTGI-ISLNSKLNLVM
A0A3B1DSR1      AYQEYLTRNQNKNQKKSLELITQANDELEVKLNKKKEEYQKFRDNAPLYWNAAPGVKGVG
A0A0F9I1G8      EFVRWKMDQKLEASQLAREFLTKQIYQSKINLEKVEEELNRFARMSGI-VSLDTKLNSVY
J9FGR8          VYNEKWVQDRNQIAISTSKFISDRLGVIERELGHVDENISNYKSEHLM-PDVQAASNLYM
A0A0W8FS74      VYLGQNIELKTEEASRTVSFIENQLKGLRGELEGAEQDLETYKSSSGM-FKLDSEAQEVV
A0A3B0V744      LYYNYSLQEKTKANRNKIDYLDKQLEETEKKLDNFETYFEDFTIDNKT-VDLNEDVRRTV
A0A405V7W6      TFFNYDEEVKRKGADNILKFIQLQLDSLSGELKESKDSLTDFQRKTNL-TDPENNGRKLS
A0A1W1D4H7      TYIATTVKQKTEANGLTLNFIDTQLKVISANLKNSEKNLENYKIHHSV-VDLKTKLEVKT
A0A3B1CUQ0      RYIQHDISKRSKEATYMIKFVKKQIEPTQKKLENALESLAAHKRNSRV-VYLKEGTKKLI
A0A1W1BK27      QFREFTLVKKTSELKKRLIFINGQIGIIENQLQGEGKNLKEYQKKHKTFFTIETNNKMIL
A0A1W1CD04      SFIEYNLENKTAELEQTLEFLDKQLIEVKSDLKNKGEKLKKHQEKSGS--AVMSSGEALL
                                                                            

A0A3B1C250      --RKLV--------S-ITEELIKAQTRRAEAEIRYMEIKNVKNERGYESIRAVLRHPLIQ
A0A1J5RCY3      --------------S-LGTQVSELETPSSGAA----------------------------
A0A1J5RUE5      --------------Q-LAVTVQNLSPRTVAGQ----------------------------
A0A0F9JKD8      --QKLL--------E-LSTQLTRSETRRKELETLRNKIRSLKAAGKDLDSLPAIASDKTV
A0A0F9XPI6      --ERKS--------E-TENDVIKLETQISLSALLKNSVVGQAAFELLPVDVGLENSGLNS
A0A2H9TBF4      --DELK--------A-LTESLVETRRKLTLSENIYRQIQDGKNLQADQYQSLPAVLAHPL
A0A3R2R3E8      --QDID--------K-YQDLLFELDNELATLRTVNSKLRSEPNRLDIYRLIPEMLGKSFE
A0A1J5SM24      --EKLK--------A-LNLLLTQSASTLADAQVKWQQVQDCRRQGRSLIDLPFILNSSND
A0A3B1C7A9      --DILS--------T-FEAQRDATSLELSQAEENIKQYKEEMNKQNSSISKYIENYATEP
A0A1J5SPZ5      --ARLQ--------A-VSNALTQNQLQLLQLQAQYSQIQQYIQSGQNLLEIQAIATHGEI
A0A409NWS0      --DSMV--------N-IDAQLNELTFKEA-------------------------------
A0A3R1PE73      --DSMV--------N-IDAQLNELTFKEA-------------------------------
A0A3R3CX96      --DSMV--------N-IDAQLNELTFKEA-------------------------------
A0A408NUV2      --DTMV--------G-LEKQLNELTFREA-------------------------------
A0A3R5LMR4      --DTMV--------G-LEKQLNELTFREA-------------------------------
A0A3R5Q2V2      --DTMV--------G-LEKQLNELTFREA-------------------------------
A0A404B052      --DTMV--------G-LEKQLNELTFREA-------------------------------
A0A3R1PAA4      --DTQV--------Q-LEGQLNELTFKEA-------------------------------
A0A3R2C7H5      --DTQV--------Q-LEAQLNELTFKEA-------------------------------
A0A405AF34      --DTQV--------Q-LEAQLNELTFKEA-------------------------------
A0A3R2D8P2      --ETMV--------A-LDSQLNELTFREA-------------------------------
A0A3R2C102      --DTIV--------G-VEAQLNELTFKEA-------------------------------
A0A3R2GYI6      --DSIV--------S-VETQLNESTFKEA-------------------------------
A0A3R2EM25      --DTIV--------G-VEAQLNELTFKEA-------------------------------
A0A3R3FNT7      --DTIV--------G-VEAQLNELTFKEA-------------------------------
S0DG33          --SGLL--------Q-VEYADANPDKATAVANALGEQYLASAIASRQLNDTNTLAFINGE
A0A3R2V5T0      --SQLA--------D-LNGQLISAQADAATASARYSQYKSIIDRGPETAVDNAVVSARDT
A0A405JUY6      --QQLS--------D-LNSQLIVAQADAATAAARYNQYKAIIEKGPEAAVHNAVVSNRDT
A0A445V3X4      --ERLK--------E-ASGQFRAAETRRIEVEAKYNAMRA------GSSSAHEEILNSPI
A0A445VBS2      --ERLK--------E-ASGQFRAAETRRIEVQAKYDAMRA------GSSSAHEEILNNPI
A0A407V607      --GEMS--------A-LNTQLRERQIELARVSARAANLRAQLGMSSAEAMQAAAIGENPR
T0ZG59          --QQLE--------Q-LNVALAQAEQDRYKAEAKWRQLQG------APADQIAQVLGDPV
A0A3R3TCJ4      --QEIS--------S-YNQQLATTQAEQAAEEARLRAARSQLARG-SSGDDVGEALQSSV
A0A3R4EU13      --QEIS--------S-YNQQLATTQAEQAAEEARLRAARSQLARG-SSGDDVGEALQSSV
A0A3B1AK25      --RQLQ--------D-LNEKLVLATQQRATAEISLKQIKSLAGESPDKLGAIPAVLNDDL
A0A3R4E576      --QQLS--------E-LNSALIVAQSDTSKAQARLERIESIIASG-QSDAMVTDLLDNPV
A0A404I461      --QQLS--------E-LNSALIVAQSDTSKAQARLERIESIIASG-QSDAMVTDLLDNPV
A0A408J920      --QQLA--------E-SNSALILAQSETAKARARVQRIEHILATD-DVDGVVTDILDSSV
A0A3R1N912      --QQLA--------E-LNSAQILAQSETARARARVQRIEHILATD-DVDAVVTDILDSSV
A0A405ZIS9      --QQLA--------E-SNSALILAQSETAKARARVQRIEHILATD-DVDGVVTDILDSSV
A0A380TGM5      --EEIS--------E-INRRLAAASADRAQATATLNEVQALQKA--SNIEAAQAIMESPV
A0A3P5W345      --EEIS--------E-INRRLAAASADRAQATATLNEVQALQKA--SNIEAAQAIMESPV
A0A380TDI0      --EHVS--------D-LSSKLTDATIERRAAEARLAQVRNLKNA--ENVDTAVQVLDSAL
A0A380TDN3      --EHVS--------D-LSSKLTDATIERRAAEARLAQVRNLKNA--ENVDTAVQVLDSAL
A0A3P5WKD3      --EHVS--------D-LSSKLTDATIERRAAEARLAQVRNLRSA--DSVDTAVQVLDSKL
A0A3R2WIS1      --GMSV--------Q-LQTKLLDTQQQRR-------------------------------
A0A3R5EJ70      --GMSV--------Q-LQTKLLDTQQQRR-------------------------------
A0A3R3UIB9      --AELS--------A-TSDRMIDARRQRAEAQSQYRQVESMRRGGWAKLATIPAVLGHPL
A0A409NVE8      --AELA--------A-TSDRMIDARRQRAEAQSQYRQVQSMRSGGWQKLATIPAVLGHPL
A0A0F9U8M8      --SELE--------K-TQATLAIAESDKSKVDSILELINRFGKSDFENLKSLPEIISHSS
A0A381Y0U7      IEPEIV--------RRYEVELIAAKGVHTTQSSLLDGLKA--QSAEELRASILTAHPDAQ
A0A381Z3K5      IEPEIV--------RRYQAELITAKGVYTTQATLLAGLKD--QSVDELRASIMTAHPDAQ
A0A0F9UWR4      --NELA--------L-TGDRMVDARSQRAEAESQYRQVQAMSEQGWERMASVPAVLGHPL
A0A3R1X0V0      --TELA--------R-TGDRLIDARLKYAEAESQYRQVQA-NRGNWEKLAAVPAVLGHPL
A0A0F9LFA5      --QELE--------Q-ISQQLIVARNEKNNLESINRVISEYGNNNLELLGSMPEITSHRV
A0A1J5R1Y0      --GNQL--------EGLVTNLVTARMKMAEAASAYQQIRN-AQASGTSLDSLPLVVRDPV
A0A160TC29      --KETD--------Q-ITERLIEARSRRLELEGTYRQLQSLAEQTYESLSSLPSILNNPL
A0A3R2TSB1      --SQNV--------D-LQAKLLDARQKRL-------------------------------
A0A3R3XUC2      --SQNV--------D-LQAKLLDARQKRL-------------------------------
A0A407WVH8      --SQNV--------D-LQAKLLDARQKRL-------------------------------
A0A408G2L4      --GQSV--------A-LETRISELKMQQA-------------------------------
A0A405APZ8      --DTVV--------G-VESQLNQLTLREA-------------------------------
A0A3R1LUZ7      --DQVV--------N-VDNQLNELVFREA-------------------------------
A0A3R2BGD8      --DTQV--------Q-LEGQLNELTFKEA-------------------------------
A0A3R2U6C3      --AQSV--------D-AQTRVMELRSKRQ-------------------------------
A0A3R3W6C3      --GQSV--------E-AQTRVMDLRAKRQ-------------------------------
A0A407XAA6      --GQSV--------E-AQTRVMDLRAKRQ-------------------------------
A0A3R5H8M2      --KQNI--------E-LERLMIELKQKQA-------------------------------
A0A3R2H5L1      --TQSI--------T-LETKKAEFEQKQA-------------------------------
A0A3R1PLZ2      --TQSI--------T-LETKKAELEQKQA-------------------------------
A0A406JUR4      --TQSI--------T-LETKKAELEQKQA-------------------------------
A0A409MU65      --TQSI--------T-LETKKAELEQKQA-------------------------------
A0A3R2CMW0      --TQSI--------Q-LETSKAEIEQKLA-------------------------------
A0A407T0V1      --TQSI--------T-LETQKAQLEQQVA-------------------------------
A0A0F9VQU4      --QRYI--------E-LDTRLDELEFQEA-------------------------------
A0A1W1DYN8      --NRII--------M-IETQLAELEVKHS-------------------------------
A0A1W1E4Z5      --NRII--------M-IETQLAELEVKHS-------------------------------
A0A3R1GLT3      --DQEV--------A-VETSIQQLRLQQA-------------------------------
A0A3R3DWA3      --EQEV--------S-VESSIQQLHMKQA-------------------------------
A0A2H9T6C5      --DQAV--------D-IDTQLAQLDMQIK-------------------------------
A0A3R2W4Z8      --TMSV--------Q-LQTKLLESQQLRR-------------------------------
A0A3R5D942      --TMSV--------Q-LQTKLLESQQLRR-------------------------------
A0A0F9KY21      --EQIV--------E-LDTTLQELDLKRL-------------------------------
A0A404TF61      --DQIV--------A-LDTSISELKLQQA-------------------------------
A0A406MXU2      --DQIV--------A-LDTSISELKLQQA-------------------------------
A0A3R4Q9I0      --DQIV--------A-LETLISELKLKQA-------------------------------
A0A407TZB0      --DQIV--------A-LETLISELKLKQA-------------------------------
A0A0F9W5Q6      --DQVV--------E-LETAISELALKRS-------------------------------
A0A404IBN2      --DQIV--------A-LDTSISELKLQQA-------------------------------
A0A406Y387      --DQIV--------A-LDTSISELKLQQA-------------------------------
A0A3R1X9G0      --DQIV--------S-LDTNISELKLKQA-------------------------------
A0A3R3ZKH7      --DQIV--------S-LDTNISELKLKQA-------------------------------
A0A3R2WMV4      --EQMV--------V-LDTRISDLKLQQA-------------------------------
A0A3R3BQL7      --EQMV--------V-LDTRISDLKLQQA-------------------------------
A0A3R4AM40      --EQMV--------V-LDTRISDLKLQQA-------------------------------
A0A3R2HMB7      --EQMV--------V-LDTRISDLKLQQA-------------------------------
A0A3R4QTV3      --EQMV--------V-LDTRISDLKLQQA-------------------------------
A0A3R4YGM2      --GQSV--------A-LETRISELKMQQA-------------------------------
A0A3R1WG16      --EQVV--------S-LDTRISELKMQQA-------------------------------
A0A3R3R2K7      --EQVV--------S-LDTRISELKMQQA-------------------------------
A0A3R3TSL3      --EQVV--------S-LDTRISELKMQQA-------------------------------
A0A3B0VME9      --GQLE--------A-VNDALAQAVTARISKESLYLQTKKNGGENMPQ------------
A0A3B1DSR1      --SSVTNVHRDRFLK-LEEKRREVVTRQAETKARIISLEEAVAARQSP------------
A0A0F9I1G8      --SQLG--------E-LNTALARAEAEMIGKRAIYNQAIKDGPASLPR------------
J9FGR8          --SQTV--------E-YKKQLQELNNQLSTAQYIRRELTGKQLSQLLP------------
A0A0W8FS74      --KNLS--------E-TEKLRAEVIFQKKQVEFALDALNSALRKGNIY------------
A0A3B0V744      --DAIN--------G-LDSQRIKIDNKLSELELLQAKLSKTPYENLTP------------
A0A405V7W6      --DNMD--------K-YQDMLFELDNELATLRTVNSKLKSEPNRLDIY------------
A0A1W1D4H7      --QKIA--------E-YEGEQLELQTEINILNNIKYYINKN-KDLTAL------------
A0A3B1CUQ0      --ENIG--------A-LEQEKTNLDIKEQQVRYLYDEVQKNITDTSTL------------
A0A1W1BK27      --EKLA--------E-KKEMIETLKLQLKELNDFQKSFKKGNLNTVSLLNNGINISSIEP
A0A1W1CD04      --ESID--------E-KKDLIEKIILQLQEVKNFRASLQNGIMSSVALTSVGIDTSSIQS
                                                                            

A0A3B1C250      KLKEEESRMA--------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A0F9JKD8      AS----------------------------------------------------LRGQVL
A0A0F9XPI6      ------------------------------------------------------MVDRYN
A0A2H9TBF4      VQQLKQREAE--------------------------------------------------
A0A3R2R3E8      ISLTKQIT----------------------------------------------------
A0A1J5SM24      NSGPSLVSQ---------------------------------------------LNQQVA
A0A3B1C7A9      RMRALQEEIARLEMERDVAMSDTTMSATRKELLVNKNRTIRDLRKQLNEQLKIYKESIYA
A0A1J5SPZ5      PSLVSQLMSL--------------------------------------------KQQQQ-
A0A409NWS0      ------------------------------------------------------------
A0A3R1PE73      ------------------------------------------------------------
A0A3R3CX96      ------------------------------------------------------------
A0A408NUV2      ------------------------------------------------------------
A0A3R5LMR4      ------------------------------------------------------------
A0A3R5Q2V2      ------------------------------------------------------------
A0A404B052      ------------------------------------------------------------
A0A3R1PAA4      ------------------------------------------------------------
A0A3R2C7H5      ------------------------------------------------------------
A0A405AF34      ------------------------------------------------------------
A0A3R2D8P2      ------------------------------------------------------------
A0A3R2C102      ------------------------------------------------------------
A0A3R2GYI6      ------------------------------------------------------------
A0A3R2EM25      ------------------------------------------------------------
A0A3R3FNT7      ------------------------------------------------------------
S0DG33          LPRLLADLRK--------------------------------------------SEDALK
A0A3R2V5T0      DNSVIQDLRK--------------------------------------------RYITIS
A0A405JUY6      DNTVMQDLRK--------------------------------------------RYIGIN
A0A445V3X4      IQSLKTRKQE--------------------------------------------LQ----
A0A445VBS2      IQSLKTRKQE--------------------------------------------LQ----
A0A407V607      IQALQRQLTE--------------------------------------------AE----
T0ZG59          IEKLQQAYAE--------------------------------------------DQ----
A0A3R3TCJ4      VSQLRGQRAV--------------------------------------------VT----
A0A3R4EU13      VSQLRGQRAV--------------------------------------------VT----
A0A3B1AK25      VGSLKHSESD--------------------------------------------MQ----
A0A3R4E576      ANELRQKYLA--------------------------------------------AS----
A0A404I461      ANELRQKYLA--------------------------------------------AS----
A0A408J920      ANDLRKKYLE--------------------------------------------SS----
A0A3R1N912      ANDLRKKYLE--------------------------------------------SS----
A0A405ZIS9      ANDLRKKYLE--------------------------------------------SS----
A0A380TGM5      VQQLRIQEAA--------------------------------------------VL----
A0A3P5W345      VQQLRIQEAA--------------------------------------------VL----
A0A380TDI0      IQRLREQELE--------------------------------------------LE----
A0A380TDN3      IQRLREQELE--------------------------------------------LE----
A0A3P5WKD3      IERFREQELE--------------------------------------------LE----
A0A3R2WIS1      ------------------------------------------------------------
A0A3R5EJ70      ------------------------------------------------------------
A0A3R3UIB9      IQQFKADEAR--------------------------------------------AR----
A0A409NVE8      IQQFKADEAR--------------------------------------------AR----
A0A0F9U8M8      ISEGRVLLET--------------------------------------------AE----
A0A381Y0U7      LDALTREFHT--------------------------------------------GQ----
A0A381Z3K5      LDSLIREFLT--------------------------------------------GQ----
A0A0F9UWR4      IQQFKSEQAR--------------------------------------------AR----
A0A3R1X0V0      IQQLKADETK--------------------------------------------AR----
A0A0F9LFA5      IQDVKREVIL--------------------------------------------VE----
A0A1J5R1Y0      VAQLEQVVAQ--------------------------------------------KQ----
A0A160TC29      VVKLRENETN--------------------------------------------AE----
A0A3R2TSB1      ------------------------------------------------------------
A0A3R3XUC2      ------------------------------------------------------------
A0A407WVH8      ------------------------------------------------------------
A0A408G2L4      ------------------------------------------------------------
A0A405APZ8      ------------------------------------------------------------
A0A3R1LUZ7      ------------------------------------------------------------
A0A3R2BGD8      ------------------------------------------------------------
A0A3R2U6C3      ------------------------------------------------------------
A0A3R3W6C3      ------------------------------------------------------------
A0A407XAA6      ------------------------------------------------------------
A0A3R5H8M2      ------------------------------------------------------------
A0A3R2H5L1      ------------------------------------------------------------
A0A3R1PLZ2      ------------------------------------------------------------
A0A406JUR4      ------------------------------------------------------------
A0A409MU65      ------------------------------------------------------------
A0A3R2CMW0      ------------------------------------------------------------
A0A407T0V1      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A3R1GLT3      ------------------------------------------------------------
A0A3R3DWA3      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A3R2W4Z8      ------------------------------------------------------------
A0A3R5D942      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A404TF61      ------------------------------------------------------------
A0A406MXU2      ------------------------------------------------------------
A0A3R4Q9I0      ------------------------------------------------------------
A0A407TZB0      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A404IBN2      ------------------------------------------------------------
A0A406Y387      ------------------------------------------------------------
A0A3R1X9G0      ------------------------------------------------------------
A0A3R3ZKH7      ------------------------------------------------------------
A0A3R2WMV4      ------------------------------------------------------------
A0A3R3BQL7      ------------------------------------------------------------
A0A3R4AM40      ------------------------------------------------------------
A0A3R2HMB7      ------------------------------------------------------------
A0A3R4QTV3      ------------------------------------------------------------
A0A3R4YGM2      ------------------------------------------------------------
A0A3R1WG16      ------------------------------------------------------------
A0A3R3R2K7      ------------------------------------------------------------
A0A3R3TSL3      ------------------------------------------------------------
A0A3B0VME9      -------------------------VLNNPLLQN--------------------LKKQYS
A0A3B1DSR1      --KKLERMVRIFLSYQTGRGGQSAATQLNPDLVT--------------------LESRLV
A0A0F9I1G8      -------------------------VLSNLVIAN--------------------LKADYA
J9FGR8          ----------------------ANSGIASTTLAG--------------------QIEEYN
A0A0W8FS74      ---------------------SPAIMRDDPLVAG--------------------LAAKLS
A0A3B0V744      -----------------------KVNVYPNYLNR--------------------AFDEFN
A0A405V7W6      ---------------RLIPEMLGKSF--EISLTK--------------------QITDLN
A0A1W1D4H7      --------------------SIGTVKFTDNRISL--------------------LVTSLE
A0A3B1CUQ0      --------------------NLSVLE--DTVVQS--------------------MISSLA
A0A1W1BK27      LIERFHAIDIELEDMRIQAKNIEKSLTKRPQLEQ--------------------LIQRLH
A0A1W1CD04      LIDSYTKSEETIRELRLQQNNITKSVTSNLLIAA--------------------LINELK
                                                                            

A0A3B1C250      ---RRVSELSKRYGKKHPKMIAAISDYKEARRTVRKEVKRVV------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A0F9JKD8      KGEQRITEFSKKYGQKHPLMIESVGDLRVLREKKEQEIGRVV------------------
A0A0F9XPI6      DQVLQRNKLLQTVGIQHPSLIAISTQLEVAKVNIIKTINIYQTQLRTSLIQSNQ------
A0A2H9TBF4      -LEQKVRELGRRYGPKHPKMIAANTELESISNNIRLQVQRIV------------------
A0A3R2R3E8      -------DLNLLLERKEELLTNVTENNSELKNLNLRIQSKIQ------------------
A0A1J5SM24      QQEIDIAKLRERYRDKHPIMVAALNSLAQTKAQLKLAIDAAA------------------
A0A3B1C7A9      ASPAELKELSLKLLTEEVRYKSLQATYQNLNK----------------------------
A0A1J5SPZ5      -------VLAERYLERYPKMIDIANQISVAQSQLDKAIKLAV------------------
A0A409NWS0      -------EISKLYTKRHPAYRTLLEKRQALED----------------------------
A0A3R1PE73      -------EISKLYTKRHPAYRTLLEKRQALED----------------------------
A0A3R3CX96      -------EISKLYTKVHPAYRTLLEKRQALED----------------------------
A0A408NUV2      -------ELQQLYTRQHPAYIALMEKRQALMN----------------------------
A0A3R5LMR4      -------ELQQLYTRQHPAYIALMEKRQTLMN----------------------------
A0A3R5Q2V2      -------ELQQLYTRQHPAYIALMEKRQTLMN----------------------------
A0A404B052      -------ELQQLYTRQHPAYIALMEKRQTLMN----------------------------
A0A3R1PAA4      -------EISKLYTRVHPAYRALLEKRATLEA----------------------------
A0A3R2C7H5      -------EISKLYTREHPAYRALLEKRATLEA----------------------------
A0A405AF34      -------EISKLYTREHPAYRALLEKRATLEA----------------------------
A0A3R2D8P2      -------ELSKLYTKEHPAYRALLEKKQTLEK----------------------------
A0A3R2C102      -------EISKLYTKEHPAYRALLEKRGTLQQ----------------------------
A0A3R2GYI6      -------EVSKLYTKQHPAYRALLEKRQTLED----------------------------
A0A3R2EM25      -------EISKLYTKEHPAYRALMEKRATLQQ----------------------------
A0A3R3FNT7      -------EISKLYTKEHPAYRALMEKRVTLQQ----------------------------
S0DG33          HFRSTSQSMQPTSEAQAYLQGGLDLDKQIAGLQLQR--TQLL------------------
A0A3R2V5T0      ---DRQRGIVQQFGADHPQAAALDAEKKEISQQIFQELQQLT------------------
A0A405JUY6      ---DREQAIIQQFGADHPQAIAMKAEKQDVTNQMFRELQQLT------------------
A0A445V3X4      ---AEYDKNLRILKPGYPKMGQLRQQIADIGREISDESQNIL------------------
A0A445VBS2      ---AEYDKNLRILKPGYPKMGQMRQQITDIEREISDESRNIL------------------
A0A407V607      ---ASPLKSQGL-GARHPELVALNNRIASLKRAIAAEVRAQV------------------
T0ZG59          ---AKYQDQLRIYKPAFPAMLQLHAKLDEIHRQIAARTALVS------------------
A0A3R3TCJ4      ---ARVADLQARYGPRHPEMLRAQQELAAIDGQIQAEIQRVI------------------
A0A3R4EU13      ---ARVADLQARYGPRHPEMLRAQQELAAIDGQIQAEIQRVI------------------
A0A3B1AK25      ---REVSALAKRYGPMHPEMIQAKANLAKATQNVNRRIRSVT------------------
A0A3R4E576      ---KRETEISDRLGSNHIQAARLRSEMAEYQRQMFAELNRIA------------------
A0A404I461      ---KRETEISDRLGSNHIQAARLRSEMAEYQRQMFAELNRIA------------------
A0A408J920      ---KIEAEITRRLGSNHIQAVRLRNEMQEYRRLMFQEISRIA------------------
A0A3R1N912      ---KIEAEITGRLGKNHVQAVRLRNEMQEYRRLMFQEVSRIA------------------
A0A405ZIS9      ---KIEAEITRRLGSNHIQAVRLRNEMQEYRRLMFQEISRIA------------------
A0A380TGM5      ---RELAELSIELGERHPRVINKKSELEKFRAKIEAEMERVL------------------
A0A3P5W345      ---RELAELSIELGERHPRVINKKSELEKFRAKIEAEMERVL------------------
A0A380TDI0      ---RKEAELGQNLGARHPAMIQLQAERQRFREKLQAEIGKIV------------------
A0A380TDN3      ---RKEAELGQNLGARHPAMIQLQAERQRFREKLQAEIGKIV------------------
A0A3P5WKD3      ---RKEAELGQSLGARHPAMIQLQAERQRFREKLQAEIGKIV------------------
A0A3R2WIS1      -------ELLARFTETNPKVRMVDGQIAAINHEING------------------------
A0A3R5EJ70      -------ELLARFTETNPKVRMVDGQIAAINHEING------------------------
A0A3R3UIB9      ---AKVDELSKRYGDRHPALEAARSDLKAASASLRGQVEQIV------------------
A0A409NVE8      ---AKVDELSSRYGARHPALEAARSDLKAASASLRGQVEQIV------------------
A0A0F9U8M8      ---LKFAELSKIYGPKHPKLIAASEELDMRVEQVNAQIQSLI------------------
A0A381Y0U7      ---QTLANQSIDLGDQHPRIKGLKKVVATLEEQIDNRIKGIL------------------
A0A381Z3K5      ---QALANQSIDLGDQHPRIKGLKKVVAILEGQIDARIQGVL------------------
A0A0F9UWR4      ---ARVEELSRRYGERYPAMQAAQSDLNAATASLRAQVEQVV------------------
A0A3R1X0V0      ---AKVEERSKRYGAQHPQMEAVRAELNAASASLHGQIVQVV------------------
A0A0F9LFA5      ---RKLSDLGEVYGPRHPKIISANAELATVKNNLNKQIKGLI------------------
A0A1J5R1Y0      ---QKVSELSKRYGPKFITMIQAQAELQQARDNLKHQVAIVV------------------
A0A160TC29      ---LKVSELSKRYGPLHPRMIAAQSDLDAVRDSVFTQMKRIA------------------
A0A3R2TSB1      -------DLASRFTSQHPMLITLDAQIASLRKEL--------------------------
A0A3R3XUC2      -------DLASRFTSQHPMLITLDAQIASLRKEL--------------------------
A0A407WVH8      -------DLASRFTSQHPMLITLDAQIASLRKEL--------------------------
A0A408G2L4      -------EMDRKFTKQHPAYRALMSQIGELTQ----------------------------
A0A405APZ8      -------EISQLYTKDHPAYRSLMDKRKTLQG----------------------------
A0A3R1LUZ7      -------EISQLYTKEHPTYKALVEKRETLNQ----------------------------
A0A3R2BGD8      -------EISKLYTRVHPAYRALLEKRATLEA----------------------------
A0A3R2U6C3      -------ELITRFAPTHPSIVGIDRQIASLTG----------------------------
A0A3R3W6C3      -------ELITRFSPSHPSIVSIDRQIASLSN----------------------------
A0A407XAA6      -------ELITRFSPSHPSIVSIDRQIASLSN----------------------------
A0A3R5H8M2      -------EFSAKYTNDHPLMAEINAQLKELSS----------------------------
A0A3R2H5L1      -------EMAAKYTAEHPAMREINGQLAAINK----------------------------
A0A3R1PLZ2      -------EMVAKYTAEHPAMREINGQLGAINK----------------------------
A0A406JUR4      -------EMVAKYTAEHPAMREINGQLGAINK----------------------------
A0A409MU65      -------EMVAKYTAEHPAMREINGQLGAINK----------------------------
A0A3R2CMW0      -------EAAAKYTNEHPAMQQMNAQLGAINK----------------------------
A0A407T0V1      -------EAGAKYTSEHPVMQQMNAQLGAINK----------------------------
A0A0F9VQU4      -------ELAQRFTPSHPNYQALIRQRRQIQR----------------------------
A0A1W1DYN8      -------DLSKKYTDIHPIMITLTNQEVKLQE----------------------------
A0A1W1E4Z5      -------DLSKKYTDIHPIMITLTNQEVKLQE----------------------------
A0A3R1GLT3      -------EMDRKFTRDHPAYQALMRQIGDLEA----------------------------
A0A3R3DWA3      -------EMDRSFTREHPAYRALLNQIAGLQA----------------------------
A0A2H9T6C5      -------QMGQRYTKSHPVMEELQLQRQLIVD----------------------------
A0A3R2W4Z8      -------ELLSRFTESNPKVRMIDGQIAAVRH----------------------------
A0A3R5D942      -------ELLSRFTESNPKVRMIDGQIAAVRH----------------------------
A0A0F9KY21      -------ELSRKFKREHPAYQGVIKQIESIEA----------------------------
A0A404TF61      -------EMDRKFTRQHPAYRALLSQLGELTA----------------------------
A0A406MXU2      -------EMDRKFTRQHPAYRALLSQLGELTA----------------------------
A0A3R4Q9I0      -------EMEHRFTREHPSYQALMTQMGQLDQ----------------------------
A0A407TZB0      -------EMEHRFTREHPSYQALMTQMGQLDQ----------------------------
A0A0F9W5Q6      -------EMERRFTRQHPTYQALMEQKRQLET----------------------------
A0A404IBN2      -------EMDRKFTRQHPAYRALLSQLGELTA----------------------------
A0A406Y387      -------EMDRKFTRQHPAYRALLSQLGELTA----------------------------
A0A3R1X9G0      -------EMDRKFTREHPAYRALMTQLGELTN----------------------------
A0A3R3ZKH7      -------EMDRKFTREHPAYRALMTQLGELTN----------------------------
A0A3R2WMV4      -------DLDRKFTREHPAYRALMAQLGDLNK----------------------------
A0A3R3BQL7      -------DLDRKFTREHPTYRALMAQLGDLNK----------------------------
A0A3R4AM40      -------DLDRKFTREHPTYRALMAQLGDLNK----------------------------
A0A3R2HMB7      -------DLDRKFTREHPTYRALMAQLGDLNK----------------------------
A0A3R4QTV3      -------DLDRKFTREHPAYRALMAQLGDLNK----------------------------
A0A3R4YGM2      -------EMDRKFTKQHPAYRALMSQIGELTQ----------------------------
A0A3R1WG16      -------EMDRKFTRQHPAYRALMTQIGELTQ----------------------------
A0A3R3R2K7      -------EMDRKFTRQHPAYRALMTQIGELTQ----------------------------
A0A3R3TSL3      -------EMDRKFTRQHPAYRALMTQIGELTQ----------------------------
A0A3B0VME9      DLRSQYEVLSTVFKDQYPKVKKLKAQMKDLRNRYAQEQQLIL------------------
A0A3B1DSR1      PLVLRERSLLREFGKDHSDVIGIREQINALRDIYRQKGIDISESGITDEGIEEGAVKIDF
A0A0F9I1G8      RLVSQYQDLTTTFLDDYPEVKNLKSRMLSIGERIHIEEKKIF------------------
J9FGR8          KLVLDRNRLVANSSEKNPLVVDMTETLRAL-------KNTLI------------------
A0A0W8FS74      ELEIQKRTLLTDYTENHPAVRTIQGQIDEI-------QKKIR------------------
A0A3B0V744      LLKNDLQKLGLSYKENTYTFKSRQKEVELM-------RADIL------------------
A0A405V7W6      SLLERKEELLTNVSENNSELKNLGVRIQSK-------IQSIR------------------
A0A1W1D4H7      ALMNRREQLASKYTQFHPDIVKIDKSIKIA-------KKAIK------------------
A0A3B1CUQ0      MLENNRKSLLSEYTARHPQVVALSAEINEI-------KKRIN------------------
A0A1W1BK27      KEKDTLEELNFNFTPTHPQVVKTNNTIIEI-------ENDIR------------------
A0A1W1CD04      EKETLLRSLLTDFTEEHPQVIEQKKEVDNM-------RNKIH------------------
                                                                            

A0A3B1C250      -----DGIRRDFEAAVANEKELRR-----------------------LSNTTEKDARRIK
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A0F9JKD8      -----KSVENEYDLALSNEHNIRR-----------------------LLSETKLEAHGIN
A0A0F9XPI6      -----------------------------------------------AQNKVNSVFSGLP
A0A2H9TBF4      -----LGVENEFEVARANEQSLVA-----------------------AMTTAKQAVQTIN
A0A3R2R3E8      -----SIRRSVEVIQERILEQAKVIRG--------------------KIGIVEGEYLKMP
A0A1J5SM24      -----AAVQANYQTAQSDYQHAKA-----------------------ALAAQEQESLELD
A0A3B1C7A9      -----------------------------------------------IIDNYESKFNELP
A0A1J5SPZ5      -----DEIKSQLAKTIDAEKRLEA-----------------------EKAIQEKAFLHLG
A0A409NWS0      -----------------------------------------------EKSKLNNRVTAMP
A0A3R1PE73      -----------------------------------------------EKSKLNNRVTAMP
A0A3R3CX96      -----------------------------------------------EKTKLNNRVTAMP
A0A408NUV2      -----------------------------------------------TKNTINKSIKRLP
A0A3R5LMR4      -----------------------------------------------TKNVINKSIKRLP
A0A3R5Q2V2      -----------------------------------------------TKNTINKSIKRLP
A0A404B052      -----------------------------------------------TKNTINKSIKRLP
A0A3R1PAA4      -----------------------------------------------EKARLGKQVQTLP
A0A3R2C7H5      -----------------------------------------------EKARLGKQVQTLP
A0A405AF34      -----------------------------------------------EKARLGKQVQTLP
A0A3R2D8P2      -----------------------------------------------EKVNLNKHIASLP
A0A3R2C102      -----------------------------------------------EKDKLDKRVSKMP
A0A3R2GYI6      -----------------------------------------------ERNKLNKRIATMP
A0A3R2EM25      -----------------------------------------------EKDKLNKRVSGMP
A0A3R3FNT7      -----------------------------------------------EKDKLNKRVSGMP
S0DG33          -----ERYRPDSRWVQSVDTQLAQLKD--------------------AKAQFNGHFNGMP
A0A3R2V5T0      -----GSFKNE---VDVANSRVQSLRD--------------------SIDKVAGRNSQAN
A0A405JUY6      -----GSFKNE---LDVSQSRVESMRE--------------------NIQRVAGNNSDAN
A0A445V3X4      -----ESVEKD---LMAYTAQEAGFRA--------------------RVAEIKEEMLSLQ
A0A445VBS2      -----ESVEKD---LMAYTAQEAGFRA--------------------RVAEIKEEMLSLQ
A0A407V607      -----GHNAPA---GTLDEIRMGLLRELAAAEAEIAAGRSSLSAAQGRRKALTASMTRFP
T0ZG59          -----GAAQSA---YGAAKARETLLRQ--------------------RVADLRQQVLNLE
A0A3R3TCJ4      -----SNLEAR---VQVARDRTNSVQS--------------------SIGRARGTLAGNN
A0A3R4EU13      -----SNLEAR---VQVARDRTNSVQS--------------------SIGRARGTLAGNN
A0A3B1AK25      -----NGVEKE---YQIAMAAESSLKR--------------------SLQRAKGEMQNIN
A0A3R4E576      -----ESYKSD---LDVAVAREKSLTQ--------------------SVSQATGVSATAN
A0A404I461      -----ESYKSD---LDVAVAREKSLTQ--------------------SVSQATGVSATAN
A0A408J920      -----QSYKSD---LEVSEAKEKSLAE--------------------SVAKATDISNSAS
A0A3R1N912      -----QSYKSD---LEVAEARERTLEA--------------------SVAKATTVSNSAS
A0A405ZIS9      -----QSYKSD---LEVSEAKEKSLAE--------------------SVAKATDISNSAS
A0A380TGM5      -----KGYATA---VSVATAREDSLER--------------------ELNKLKSKQALAN
A0A3P5W345      -----KGYATA---VSVATAREDSLER--------------------ELNKLKSKQALAN
A0A380TDI0      -----QRAENE---VVVARGREAALQR--------------------DLASVKGDMVQSN
A0A380TDN3      -----QRAENE---VVVARGREAALQR--------------------DLASVKGDMVQSN
A0A3P5WKD3      -----QRAENE---VVVARGREAALQR--------------------DLSSVKGDMVQSN
A0A3R2WIS1      ------------------------------------------------LETRVSAMPAIQ
A0A3R5EJ70      ------------------------------------------------LETRVSAMPAIQ
A0A3R3UIB9      -----AGIERN---YQLAVANENSLQA--------------------SVDANKAQIQKIS
A0A409NVE8      -----AGIERN---YQLAVANEQSLRA--------------------SVDSNKAQIQKIS
A0A0F9U8M8      -----SGIEKE---SYTAAQRVKRYRK--------------------ELSDIRSKYSDIT
A0A381Y0U7      -----AGLELR---VNSSMAQVEQLKR--------------------DVEDAKKRESDMR
A0A381Z3K5      -----AGLELR---VKSSKAQVDQLQQ--------------------DVSGAKTKESEMR
A0A0F9UWR4      -----AGIERN---YQLAVANEQSVRA--------------------SFDANKEQIQDIS
A0A3R1X0V0      -----AGIERN---YQLAVANQKTLQA--------------------SFNRVQSQQQSVS
A0A0F9LFA5      -----TGIEKE---LNRVTRTVSALER--------------------DLVKIRAEYQDIT
A0A1J5R1Y0      -----SSIEHA---YNEARANVQALSG--------------------AVAEVRGSIRQAN
A0A160TC29      -----NGIEND---FLVAKSKENSLQS--------------------ALNSTKARIRDMN
A0A3R2TSB1      -----GGVDN--------------------------------------------RIRRMP
A0A3R3XUC2      -----GGVDN--------------------------------------------RIRRMP
A0A407WVH8      -----GGVDN--------------------------------------------RIRRMP
A0A408G2L4      -----------------------------------------------QQKSLEGKVGDLP
A0A405APZ8      -----------------------------------------------ERDKLNKRISAMP
A0A3R1LUZ7      -----------------------------------------------ERARLNKRVASMP
A0A3R2BGD8      -----------------------------------------------EKARLGKQVQSLP
A0A3R2U6C3      -----------------------------------------------DVNRIGNNIKQLP
A0A3R3W6C3      -----------------------------------------------DVSRIGNNIKQLP
A0A407XAA6      -----------------------------------------------DVSRIGNNIKQLP
A0A3R5H8M2      -----------------------------------------------KKEQLNQALKQLP
A0A3R2H5L1      -----------------------------------------------QIGELNSTLKQLP
A0A3R1PLZ2      -----------------------------------------------QIGELNSTLKQLP
A0A406JUR4      -----------------------------------------------QIGELNSTLKQLP
A0A409MU65      -----------------------------------------------QIGELNTTLKQLP
A0A3R2CMW0      -----------------------------------------------KIGELNDTLKQLP
A0A407T0V1      -----------------------------------------------KIGELNATLKELP
A0A0F9VQU4      -----------------------------------------------DLQELNARVNELP
A0A1W1DYN8      -----------------------------------------------QLEKINAKAHGLP
A0A1W1E4Z5      -----------------------------------------------QLEKINAKAHGLP
A0A3R1GLT3      -----------------------------------------------RKSGFQGQVKQLP
A0A3R3DWA3      -----------------------------------------------RKDSFRRDVSALP
A0A2H9T6C5      -----------------------------------------------RKNKFSDEARGLP
A0A3R2W4Z8      -----------------------------------------------EIEGLETRVSAMP
A0A3R5D942      -----------------------------------------------EIEGLETRVSAMP
A0A0F9KY21      -----------------------------------------------EKELLTSKVSNLP
A0A404TF61      -----------------------------------------------KQDGLAKKVEGLP
A0A406MXU2      -----------------------------------------------KQNGLAKKVEGLP
A0A3R4Q9I0      -----------------------------------------------QKRGLEKKVKNLP
A0A407TZB0      -----------------------------------------------QKRGLEKKVKNLP
A0A0F9W5Q6      -----------------------------------------------RRDDLLKRVGGLP
A0A404IBN2      -----------------------------------------------KQDGLAKKVEGLP
A0A406Y387      -----------------------------------------------KQNGLAKKVEGLP
A0A3R1X9G0      -----------------------------------------------KQDGLAKKVQSLP
A0A3R3ZKH7      -----------------------------------------------KQDGLAKKVQSLP
A0A3R2WMV4      -----------------------------------------------QRHGLEKKVQDLP
A0A3R3BQL7      -----------------------------------------------QRHGLEKKVQDLP
A0A3R4AM40      -----------------------------------------------QRHGLEKKVQDLP
A0A3R2HMB7      -----------------------------------------------QRHGLEKKVQDLP
A0A3R4QTV3      -----------------------------------------------QRHGLEKKVQDLP
A0A3R4YGM2      -----------------------------------------------QQKSLEGKVGDLP
A0A3R1WG16      -----------------------------------------------QQKALESKAQDLP
A0A3R3R2K7      -----------------------------------------------QQKALESKAQDLP
A0A3R3TSL3      -----------------------------------------------QQKALESKAQDLP
A0A3B0VME9      -----DSIRLAYEEALEKEKR----------------------LTT-KAEAQKKLAIELN
A0A3B1DSR1      VALYIQSLKQLLVELKQRKLT----------------------FDE-LIALESQESKKLS
A0A0F9I1G8      -----KAIENEYQTALKKRTA----------------------LQE-RVSLQKTLAIDLN
J9FGR8          -----QTVDNLIRSLNTEMAS----------------------IRR-QSEAATSQLASNP
A0A0W8FS74      -----STYETNLVNLNKQQSS----------------------VTH-QLDIYESKLRKLP
A0A3B0V744      -----AEVNDYKQDLQKQKSN----------------------LVT-TKQQLRRQLISLP
A0A405V7W6      -----RSVEVIEDRIKSQRNV----------------------INS-NLGKIEGEYLKMP
A0A1W1D4H7      -----KAVQNSLDQLNQRSID----------------------LGN-MVVQLNKSLESLP
A0A3B1CUQ0      -----ASILNTLDSLRTKKES----------------------FSK-EIGRLRAELKVLP
A0A1W1BK27      -----SYIQTDLNRLRKSKSSIKTKIIANINTTKKSIEHKLNIFKH-DIQNENALMQTLP
A0A1W1CD04      -----GNIVTNIQKLKKNRAIAKSTILNNMLMVQNNLTDKLRLLKS-DIRQKKSLLRSMP
                                                                            

A0A3B1C250      GKEFEMAKLEREVSANRQLHDLFLTRFKETNMGENA--NVTNVRIIDRA-EPPMRPHKPK
A0A1J5RCY3      --------------------------------------SPVKVSTVRTA-TVPLAPATPK
A0A1J5RUE5      --------------------------------------SSIELTVVAPA-VPPETPFEPN
A0A0F9JKD8      EKFVKYNSLKREVDTNRKLFESLLQKMHKERIEEEG--QTVNVMLVETA-ETPSYPESPK
A0A0F9XPI6      EKEKMLRSIERQQSIKENLFLLLLQKREEAGISLAV--TTPLVKIVDYA-LTSTTPIAPK
A0A2H9TBF4      SKQFRLKALEREVRTNKDLYDAFFKRIQETSATSDL--QSANARVVDRA-FTPEHPVKPK
A0A3R2R3E8      QKKMEYNRLKSLQDLNEKYYTLLTEKKIMYSISNAG--YTSNNRVLNEA-SLNFTPVSPN
A0A1J5SM24      RYGVEYTNLERDYNINNQLLQQILERMRETSMTSTI--ETQNARIVDRG-QVAKKPVSPN
A0A3B1C7A9      NRTIGFARYQRELNAYEKLYLLIEEKYQEALISEQS--TPGNVLIIDEA-QRPVKPSKPN
A0A1J5SPZ5      DVRTEYESLKNQSDVKRKNYMDILDRLNQTQTTSNI--DKIPLRPLDRA-QIAGAPYTPN
A0A409NWS0      KTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEAS--TVGDVRIVDPA-ITQPGVLKPK
A0A3R1PE73      KTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEAS--TVGDVRIVDPA-ITQPGVLKPK
A0A3R3CX96      KTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEAS--TVGDVRIVDPA-ITQPGVLKPK
A0A408NUV2      KTQQEILRLTRDVQVGQEIFVQLLNKQQELNIMKAG--TIGNVRIIDDA-AVETRAVKPK
A0A3R5LMR4      KTQQEILRLTRDVQVGQEIFVQLLNKQQELNIMKAG--TIGNVRIIDDA-AVETRAVKPK
A0A3R5Q2V2      KTQQDILRLTRDVQVGQEIFVQLLNKQQELNIMKAG--TIGNVRIIDDA-AVETRAVKPK
A0A404B052      KTQQDILRLTRDVQVGQEIFVQLLNKQQELNIMKAG--TIGNVRIIDDA-AVETRAVKPK
A0A3R1PAA4      KTQQEILRLTRDVQVDQQVYMQLMNKQQELSISKAG--TVGNIRIIDEA-ETGLRPVQPQ
A0A3R2C7H5      KTQQEILRLTRDVQVDQQVYMQLMNKQQELSISKAG--TVGNIRIIDEA-ESGLRPVKPQ
A0A405AF34      KTQQEILRLTRDVQVDQQVYMQLMNKQQELSISKAG--TVGNIRIIDEA-ESGLRPIKPQ
A0A3R2D8P2      KTQQQILRLTRDAKVSQEVYMQLLNKQQELNISKAS--TVGYVRIVDTA-VTQPKPVRPK
A0A3R2C102      QTQQEILRLTRDVDAGKEIYMQLLNKQQELSITKAS--TVGNVRIIDPA-VTQPKPVKPK
A0A3R2GYI6      KTQQEILRLTRDVQVEQEIFMQLLNKEQELSVTKAS--TVGNVRIIDPA-LTQINPVQPR
A0A3R2EM25      KTQQEILRLTRDVQAGQEIYMQLLNKQQELGITKAS--TVGNVRIVDPA-VTQPRPVKPQ
A0A3R3FNT7      KTQQEILRLTRDVQAGQEIYMQLLNKQQELGITKAS--TVGNVRIVDPA-VTQPRPVKPQ
S0DG33          SSERESVDLLRAQKVAETIYLGMVQKAEQLQVRRAS--TTGGAHIVDAA-IRPHRPVKPR
A0A3R2V5T0      ITMVQLRELEQRSTALRTLYQSYLGRFEEASQKQSL--PIAKARIISEA-GLPTSPSSPK
A0A405JUY6      VNMVQLQELEQKASALRTLYESYLQRFEQASQQQSL--PIAKARVISDA-GVPVSPSSPR
A0A445V3X4      DRSTDYRTLKREVETNHQLYERLLQRMKEIDVIAGV--GSNNISVVDPA-EIPARPYKPS
A0A445VBS2      DRSTDYRTLKREVETNHQLYERLLQRMKEIDVIAGV--GSNNISVVDPA-EIPTHPYKPS
A0A407V607      GQEVTLTRLSREVTVASEIYQQLLQKREEARLNMAI--APTSARVIEPA-VLPTRPVAPL
T0ZG59          QRSIRYNILKREVDTNRQLYDAILQRYKEIGVAGGV--GINNISVVDRA-EPPMVRYRPR
A0A3R3TCJ4      AAAVRLNELERNAEAVRTLYKGLLDRYQETTSRAGV--ETADSRIVSAA-KAPGSPSSPN
A0A3R4EU13      AAAVRLNELERNAEAVRTLYKGLLDRYQETTSRAGV--ETADSRIVSAA-KAPGSPSSPN
A0A3B1AK25      RKGYKLGVLEREVESNRQLYKLFLNRFKETKETSGL--EQVRARIVDPA-EPSIKPIKPK
A0A3R4E576      LTQVQLRELEREAETYKNLYQTFLQRYQEAIQQQSF--PVTEARIITNA-VPPAGPSHPK
A0A404I461      LTQVQLRELEREAETYKNLYQTFLQRYQEAIQQQSF--PVTEARIITNA-VPPAGPSHPK
A0A408J920      ETQVQLRELQREAETYKNMYQTFLQRYQEAMQQQSF--PVTEARVISKA-MPPRIPSKPN
A0A3R1N912      QTQVQLRELQREAETYKNMYQTFLQRYQEAMQQQSF--PVTEARVISKA-IPPKIPSKPN
A0A405ZIS9      ETQVQLRELQREAETYKNMYQTFLQRYQEAMQQQSF--PVTEARVISKA-MPPRIPSKPN
A0A380TGM5      SREIELRELEREAEANRKLLETFLTRLKETTPQLDTEMQVPGATVLSPA-AVPLRSL-PD
A0A3P5W345      SREIELRELEREAEANRKLLETFLTRLKETTPQLDTEMQVPGATVLSPA-AVPLRSL-PD
A0A380TDI0      QASIGLRALEREADANKLLLEQFLASFMQASAQEDMRAQLPDARVVSPA-AMPDKPSYPR
A0A380TDN3      QASIGLRALEREADANKLLLEQFLASFMQASAQEDMRAQLPDARVVSPA-AMPDKPSYPR
A0A3P5WKD3      QASIGLRALEREADANKLLLEQFLASFMQASAQEDMRAQLPDARVVSPA-AMPDKPSYPR
A0A3R2WIS1      RDALR---LERDVRVNGELYKSLLNSSLQLRLVKEG--KIGNVRLLDTA-IEPKSAVKPQ
A0A3R5EJ70      RDALR---LERDVRVNGELYKSLLNSSLQLRLVKEG--KIGNVRLLDTA-IEPKSAVKPQ
A0A3R3UIB9      RKEFQIRELQREVEANRALYDTFMTRLKETAATSDL--ETANARVVDQS-VVPTQPIKPQ
A0A409NVE8      RKEFEIRELQREVEANRTLYDTFMTRLKEATATADL--ESANASVVDPA-IVPLNPIKPM
A0A0F9U8M8      GLDTKYTALKIELDTNRNLYNTFLERSRETEATSDY--KASPAHFTGVA-AASLYPVKPN
A0A381Y0U7      EKGREYFNAKRELANTTRIRDTILLRVMQEEVDLELGSKESSVEIIDEA-DLPIKAVRPN
A0A381Z3K5      EKGREYFDAKRALANTTRIRDTILLRVMQEEVDLEL-PKESTVEIIDEA-DLPIKAVRPN
A0A0F9UWR4      RKEFRVRELTREVESNRELYETFMTRLRETTSTQDL--STTNARIVDQA-IPPSRPSAPN
A0A3R1X0V0      RKEFKLRELKSEVDANRSLYNAFANRLKETAATSDL--DIVSVRIVDPA-IVPTMPVGQR
A0A0F9LFA5      RKETQYNQLKREVETNRNIFNTFLSRSKETEVTSDF--SSAAARFTDRA-YAPNNPVKPN
A0A1J5R1Y0      EKQFALADLQRDVQTNQQVYDMFLQRFKETSAATDL--TKPIASVVDPA-TAPVVPLRPH
A0A160TC29      RTEFELNDYVREVRANRGLYETFFNRISETSVTGDL--QTANARVIDPA-VLPKEPIKPN
A0A3R2TSB1      MLQQNSLRMQRDIKVNTELYSSLLNSSLQMRLAREG--RIGNVRVLDQA-LSPEKPVRPK
A0A3R3XUC2      MLQQNSLRMQRDIKVNTELYSSLLNSSLQMRLAREG--RIGNVRVLDQA-LSPEKPVRPK
A0A407WVH8      MLQQNSLRMQRDIKVNTELYSSLLNSSLQMRLAREG--RIGNVRVLDQA-LSPEKPVRPK
A0A408G2L4      ATQQELLNLTRDVEVASQIYTQLLNKSQELDIVRAG--AVGNVRLVDAADVDLTSPVKPK
A0A405APZ8      ATQQEILRLNRDVQAGQEIYMALLNKQQELSISKAS--TIGNVRIVDDA-VTLPNPIAPK
A0A3R1LUZ7      ETQQEILRLSRDVESGQAVYMQLLNRQQELSIAKSS--AIGNVRIIDPA-VTEPTAVKPQ
A0A3R2BGD8      KTQQEILRLTRDVQVDQQVYMQLMNKQQELSISKAG--TVGNIRIIDEA-ETGLRPVQPQ
A0A3R2U6C3      DLEQDVVRLVRDVRVNTELYTALLNNAQQLKLIRAG--KVGNVRILDAA-VQPDKPVRPK
A0A3R3W6C3      DLEQDVVRLVRDVRVNTELYTGLLNNAQQLRLIRAG--KVGNVRILDAA-VQPDRPVRPK
A0A407XAA6      DLEQDVVRLVRDVRVNTELYTGLLNNAQQLRLIRAG--KVGNVRILDAA-VQPDRPVRPK
A0A3R5H8M2      ETQRLYLQLYRDVKVNAEQYTALLNNYQQLKIANAG--EIGNVRIVDTA-IAPVDKIKPK
A0A3R2H5L1      DVQRQYLQLYREVEVKTQLYTALLNSYQQLRIAKAG--EIGNVRIVDTA-VEPVEPIKPK
A0A3R1PLZ2      DVQRQYLQLYREVEVKTQLYTALLNSYQQLRIAKAG--EIGNVRIVDTA-IEPVEPIKPK
A0A406JUR4      DVQRQYLQLYREVEVKTQLYTALLNSYQQLRIAKAG--EIGNVRIVDTA-IEPVEPIKPK
A0A409MU65      DVQRQYLQLYREVEVKTQLYTALLNSYQQLRIAKAG--EIGNVRIVDTA-IEPVEPIKPK
A0A3R2CMW0      DLQRRYLQLYREVEVKTQLYTALLNSYQQLRIAKAG--EIGNVRIVDTA-VLPIEPIKPK
A0A407T0V1      DLQRRYLQLYREVEVKQQLYTALLNSYQQLRIAKAG--EIGNVRIVDTA-IEPVEPIKPK
A0A0F9VQU4      AAQQEVLRRTRDVEVTQAIYVNILNKVQELEVARAG--TIGNIRIIDSA--VLSGQVAPN
A0A1W1DYN8      KTQQEILRLSRDVEVATTIYTQLLNKTQELKVVKAG--AVGNVRIIDTA-LTAQRPIKPK
A0A1W1E4Z5      KTQQEILRLSRDVEVATTIYTQLLNKTQELKVVKAG--TVGNVRIIDTA-LTAQRPIKPK
A0A3R1GLT3      EAQQELLRLTRDLQVSNEMYTAMLNQAQQLDVARAG--TVGNVRIVDAAEVDATEPVKPR
A0A3R3DWA3      DTQQELLRLTRDLQVSNELYTALLNQAQQLDVARAG--TVGNVRIVDPAVVDMSSPVKPR
A0A2H9T6C5      KTQQEVMRLARDVQVNTEVYTELLNKAQELKIVKAS--AVGNVRILDHA-LSAIEAVKPK
A0A3R2W4Z8      AVQRDALRLERDVRVNGELYKSLLNSSLQLRLVKEG--KIGNVRLLDTA-VEPKKAVKPQ
A0A3R5D942      AIQRDALRLERDVRVNGELYKSMLDSSLQLRLVKEG--KIGNVRLLDTA-VEPRRAVKPQ
A0A0F9KY21      ETQQELLRLTRDVEVGNEIYMLLLSKTQELDIVRAG--TVGNVRVVDAAAVDTTEPVKPK
A0A404TF61      STQQELLSLTRDVKVSTEIYTQLLNKSQELDVMRAG--TVGNVRLIDTADVDLRKPVKPR
A0A406MXU2      STQQELLSLTRDVKVSTEIYTQLLNKSQELDVMRAG--TVGNVRLIDTADVDLKKPVKPK
A0A3R4Q9I0      ETQQELLRLTRDMQVTTDIYTQLLNKTQELDIVRAG--TVGNVRVIDSADANIEKPVKPK
A0A407TZB0      ETQQELLRLTRDMQVTTDIYTQLLNKTQELDIVRAG--TVGNVRVIDSADANIEKPVKPK
A0A0F9W5Q6      ETQQELLRFARDVKVSTEIYTAMLNKSQELDIVRAG--TVGNVRIIDDAVVDTSQPVKPK
A0A404IBN2      STQQELLSLTRDVKVSTEIYTQLLNKSQELDVMRAG--TVGNVRLIDTADVDLKKPVKPK
A0A406Y387      STQQELLSLTRDVKVSTEIYTQLLNKSQELDVMRAG--TVGNVRLIDTADVDLKKPVKPK
A0A3R1X9G0      STQQELLSLTRDVRVGTEIYTQLLNRSQELDVMRAG--TVGNVRLIDGADVDRTKPVKPK
A0A3R3ZKH7      STQQELLSLTRDVRVGTEIYTQLLNRSQELDVMRAG--TVGNVRLIDGADVDRTKPVKPK
A0A3R2WMV4      ATQQELLNLTRDVEVATQIYTQLLNKSQELDIVRAG--AVGNARLIDTADVDITSPVKPR
A0A3R3BQL7      ATQQELLNLTRDVEVATQIYTQLLNKSQELDIVRAG--AVGNARLIDTADVDITSPVKPR
A0A3R4AM40      ATQQELLNLTRDVEVATQIYTQLLNKSQELDIVRAG--AVGNARLIDTADVDITSPVKPR
A0A3R2HMB7      ATQQELLNLTRDVEVATQIYTQLLNKSQELDIVRAG--AVGNARLIDTADVDITSPVKPR
A0A3R4QTV3      ATQQELLNLTRDVEVATQIYTQLLNKSQELDIVRAG--AVGNARLIDTADVDITSPVKPR
A0A3R4YGM2      ATQQELLNLTRDVEVASQIYTQLLNKSQELDIVRAG--AVGNVRLVDAADVDLTSPVKPK
A0A3R1WG16      ATQQELLNLTRDVEVASQIYTQLLNKSQELDIVRAG--AVGNVRLVDSADVDLTSPVKPK
A0A3R3R2K7      ATQQELLNLTRDVEVASQIYTQLLNKSQELDIVRAG--AVGNVRLVDSADVDLTSPVKPK
A0A3R3TSL3      ATQQELLNLTRDVEVASQIYTQLLNKSQELDIVRAG--AVGNVRLVDSADVDLTSPVKPK
A0A3B0VME9      SRATQYKILRREVATNREVYSSLLSRSKEIEASAGS--DNGNIMIVSMA-RPPLYPYKPK
A0A3B1DSR1      RYLMEDQTHSDEIERLKTIWQIAVDQLNRTTLSKNH--SGYSMEKMAPV-RAELS--FKR
A0A0F9I1G8      ERATQYKIIAREVETNKGIYQSLLERAKEIESMVGV--SSSNIHIVDRA-LLPIFPFKPN
J9FGR8          GQAKYLLSVERQQKVKEELYLYLLQKREENELSQAF--TAYNTRVINAP-RGSMAPTAPQ
A0A0W8FS74      KAERDLARLTRVSNVNAGIYTFLLQKHEEARIAKAT--TVSNINIVDPA-ITPVSPIKPD
A0A3B0V744      SKNTEYNKSKRFYSVYEEMYLSLMQSKNEFEIAIAG--SITKIKILSPA-SLSNTPIYPV
A0A405V7W6      QQKMEYNRLKSLQDLNEKYYTLLTEKKVMYSISNAG--YTSSNRILNEA-SLNSIPVSPN
A0A1W1D4H7      TEEKKLAQLLRPLKVNQKIYEFLLQKRAETAILKSA--TIANARILDSA-RENTTPVKPK
A0A3B1CUQ0      EEEKTLAGLVLNKEVLSNINAFLFQKLNEATITQAS--TISSIQVVDPA-IVPKKPIKPQ
A0A1W1BK27      EKSLTVQELKRKFTLSENIYTFLLQKKMETQMSLAS--VIENTQIIESA-REGLKPIKPN
A0A1W1CD04      KENLVNASLKRNFALNEEIYTFLLQRKIEIEISKAS--TIANTRVVENA-YVAKGAYKPK
                                                                            

A0A3B1C250      KSRIVGLALFIGIFLGVILAFVQEHLDKTFRNTDD----VERFL--TLPVLG--------
A0A1J5RCY3      KTLNLALGLLVGLALGVGLAVLREVLDTKVRNEAD----VRRVT--EASVLG--------
A0A1J5RUE5      TRFLSVTGLALGLGAGVILALLLTIFDTRVRTAAD----IERVI--HLPALA--------
A0A0F9JKD8      KALNLIIGFMIGILGGAMLAFFFEYFDNTVKAAED----AEEKL--GIPVLG--------
A0A0F9XPI6      KTIILGVSGILGLLIPFVFFYIKFSLNDKIGSKSD---VLAIES--SIPFLG--------
A0A2H9TBF4      KKLIVGIAALLSLLIACGMAYLLEMLNNTIRTAKD----VEDQL--NLPVLG--------
A0A3R2R3E8      RKLVYAGFIFIGFVSGFAFLFFKYVTFNEINTIDD----LKHLLPDKVTVLG--------
A0A1J5SM24      VPLNLGLGFVGGLGLGLAFAFFVAYIDDRVKSSYD----IESVI--GLPLIG--------
A0A3B1C7A9      RKLIVVIGLILGFGFGVGFAFVRDYFDNTVKTPED----IE-KE--NINVLT--------
A0A1J5SPZ5      MGRIIKTCTGLGVLVFLGVAVGLSFIDDRIKSAWD----VEHFI--GANLLG--------
A0A409NWS0      KALIVLGSIILGLMLSIMGVLLRSLFNRGIESPQV----LE-EN--GISVYA--------
A0A3R1PE73      KALIVLGSIILGLMLSIMGVLLRSLFNRGIESPQV----LE-EN--GISVYA--------
A0A3R3CX96      KALIILGSMILGLMLSIVGVLLRSLLNRGIESPQV----LE-EN--GISVYA--------
A0A408NUV2      KPLIVVLATLLGGMLSVGLILVRAAFHRGVESPEQ----LE-EM--GLSVYA--------
A0A3R5LMR4      KPLIVVLATLLGGMLSVGLILVRAAFHRGVESPEQ----LE-EM--GLSVYA--------
A0A3R5Q2V2      KPLIVVLATLLGGMLSVGIILVRAAFHRGVESPEQ----LE-EM--GLSVYA--------
A0A404B052      KPLIVVLATLLGGMLSVGLILVRAAFHRGVESPEQ----LE-EM--GLSVYA--------
A0A3R1PAA4      KAMIVFFALLMGGVLSASVVVLRAALHRGISDTDT----LE-KR--GISVYA--------
A0A3R2C7H5      KAMIVFFALLLGGVLSASVVVLRAALQHGVSDTEA----LE-KR--GINVYA--------
A0A405AF34      KAMIVLFALLMGGVLSASIVVLRAALQRGVSDTEA----LE-KR--GINVYA--------
A0A3R2D8P2      KALIVALATVLGGGLSVVYVLVMAAFRKGLESPDE----LE-EL--GVSVYA--------
A0A3R2C102      KTLIVIIVTMLGGAIAVVIVLAKNMLHRGIESPDQ----LE-EQ--GINVYA--------
A0A3R2GYI6      KTLIVLLAVFVGGLLSVGFVLLKTMLHKGIDNPEA----LE-EH--GINVYA--------
A0A3R2EM25      KTIIVLIVTLLGGLFSTGFVLLKTMLHRGIESPEQ----LE-QQ--GINVYA--------
A0A3R3FNT7      KTIIVLIVTLLGGLFSTGFVLLKTMLHRGIESPEQ----LE-QQ--GINVYA--------
S0DG33          PELVLGGGLILGLISG----VVLVFMRRYVMTGVTDPRYVERRM--SVPVFGEILFSQQQ
A0A3R2V5T0      KTMTMALSVVLGLMLGGGIAALLEFRDRFFHTGND----VRDNL--RMRFLG--------
A0A405JUY6      KTLTIALSVILGLLIGCAAAAVLELRERFFRTGED----VQQKL--GMRFLG--------
A0A445V3X4      LSRNLTLALAFGFLGGGLLAFLFEKLDDTLKTGEE----LEKHL--GLPLLG--------
A0A445VBS2      LSRNLTLALVFGLLGGGVLAFLFEKLDDTLKTGEE----LERHL--GLPLLG--------
A0A407V607      KGPTGPVLVLMGLAAAFAAGALKDLLDRTASPHDL----AGYVQ--ALQIYA--------
T0ZG59          LKLNLTIGLLLGLFAGIAAALVLDHLDDTVHIATD----AEQKL--GLAVLG--------
A0A3R3TCJ4      IPVNLVLGFIFAVGAGLTAVVIMEMLDDGLLTADD----VEARL--GLPTLG--------
A0A3R4EU13      IPVNLVLGFIFAVGAGLTAVVIMEMLDDGLLTADD----VEARL--GLPTLG--------
A0A3B1AK25      KQLIVLIATLISGFLGILLAFLFEHLDNTIKKASD----LEDRL--HLPVLG--------
A0A3R4E576      KPLTLALFFLLGAAAGAGVGGWREYRDRFFRTGKQ----VQDYL--GLEFLG--------
A0A404I461      KPLTLALFFLLGAAAGAGVGGWREYRDRFFRTGKQ----VQDYL--GLEFLG--------
A0A408J920      KPIILALFMIMGAAAGGGIAMFREFRDRFFRTGEQ----VRDVL--GLEFLG--------
A0A3R1N912      KPMLLALFMIMGAAAGGGIAMFREFRDRFFRTGEQ----VRDVL--GLEFLG--------
A0A405ZIS9      KPIILALFMIMGAAAGGGIAMFREFRDRFFRTGEQ----VRDVL--GLEFLG--------
A0A380TGM5      KRIVLAVATIIALLLGLGLALMAERLDYGFRHAEQ----VSEAT--GLPVIA--------
A0A3P5W345      KRIVLAVATIIALLLGLGLALMAERLDYGFRHAEQ----VSEAT--GLPVIA--------
A0A380TDI0      KVFVVMIAFLGSILVGGLLALTLESLDAGFRSAEQ----IEAVT--ELPVMA--------
A0A380TDN3      KVFVVMIAFLGSILVGGLLALTLESLDAGFRSAEQ----IESVT--ELPVMA--------
A0A3P5WKD3      KVFVVMIAFLGSILVGGLLALTLESLDAGFRSAEQ----IESVT--ELPVMA--------
A0A3R2WIS1      KPLIVALSLILGLLAGVALAILRTKLSSGIRNPQE----IEDRL--GLNVYS--------
A0A3R5EJ70      KPLIVALSLILGLLAGVALAILRTKLSSGIRNPQE----IEDRL--GLNVYS--------
A0A3R3UIB9      KSLIISMAGILALMAGIGLSLLLEMLNNTFKGAEE----VEAKL--NLPVLG--------
A0A409NVE8      RGLIVGLAGILALLGSTGITLLLQILNNTFKSIEE----VENKL--NLPVLG--------
A0A0F9U8M8      KKMIVAGAFFLSLMFFVGLVILFEMLDDTIKSPSD----IESKL--SMRMLG--------
A0A381Y0U7      IPLNISLGVVVGLILGVGLAFFIEYLDTSVKTIDD----VERAL--GAAVLG--------
A0A381Z3K5      IPLNISLGVVVGLVLGVGLAFFIEYLDTSVKTIDD----VERAL--GAAVLG--------
A0A0F9UWR4      TKLLIIIATMLALIVGVAIALIADFLNNTFKSAED----VENNL--NLPVLG--------
A0A3R1X0V0      KVLVVTLTAMLSLILAAALTLLFEALNNTFKSVDQ----VEEQL--NIPVLG--------
A0A0F9LFA5      KKLIVILAFVASFGFAVVMSFIFDALNDTVKTKSD----VEGKL--AQRMLG--------
A0A1J5R1Y0      KARVIAAALLVGLLFGIAVAFLLERLDTTVRSTEE----VGLRL--GQPILT--------
A0A160TC29      KKLIVALALVVSAMFGIALAFLLDALDATVKNAED----VDRKL--GVSLLG--------
A0A3R2TSB1      AVIVMALALVVGLFLGAVTSVLRKVLKNTVATPDE----IEMRT--GLNVYS--------
A0A3R3XUC2      AVIVMALALVVGLFLGAVTSVLRKVLKNTVATPDE----IEMRT--GLNVYS--------
A0A407WVH8      AVIVMALALVVGLFLGAVTSVLRKVLKNTVATPDE----IEMRT--GLNVYS--------
A0A408G2L4      KALIVLIATFLGAFVGVALVLLRKSLSRGLEGPEA----IE-QL--GLPVYA--------
A0A405APZ8      RFLLVFLVTIIGAFFSAGIVFLKVLMHRALQNPNQ----LE-EI--GINVYA--------
A0A3R1LUZ7      KIAIIAIGIIAGFFVSGWIILLRILLRKGIDSPAQ----LE-EN--GINVYA--------
A0A3R2BGD8      KAMIVLFALLMGGVLSASVVVLRAALHRGIGDTDT----LE-KR--GISVYA--------
A0A3R2U6C3      GAIIIGVATAIGLIFGILCAFVRSALFGGLSEPED----VERHT--GLPVLA--------
A0A3R3W6C3      AAIIIGVATVIGLIFGMLCAFVRNALFGGLSEPDD----VERYT--GLPVLA--------
A0A407XAA6      AAIIIGVATVIGLIFGMLCAFVRNALFGGLSEPDD----VERYT--GLPVLA--------
A0A3R5H8M2      TLIVLILSIFVGGFLGTLLALLRNMMRSGIKDSAQ----IENEL--DLPVYA--------
A0A3R2H5L1      KLQILILSLFLGGFIGTLIALLRNMLRTGIKDSGQ----IENEL--DLPVYA--------
A0A3R1PLZ2      KLLVLILSIFVGGFIGTLVALLRNMLRTGIKDSGQ----IENEL--DLPVYA--------
A0A406JUR4      KLLVLILSIFVGGFIGTLVALLRNMLRTGIKDSGQ----IENEL--DLPVYA--------
A0A409MU65      KLLVLILSIFVGGFIGALIALLRNMLRTGVKDSGQ----IENEL--DLPVYA--------
A0A3R2CMW0      KLQILILAIFLGGFLGTLLALLRNMMHSGIKDSNQ----IENEL--DLPVYA--------
A0A407T0V1      KLQVLILSLFLGGFLGTLLALLRNMMRSGIKDSAQ----IENEL--DLPVYA--------
A0A0F9VQU4      TPRIFILYTILGLLLITGYVLLKELFKRGVESPDQ----IE-RL--GLTVYA--------
A0A1W1DYN8      KLLIVLISTLLGLFLVIAWVLVRRAMNKGVEDSDL----IERDI--GIPVYA--------
A0A1W1E4Z5      KLLIVLISTLLGLFLVIAWVLVRRAMNKGVEDSDL----IERDI--GIPVYA--------
A0A3R1GLT3      KPLLVLVGTLLGAFLSIGLVLLRQVLNRGVEDPSQ----IE-EI--GLPVYA--------
A0A3R3DWA3      RLLVVLVATLLGGFLSIGAVFVLRMLNPGIEDPAQ----IE-EL--GLPVYA--------
A0A2H9T6C5      KSLIFVLAVLLGAMLGTGFVFLRTMLRQGVKTPEE----IESKT--GLSVYA--------
A0A3R2W4Z8      KPLVVALSLVLGLLAGVAFAIVRSKLSSGIQNPQE----IEERL--GLNVYS--------
A0A3R5D942      KPLVVALSLVLGLLTGVALAILRSKLSSGIRNPQE----IEDRL--GLNVYS--------
A0A0F9KY21      KALIAVVATLLGGFLAVAIVLIQKAMHRGVEDPSE----IE-AL--GLAVYA--------
A0A404TF61      KPLIVLIATLFGAFLATALVLFRKALNRGVENPDQ----IE-QL--GLPVYA--------
A0A406MXU2      KPLIVLIATLLGAFLATAVVLFRKALSRGVENPDQ----IE-QL--GLPVYA--------
A0A3R4Q9I0      KMLIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEV----IE-QL--GIPVYA--------
A0A407TZB0      KMLIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEV----IE-QL--GIPVYA--------
A0A0F9W5Q6      KALIVVLATLLGGMLGVAIALLRHALNRGIENPEL----IE-QM--GLPVYA--------
A0A404IBN2      KPLIVLIATLLGAFLATAVVLFRKALSRGVENPDQ----IE-QL--GLPVYA--------
A0A406Y387      KPLIVLIATLLGAFLATAVVLFRKALSRGVENPDQ----IE-QL--GLPVYA--------
A0A3R1X9G0      KILIVLVATLFGAFLAVALVLLRKAINRGIESPEV----IE-KL--GLPVYA--------
A0A3R3ZKH7      KILIVLVATLFGAFLAVALVLLRKAINRGIESPEV----IE-KL--GLPVYA--------
A0A3R2WMV4      KALIILAATLLGGFVGVALVLVRKSLGRGIEGPDA----IE-KL--GLPVYA--------
A0A3R3BQL7      KALIILAATLLGGFVGVALVLVRKSLGRGIEGPDA----IE-KL--GLPVYA--------
A0A3R4AM40      KALIILAATLLGGFVGVALVLVRKSLGRGIEGPDA----IE-KL--GLPVYA--------
A0A3R2HMB7      KALIILAATLLGGFVGVALVLVRKSLGRGIEGPDA----IE-KL--GLPVYA--------
A0A3R4QTV3      KALIILAATLLGGFVGVALVLVRKSLGRGIEGPDA----IE-KL--GLPVYA--------
A0A3R4YGM2      KALIVLIATFLGAFVGVALVLLRKSLSRGLEGPEA----IE-QL--GLPVYA--------
A0A3R1WG16      KALIVLIATFLGAFFGVALVLLRKSLSRGLEGPEA----IE-QL--GLPVYA--------
A0A3R3R2K7      KALIVLIATFLGAFFGVALVLLRKSLSRGLEGPEA----IE-QL--GLPVYA--------
A0A3R3TSL3      KALIVLIATFLGAFFGVALVLLRKSLSRGLEGPEA----IE-QL--GLPVYA--------
A0A3B0VME9      VARNLLLGIVLGSFAGVGLAFVLEYLDDTIKNPDE----FPQRY--HIPVLG--------
A0A3B1DSR1      HLKFLGGGVVGGMLVLFGFIYLRAFLDTTVHTVND----IRDNF--NLPILG--------
A0A0F9I1G8      VRLNLLLAIVVGLMGGIGLAFLLEYFADTITNPDQ----ISERF--QIPILG--------
J9FGR8          RSKILLIAFVLGLALPAAVIYLMENMDNRVRGRKD----LELLT---VPLVG--------
A0A0W8FS74      KPKNLLLGFLVACILGIGLAFFQEYLDDTIKDAEE----AKRAI--GLPLLA--------
A0A3B0V744      PLFAYATAVILSIVLSFLFAGVMYLAHNKIQSLHE----IEFLT--TATTLG--------
A0A405V7W6      RRLVYAGFIFIGFVIGFAFLFFKYITFNEINTIED----LKQLLPEKVTILG--------
A0A1W1D4H7      RVLIVVVSVISGLIIGIFLAFLREFFTTTLQSLEE----LEHIT--SLPIYG--------
A0A3B1CUQ0      KKRNILLAVVVGLMSGVGFAFFFDYLDNSIKTPRD----VEERL--GLPVFG--------
A0A1W1BK27      KKLIVIVGFITSLILAIFYVFLKSMLDTKIRNEAN----IKELT--DAPLYG--------
A0A1W1CD04      KTLIMAVATIVGFILAIFFVLMRDFFDTKIRTVRD----IESLT--DKPIYG--------
                           .                                                

A0A3B1C250      -----------SVPTV-------------------------KKGGDDAFGPEWHSLANPR
A0A1J5RCY3      -----------SVHYD-----------------------------PDAPDHPLIVQSGPQ
A0A1J5RUE5      -----------TIVRA-----------------------------RQSQQPATTVAHDPS
A0A0F9JKD8      -----------MVSHL------------------------RREKKGKERHIERIVIEEPK
A0A0F9XPI6      -----------EIPHF--------------------------------KTEKKFIDFNDH
A0A2H9TBF4      -----------VLPEV----------------------DIKASSVPVSQLFINKDISKEQ
A0A3R2R3E8      -----------NIPLL----------------------------KESTEYSQLLVHNTPK
A0A1J5SM24      -----------IIPEI---------KKMEQPD------------------KAQIVMNNAD
A0A3B1C7A9      -----------WIPKI---------EGVETNKE-----------------FEFIIHEKSD
A0A1J5SPZ5      -----------IIPEI---------------------------GQIKDEDKYQLVLNNKP
A0A409NWS0      -----------SIPLS---------EWQKSRDSVKTVKGVK---RYKQ--SQLLAVGNPT
A0A3R1PE73      -----------SIPLS---------EWQKSRDSVKTVKGVK---RYKQ--SQLLAVGNPT
A0A3R3CX96      -----------SIPLS---------EWQKSRDSVKTVKGIK---RYKQ--SQLLAVGNPT
A0A408NUV2      -----------TIPYS---------EEQAKIEQLQQKKRRQ--AMPLN--EALLAARNPA
A0A3R5LMR4      -----------TIPYS---------EDQAKIEQQQKKKRRQ--AMPLN--EALLAARNPA
A0A3R5Q2V2      -----------TIPYS---------GEQAKIEQQQKKKRRK--LMPLN--EALLAARNPA
A0A404B052      -----------TIPYS---------GEQAKIEQQQKKKRRQ--AMPLN--EALLAARNPA
A0A3R1PAA4      -----------TVPLS---------PWQQKRNRVQQQLLTK--HSSGK--LPILAQEEPE
A0A3R2C7H5      -----------TVPLS---------PWQQKRNRTQQQLLVK--NGGDK--LPILAKEEPG
A0A405AF34      -----------TVPLS---------PWQQKRNRTQQQLLVK--NGGDK--LPILAREEPG
A0A3R2D8P2      -----------SIPLS---------EWQQKQDRKFKLRKANNGSNAKS--TDLLAIGNPA
A0A3R2C102      -----------SIPLS---------EWQQKKDIETILRSSKK-SNTRS--KTLLAVGNPA
A0A3R2GYI6      -----------SIPLS---------EWQQKKDIEMANKRGRKISSTDS--VSLLAIGNPA
A0A3R2EM25      -----------SIPLS---------EWQQKSDRETMLSSKR--SSIKS--YTLLAVGNPA
A0A3R3FNT7      -----------SIPLS---------EWQQKSDRETMLSGKR--SSTKS--YTLLAVGNPA
S0DG33          VLLDRSFAARKSLPGLGGRSNLPFQRSAPDIDMRTGASAMSAAASYSGDNSRILAARFPH
A0A3R2V5T0      -----------YLPFIGERGVENAKAGTSAATPGGEHATLDESGQVSFQKMLRLAVDSPR
A0A405JUY6      -----------YLPRIAGAAREDA-PKPSAVPEQGEAANQPVGDPISFRRMMRVAVEAPR
A0A445V3X4      -----------VILDV---------SREEALDGEE---------------VALLMHRAPN
A0A445VBS2      -----------VILDV---------RHEESLDGEE---------------VALLMHRAPN
A0A407V607      -----------AVPTL---------AWHERRA------------------GELLVGTSQA
T0ZG59          -----------IIPL-------------ARAG------------------TPEQAMQDPR
A0A3R3TCJ4      -----------SVPLL---------MSIADRKDRHMP-------------PTEYLLARPL
A0A3R4EU13      -----------SVPLL---------MSIADRKDRHMP-------------PTEYLLARPL
A0A3B1AK25      -----------LLPKL---------DLKKHKTAS----------------PLSYAKGNKQ
A0A3R4E576      -----------MTPLV---------PNAASPAKSGVQQKPGLIQKTSP--LVTYVVEHPL
A0A404I461      -----------MTPLV---------PNAASPAKSGVQQKPGLIQKTSP--LVTYVVEHPL
A0A408J920      -----------NTPLI---------PNKPATE----APESGHPGLTLPTSVARYAVDHPL
A0A3R1N912      -----------NTPLI---------PNKPVEEILPKAQESG-PTATRPSSVARYAVDHPL
A0A405ZIS9      -----------NTPLI---------PNKPATE----APESGHPGLTLPTSVARYAVDHPL
A0A380TGM5      -----------HLPVA---------RSGR----------DG---------PEAAMLDSQP
A0A3P5W345      -----------HLPVA---------RSGR----------DG---------PEAAMLDSQP
A0A380TDI0      -----------HVPLL---------TAAK-------GGGDR---------PETFILKRPD
A0A380TDN3      -----------HVPLL---------TAAK-------GGGDR---------PETFILKRPD
A0A3P5WKD3      -----------HVPLL---------TAAK-------GGGDR---------PETFILKRPD
A0A3R2WIS1      -----------VVPLA---------LEQETILEHIAGGAKG---------VQLLAVTSPE
A0A3R5EJ70      -----------VVPLA---------LEQETILEHIAGGAKG---------VQLLAVTSPE
A0A3R3UIB9      -----------ILPLV---------KNKHR---------SQ---------IASLFSSNED
A0A409NVE8      -----------ILPLM---------KNRQR---------SQ---------IAHLFSSDED
A0A0F9U8M8      -----------MIPL----------------------SKNTAL-------DIRTFFDKEQ
A0A381Y0U7      -----------VIP---------------------------QN-------VGSLLEEGDE
A0A381Z3K5      -----------VIP---------------------------QN-------VGSLLEEGDE
A0A0F9UWR4      -----------IVPLV---------A-----------KKQQKK-------VSHLFEKGDD
A0A3R1X0V0      -----------VAPRL---------S-----------TKLGCE-------LWQLYSRELD
A0A0F9LFA5      -----------LLP-------------------HVQTPKNSVF-------PIHAYLDDNY
A0A1J5R1Y0      -----------TLPLL---------KDHDHIGRRYL--------------------ADPH
A0A160TC29      -----------IVPLI---------A-SGKRNKKIDPNKLDAT-------LVRAFVEGSD
A0A3R2TSB1      -----------TIALS---------TRQGTLDRAIRQGKPGVK-------LLAA--SHPD
A0A3R3XUC2      -----------TIALS---------TRQGTLDRAIRQGKPGVK-------LLAA--SHPD
A0A407WVH8      -----------TIALS---------TRQGTLDRAIRQGKPGVK-------LLAA--SHPD
A0A408G2L4      -----------SIPYS---------AL--QDEEDNKKGRARDGVDKPA--Y-LLALRNPT
A0A405APZ8      -----------SIPIS---------EM--QQKKDMLLIRGKSRQKQDG--L-LLAEANPA
A0A3R1LUZ7      -----------SVPIS---------DWLYKNSDNAGKLGINKAHHHKA--YGLLAVENPA
A0A3R2BGD8      -----------TVPLS---------PW--QQKRNRAQQQLLTKHGSGK--LPILAQEEPE
A0A3R2U6C3      -----------AIPYS---------DVQD------KLWRRSRRKNATV--PALLAQSQGN
A0A3R3W6C3      -----------AIPYS---------DMQD------KLWRRSRRKNATV--PALLAQSQGN
A0A407XAA6      -----------AIPYS---------DMQD------KLWRRSRRKNATV--PALLAQSQGN
A0A3R5H8M2      -----------TVPRS---------PVQE--------SRINILKKKKN--IPILAVKNSD
A0A3R2H5L1      -----------TVPRS---------PIQE--------SRVKILKKKKS--IPILAVKNSD
A0A3R1PLZ2      -----------TVPRS---------PIQE--------SRIKILKKKKS--IPILAVKNSD
A0A406JUR4      -----------TVPRS---------PIQE--------SRIKILKKKKS--IPILAVKNSD
A0A409MU65      -----------TVPRS---------PIQE--------SRIKILKKKKS--IPILAVKNSD
A0A3R2CMW0      -----------TVPRS---------PAQE--------SRIKLLKKKKS--IPILAIKNGD
A0A407T0V1      -----------TVPRS---------PVQE--------SRINILKKKKN--IPILAVKNSD
A0A0F9VQU4      -----------NVPQS---------SAQRKLNRALKRRGEKTS-KSVV--GGVLAQRDPM
A0A1W1DYN8      -----------NVALS---------AKQKLLNKDIITNKIKHA---------ILCEHDPQ
A0A1W1E4Z5      -----------NVALS---------AKQKLLNKDIITNKIKHA---------ILCEHDPQ
A0A3R1GLT3      -----------SIPVS---------PGQ---QSDSVRGKFR---ADGK--LHLLAVKDPA
A0A3R3DWA3      -----------AIPLS---------GSRSLLQTQKRRGRRKHGDASGQ--SHLLAKAEPA
A0A2H9T6C5      -----------TVPVS---------EQNR--LLERNSHKNGDS--------CLLACSAPD
A0A3R2W4Z8      -----------VVPLA---------LEQE--TILEHIAGGAKG-------VQLLAVTSPE
A0A3R5D942      -----------VVPLA---------LEQE--TILEHIAGGAKG-------VQLLAVTSPE
A0A0F9KY21      -----------SVPHS---------DHQD--KLSGFAERARKNKTNKP--KSILALDNPA
A0A404TF61      -----------SIPFS---------SLQK--SEESKILRSGRGRANKV--APILASSHPT
A0A406MXU2      -----------SIPFS---------TLQK--TEESKTFRSGRGRANNT--APILASSHPT
A0A3R4Q9I0      -----------SIPLS---------KGQS--QIEG-TLKGSNR-ASTG--SLLLAVNNPA
A0A407TZB0      -----------SIPLS---------KGQS--QIEG-TLKGSNR-ASTG--SLLLAVNNPA
A0A0F9W5Q6      -----------AVPFS---------KDQQ--ILERGSKTKGNI---QG--SHLLAATNPA
A0A404IBN2      -----------SIPFS---------TLQK--TEESKTFRSGRGRANNT--APILASSHPT
A0A406Y387      -----------SIPFS---------TLQK--TEESKTFRSGRGRANNA--APILASSHPT
A0A3R1X9G0      -----------SVPYS---------LLQK--TEEQKKSRTPNR-TGKA--PSLLAIHHPT
A0A3R3ZKH7      -----------SVPYS---------LLQK--TEEQKKPRTPNR-TGKA--PSLLAIHHPT
A0A3R2WMV4      -----------SIPYS---------VLQQ--EEDSKKLRLANG-VNSQ--SFLLAQRNPT
A0A3R3BQL7      -----------SIPYS---------VLQQ--EEDSKKLRLANG-VNSQ--SFLLAQRNPT
A0A3R4AM40      -----------SIPYS---------VLQQ--EEDSKKLRLANG-VNSQ--SFLLAQRNPT
A0A3R2HMB7      -----------SIPYS---------VLQQ--EEDSKKLRLANG-VNSQ--SFLLAQRNPT
A0A3R4QTV3      -----------SIPYS---------VLQQ--EEDSKKLRLANG-VNSQ--SFLLAQRNPT
A0A3R4YGM2      -----------SIPYS---------ALQD--EEDNKKGRARDG-VDKP--AYLLALRNPT
A0A3R1WG16      -----------SIPYS---------ALQQ--EEDSKKVRAKDG-TDKP--AYLLALRNPT
A0A3R3R2K7      -----------SIPYS---------ALQQ--EEDSKKVRAKDG-TDKP--AYLLALRNPT
A0A3R3TSL3      -----------SIPYS---------ALQQ--EEDSKKVRAKDG-TDKP--AYLLALRNPT
A0A3B0VME9      -----------LIPFK-----------------D--AG----KTDDEFDEIALTFYNEPK
A0A3B1DSR1      -----------AIPEF-----------------APIATKELKQIDSHKIAPELYYFHKPG
A0A0F9I1G8      -----------VVPLA-----------------K--SG---------DYVLDKAFVSEPR
J9FGR8          -----------EIPFT-----------------G--DK----KKKKDASQHTILVKEGSR
A0A0W8FS74      -----------VIPFI-----------------T--SR---AENGEAKKRLPLITRLEPK
A0A3B0V744      -----------AVPKH-----------------N--LN---------GKVAKIIVDKHPK
A0A405V7W6      -----------NIPLL-----------------K--ES---------SEFSQLMIHNNPK
A0A1W1D4H7      -----------VIPYN-----------------K--DE-------------------STE
A0A3B1CUQ0      -----------HIPLV-----------------Q--AEETKKPLSGGNSNSGLITINSTK
A0A1W1BK27      -----------SLPNK-----------------K--HK----------------------
A0A1W1CD04      -----------SLPPL-----------------K--NE----------------------
                                                                            

A0A3B1C250      SPFAESVNHIRTSVMFSNI---DNP-PKIIMITSAMPSEGKSTLATNMALAYSNLG--KT
A0A1J5RCY3      SHRAESFRRLRTNLQFIDV---AEQ-PKTIVVTSSLPGEGKTTTSINLAITLADAG-ARV
A0A1J5RUE5      SRRAEGFRRLQANLQYLDV---GKP-LSSVVVTSAVPGEGKSTTALNLALAVAENG-KSV
A0A0F9JKD8      SSFAENYKALRTAIMLSSA---EST-PKTLLITSMGPAEGKTATAVNLALVVAQSV-GKV
A0A0F9XPI6      SVLAESFRILATNINYMLPKRKDGS-GNVIFVTSGYMGEGKSLLAYNLSVAYASIN-KKV
A0A2H9TBF4      RAFVESVRTIRTGLNLSLMSVGQEAHKKIIAITSTMPGEGKSSVAANLSSALGQLG-S-V
A0A3R2R3E8      SILAESMRNIRTNLSFVNS---DVR---VIAISSSISGEGKTFVALNLAGIIALSG-KRT
A0A1J5SM24      RQVAESFLTLHSSLRLKDE---SKN-AKVFLTTSTIPGEGKSFMTTNLALTFASHG-ERV
A0A3B1C7A9      SIYSEAFRVLRTRIQFSKL---NNGGVKVIHITSSTPQEGKTTIAINVAGSFAQTN-KRT
A0A1J5SPZ5      NPGQESFLSVYSSVKIQSK---LDF-PKSILVTSTIPGEGKTLVSCNLAGAFARHG-RNT
A0A409NWS0      DLAIEAVRSLRTSLHFAMM---QAK-NNVLMMTGVSPSIGKTFVCANLAAVVSQTN-KRV
A0A3R1PE73      DLAIEAVRSLRTSLHFAMM---QAK-NNVLMMTGVSPSIGKTFVCANLAAVVSQTN-KRV
A0A3R3CX96      DLAIEAVRSLRTSLHFAMM---QAK-NNVLMLTGVSPSIGKTFVCANLAAVISQTN-KRV
A0A408NUV2      DLAMESLRSLRTSLHFAMM---EAK-NNIVMISGPGPGLGKTFVSTNFAATLAMGG-KKV
A0A3R5LMR4      DLAMESLRSLRTSLHFAMM---EAK-NNIVMISGPGPGLGKTFVSTNFAATLAMGG-KKV
A0A3R5Q2V2      DLAMESLRSLRTSLHFAMM---EAK-NNIVMISGPGPGLGKTFVSTNFAATLAMGG-KKV
A0A404B052      DLAMESLRSLRTSLHFAMM---EAK-NNIVMISGPGPGLGKTFVSTNFAATLAMGG-KKV
A0A3R1PAA4      DLSVEAIRSLRTSLHFAMM---EAK-NNILMVSGASPASGKSFTSTNLAVVIAQAG-QRV
A0A3R2C7H5      DLSVEAIRSLRTSLHFAMM---EAK-NNILMVSGASPASGKSFTSTNLAVVIAEAG-QRV
A0A405AF34      DLSVEAIRSLRTSLHFAMM---EAK-NNILMVSGASPASGKSFTSTNLAVVIAEAG-QRV
A0A3R2D8P2      DLAIESIRSLRTSLHFASL---EAK-NNILMISGASPSIGKTFVSVNLAAVIAQAG-QRV
A0A3R2C102      DLAIEAVRSLRTSLHFAML---ESK-NNVLMICGASPNIGKTFVSINLAAVIAQAG-QRV
A0A3R2GYI6      DLAIEAIRSLRTSLHFAMM---EAN-NNVLMISGASPNIGKTFVSINLAAVIAQTG-QRV
A0A3R2EM25      DLAIEAVRSLRTSLHFASL---EAK-NNVLMISGASPSIGKTFVSINLAAVIAQAG-QRI
A0A3R3FNT7      DLAIEAVRSLRTSLHFASL---EAK-NNVLMISGASPSIGKTFVSINLAAVIAQAG-QRI
S0DG33          DTSVEALRAVRTAVTRDLA---HAR-NNILMVIGPTPSAGKSFVAANLAILHAEIG-SRV
A0A3R2V5T0      SSFAETLRNVKLTADVVIQ---ERQ-CRVIGVISCLPNEGKSVVALNLAGLIASTG-KRT
A0A405JUY6      SQFAETLRNTKLACDIVLQ---GKK-CAVIGVVSCLPGEGKSTVAANFAGLIASSG-ART
A0A445V3X4      STLAEAYRSIRTGLLFSTP---NGA-PKILHFTSSVPIEGKTTSSVSVATAFVQAG-KVV
A0A445VBS2      SILAEAYRSIRTGLLFSTP---NGA-PKILHFTSSVPIEGKTTSSVSVATAFVQAG-KVV
A0A407V607      PHYVEAIKTLALTLEEHHG---AAT-GSVIGLSSTTAREGKSVTLANLALALSEAG-HRV
T0ZG59          SALAEAYRSARTALQFATA---DGV-PRSLLITSTRPGEGKSTTALALAQSFAQMG-RRV
A0A3R3TCJ4      SGFAEAFRSLRTSILYARL---GQA-VKVVTVTSALPGEGKTTTSVCLAISAAQAG-SRV
A0A3R4EU13      SGFAEAFRSLRTSILYARL---GQA-VKVVTVTSALPGEGKTTTSVCLAISAAQAG-SRV
A0A3B1AK25      SFFSESIRTIRTAMLLSGL---DDP-YKVILVTSSVPGEGKSAVATTLAESMGEL--HKV
A0A3R4E576      SPFAETLRSAKIAADLRFS---DKP-CKVIGIVSSLPAEGKSAISINFAELLARQG-SKT
A0A404I461      SPFAETLRSAKIAADLRFS---DKP-CKVIGIVSSLPAEGKSAISINFAELLARQG-SKT
A0A408J920      SSFAETLRSTRLAIDLGIS---AKSGARIVGVVSALPSEGKSTISINLAQLLAGQG-ARV
A0A3R1N912      SSFAETLRSTRLALDLGIP---AKSGARVVGVVSALPSEGKSTISINLAQLLAGQG-ARV
A0A405ZIS9      SSFAETLRSTRLAIDLGIS---AKSGARIVGVVSALPSEGKSTISINLAQLLAGQG-ARV
A0A380TGM5      SLFLEGIRSTYIQLALRSK---RPA-IRSLLVTSSMPKEGKTTLAIGLTRARAIAG-HRA
A0A3P5W345      SLFLEGIRSTYIQLALRSK---RPA-IRSLLVTSSMPKEGKTTLAIGLTRARAIAG-HRA
A0A380TDI0      SAYAEAIRSLRTRLLLAFG---DRP-PQVVVLTSAEPDEGKSTLGLSLVRAQAQAD-RRT
A0A380TDN3      SAYAEAIRSLRTRLLLAFG---DRP-PQVLVLTSAEPDEGKSTLGLSLVRAQAQAD-RRT
A0A3P5WKD3      SAYAEAIRSLRTRLLLAFG---DRP-PQVLVLTSAEPDEGKSTLGLSLVRAQAQAD-RRT
A0A3R2WIS1      SLAIESLRNLRVSLQLTLM---ESG-NNRVLITGATPGVGKSFVSGNFAVIMAQAG-KRV
A0A3R5EJ70      SLAIESLRNLRVSLQLTLM---ESG-NNRVLITGATPGVGKSFVSGNFAVIMAQAG-KRV
A0A3R3UIB9      KSFSESIRTIRTSLVLSGM---SDP-HRILVVTSSIPGEGKSTVAANLAYAFGQM--EKV
A0A409NVE8      KSFSESIRTIRTALVLSGM---SGP-HRILVVTSSLPGEGKSTVAANLAYAFGQM--ERV
A0A0F9U8M8      QQFSEAVRTLRTGVVLSQM---DAENNKVIEVTSSIPGEGKTTTSINLAFSLGQI--EKV
A0A381Y0U7      SPHAEAYRVLRTNILFAGR---KSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQG-DRI
A0A381Z3K5      SPHAEAYRVLRTNILFAGR---KSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQG-DRI
A0A0F9UWR4      MRFCEAVRTIRTSVMLADM---SRPQKVIV-ITSSVPGEGKSSVAANMAFALGQL--QRV
A0A3R1X0V0      RRFSESIRTMRTGIVLSDL---KQPHKVLL-VTSSIPGEGKTTVSTNLACALGQM--EKV
A0A0F9LFA5      RRFAESVRTFRTSLLLTQL---ERDHKVIA-VTSSSPGEGKTTTSANLAMSLAQM--GKV
A0A1J5R1Y0      SQFAEAVRTARTGVLLSAI---DQPHKIVV-VTSSLPGEGKTTFAANLALAHAQT--KRV
A0A160TC29      HGFQESIRTLRTSLTLASL---ENKAQVML-FTSSVPGEGKTTTSTNLAEAFGQM--EKV
A0A3R2TSB1      DPALEGVRRLRTALGFLMA---GAQNNRIL-LTSATPGAGKTFLSANFSAVLAASG-RRV
A0A3R3XUC2      DPALEGVRRLRTALGFLMA---GAQNNRIL-LTSATPGAGKTFLSANFSAVLAASG-RRV
A0A407WVH8      DPALEGVRRLRTALGFLMA---GAQNNRIL-LTSATPGAGKTFLSANFSAVLAASG-RRV
A0A408G2L4      DLSIESIRSLRTCLHFAGL---DST-NNRIMISGPSPQVGKTFVSSNLAAVMALSG-QRV
A0A405APZ8      DLAIEAIRSLRTSLHFAML---EAK-NKVVMISGASPEIGKTFVCANLAAVIAQSG-ERV
A0A3R1LUZ7      DLAIEAIRSLRTSLHFAML---DAV-NNVLMISGASPNAGKTFVSSNLAAVMAQGD-RKV
A0A3R2BGD8      DLSVEAIRSLRTSLHFAMM---EAK-NNILMVSGASPASGKSFTSTNLAVVIAQAG-QRV
A0A3R2U6C3      SPPIESLRSFRNVLQASLR---QSA-NNMVMFTGPVAGVGKSFLSANFAFIQGGVG-KRV
A0A3R3W6C3      SPPIESLRSFRNVLQASLR---QSA-NNMVMFTGPVAGVGKSFLSANFAFIQGGVG-KRV
A0A407XAA6      SPPIESLRSFRNVLQASLR---QSA-NNMVMFTGPVAGVGKSFLSANFAFIQGGVG-KRV
A0A3R5H8M2      DIAIESLRSMRTAIHFALS---SAR-NNLITISGPAPEVGKSFISTNLATILAQSD-KRV
A0A3R2H5L1      DIAIESLRSIRTAIHFALT---SAK-NNIIMIAGPSPEVGKSFISTNLATIFAQGD-KRV
A0A3R1PLZ2      DIAIESLRSIRTAIHFALT---SAK-NNIIMIAGPSPEVGKSFISTNLATIFAQGN-KRV
A0A406JUR4      DIAIESLRSIRTAIHFALT---SAK-NNIIMIAGPSPEVGKSFISTNLATIFAQGN-KRV
A0A409MU65      DIAIESLRSIRTAIHFALA---SAK-NNIIMIAGPSPEVGKSFISTNLATIFAQGD-KRV
A0A3R2CMW0      DIAIESLRSMRTAIHFALN---NAK-NNIIMISGPAPEVGKSFISTNLAAILAQSN-KRV
A0A407T0V1      DIAIESLRSMRTAIHFALS---SAR-NNLITISGPAPEVGKSFISTNLATILAQSD-KRV
A0A0F9VQU4      DLSLESLRGLRTSLHFTMM---DGR-NNRVMLTGPSPGVGKSFVSVNLGAISALAG-KKV
A0A1W1DYN8      DSAIEGLRSLRTNLHFALL---EAK-NNIVMVTGPSPDIGKSFVSINFAHTIAQAG-QKV
A0A1W1E4Z5      DSAIEGLRSLRTNLHFALL---EAK-NNIVMVTGPSPDIGKSFVSINFAHTIAQAG-QKV
A0A3R1GLT3      DLAVEAVRSLRTSLHFARL---EAK-NNIVLISGSSPNAGKTFVSSNLAAVIAQAG-QRV
A0A3R3DWA3      DLAVEALRSLRTSLHFAMM---EAK-NNVLAISGPRPGVGKTFVAANLATVIAQGG-QRV
A0A2H9T6C5      DLAVESLRSLRTNLAFAMM---EEK-DSRIMITGSSPTVGKSFVSANLALLLAESG-KKV
A0A3R2W4Z8      SLAIESLRNLRVSLQLTLM---ETG-NNRVLITGATPGVGKSFVSGNFAVIMAQAG-KRV
A0A3R5D942      SLAIESLRNLRVSLQLTLM---ESG-NNRVLITGATPGVGKSFVSGNFAVIMAQAG-KRV
A0A0F9KY21      DLAIEALRSLRTSLHFAMI---EAK-NNIIAISGPSPSVGKSFISVNLASVLAQSG-KKV
A0A404TF61      DLAIEGLRSLRTSLHFAML---EAS-NNRLMISGPSPKVGKTFVSANLAAVIAQTG-QRV
A0A406MXU2      DLAIEGLRSLRTSLHFAML---EAS-NNRLMISGPSPKVGKTFVSANLAAVIAQTG-QRV
A0A3R4Q9I0      DLAVESLRSLRTSLHFATL---EAK-NNILMISGPSPAVGKSFVSSNLAAIIAQTG-QKV
A0A407TZB0      DLAVESLRSLRTSLHFATL---EAK-NNILMISGPSPAVGKSFVSSNLAAIIAQTG-QKV
A0A0F9W5Q6      DLSIEALRSLRTSLHFAMM---EAK-NNILMISGPSPSVGKSFISANLAAIVAQTG-QKV
A0A404IBN2      DLAIEGLRSLRTSLHFAML---EAS-NNRLMISGPSPKVGKTFVSANLAAVIAQTG-QRV
A0A406Y387      DLAIEGLRSLRTSLHFAML---EAS-NNRLMISGPSPKVGKTFVSANLAAVIAQTG-QRV
A0A3R1X9G0      DLSIEALRSLRTSLHFGML---DAK-NNLLMISGPSPGVGKTFISANLAAVVAQAG-QRV
A0A3R3ZKH7      DLSIEALRSLRTSLHFGML---DAK-NNLLMISGPSPGVGKTFISANLAAVVAQAG-QRV
A0A3R2WMV4      DLSIESIRSLRTCLHFAGL---DAT-NNRIMISGPSPQVGKTFVSSNLAAVIAQSG-QRV
A0A3R3BQL7      DLSIESIRSLRTCLHFAGL---DAT-NNRIMISGPSPQVGKTFVSSNLAAVIAQSG-QRV
A0A3R4AM40      DLSIESIRSLRTCLHFAGL---DAT-NNRIMISGPSPQVGKTFVSSNLAAVIAQSG-QRV
A0A3R2HMB7      DLSIESIRSLRTCLHFAGL---DAT-NNRIMISGPSPQVGKTFVSSNLAAVIAQSG-QRV
A0A3R4QTV3      DLSIESIRSLRTCLHFAGL---DAT-NNRIMISGPSPQVGKTFVSSNLAAVIAQSG-QRV
A0A3R4YGM2      DLSIESIRSLRTCLHFAGL---DST-NNRIMISGPSPQVGKTFVSSNLAAVMALSG-QRV
A0A3R1WG16      DLSIESIRSLRTCLHFAGL---DST-NNRIMISGPSPQVGKTFVSSNLAAVMALSG-QRV
A0A3R3R2K7      DLSIESIRSLRTCLHFAGL---DST-NNRIMISGPSPQVGKTFVSSNLAAVMALSG-QRV
A0A3R3TSL3      DLSIESIRSLRTCLHFAGL---DST-NNRIMISGPSPQVGKTFVSSNLAAVMALSG-QRV
A0A3B0VME9      APLSEAIRTAMVAINLSTA---ATP-PKTVLITSVLPDAGKSTLASNLSLSLLASS-AKV
A0A3B1DSR1      SIEAESFRSVRTALYVIAA---SDK-AQVIQVTSPLSGDGKTTLIGNLAVAMANSG-KSV
A0A0F9I1G8      APISEAIRTTKVSLQLSGA---DAL-SKCFMITSTAPEEGKTTLAANLAFAFAGSE-EKV
J9FGR8          DMLNEAFRVMRSNLDFMSG---DTTQSQVFITTSFNPGSGKSFLTINMGMSFVLKG-KKV
A0A0W8FS74      SQVAEAFRSLRTSLHFSAI---NRD-KKIILITSTFPGEGKSIITANLSNTMAQTG-VKV
A0A3B0V744      SAVSEALRSIRTNIEFMIP---DKD-SKVLSVTSTIGSEGKTFISTNLGALLAMAG-KKT
A0A405V7W6      SILAESMRNIRTNLSFVNS---N---ARVIAISSSISGEGKTFVALNLAGIIALSG-KKT
A0A1W1D4H7      NTYKEAFRNLRTNLQFLPE---SKN-HKIISITSSISGEGKTTISTTLGEMLAKGD-KKV
A0A3B1CUQ0      SITAESFRSLRTNLQFAVP---EKR-GRVFHFTSTMQGEGKTTITANLGVTLALMG-SRT
A0A1W1BK27      RFFEEAMRVIRTNLQFIIP---KDKQCISILVSSTVPGEGKTTVIANLAHIIAQSNQKRV
A0A1W1CD04      RFFKEALRSIRTNLQFVIS---KNG-CTKILISSTVPQEGKTTISAGLAKIISEAD-KKV
                    *                            .     **:     .            

A0A3B1C250      LLIDADLRKHSLTEFLDS--NSNGLGLTDLVSGQNTF--QDCIRRLKLS------KNLYI
A0A1J5RCY3      VLVDADLRRPSVAEYMGL--E-GSVGLTTVLIGRAAV--LDVVQPWGNG------Q-LHV
A0A1J5RUE5      LVIDADLRRPAIALDTGL--E-AAAGLTTILIGRATL--EDVVQPWGEH------DGLHV
A0A0F9JKD8      LLVDTDLRKPRIHNIFGF--S-NKSGLSTYLVGSN----AKIIKEGP-S------PNINI
A0A0F9XPI6      LLIDADLRSPEQHKYFKM--DRNTKGLTDYLKEEEINWKSFIFSGLEKS------KNHHV
A0A2H9TBF4      VLVDGDLRRPTVGKNFSI--KGGSAGLANLLSGHAQM--NECLHPR---------NSIMV
A0A3R2R3E8      IVIDLDLRKPKVHLGLNV--P-NEKGISNLIIKQVTL--EECIRKSE-I------ENLDF
A0A1J5SM24      LVVDCDLRKPNIHKSFRL--E-NLKGVIDVVTGTAKL--DDVIVKGV-Y------PNLDV
A0A3B1C7A9      IIVDCDLRKPRVHTVFKE--Q-RFPGFTDYFLGHTDL--ESVIHKSK-L------PNLDF
A0A1J5SPZ5      LLIDCDLRRPMLHRHYKQ--A-NNNGLISWYENGADL--ESDLLGNPHLGIVKIGENLSL
A0A409NWS0      LLIDCDMRKGYTHELLGT--N-NVNGLSEILLGKEEI--EQCAKPTS-I------TNFDL
A0A3R1PE73      LLIDCDMRKGYTHELLGT--N-NVNGLSEILLGKGEI--EQCAKPTS-I------TNFDL
A0A3R3CX96      LLIDCDMRKGYTHELLGT--N-NVNGLSEILLGKGEI--SQSAKPTS-I------TNFDL
A0A408NUV2      LVIDADLRKGYMQKVMGQ--E-MGAGLSAYLAGQTEM--MQVISKTG-F------DGLDF
A0A3R5LMR4      LVIDADLRKGYMQKVMGQ--E-MGAGLSAYLAGQTEM--MQVISKTG-F------DGLDF
A0A3R5Q2V2      LVIDADLRKGYMQKVMGQ--E-MGAGLSAYLAGQTEM--MQVISKTG-F------DGLDF
A0A404B052      LVIDADMRKGYMQKVMGQ--E-MGAGLSAYLAGQTEM--MQVISKTG-F------DGLDF
A0A3R1PAA4      LLIDADMRKGFLHRWLNN--S-AKAGLSDMLSGLIAP--EMAVKKTD-I------ANLDF
A0A3R2C7H5      LLIDADMRKGFLHRWFSN--G-AKGGLSDMLSGLIAP--DQSVKKTA-I------ANLDF
A0A405AF34      LLIDADMRKGFLHRWFNN--S-ARGGLSDMLSGLIAP--DQSVKKTA-I------ANLDF
A0A3R2D8P2      ILIDCDMRRGYTHLQMQT--S-VESGLSDVLSEQVSL--DKCIKRTK-V------ENLDF
A0A3R2C102      LVIDADMRKGYSHTLLNT--N-WQNGLSDILSQQVSK--EAAVRKTE-I------ENLDF
A0A3R2GYI6      LVIDADMRKGYSHILVGT--E-WNNGLSDFLSGKITQ--EQAIHQTK-V------EGMDF
A0A3R2EM25      LVVDADMRKGYAHSLLNC--E-LGIGLSDVLSGQASA--QQAVRKTS-I------ENLSF
A0A3R3FNT7      LVVDADMRKGYAHSLLNC--E-LGLGLSDVLSGQATA--QQAIKKTS-I------ENLSF
S0DG33          VLIDADMRRGHLASLFDE--S-NRGGLSEVLSERMAL--RNALRTTG-V------DGLTF
A0A3R2V5T0      LVVDADIRNPGLSRMLTT--R-QSAGLVEVVLDEIPW--TQAVKVDT-R------TKMGI
A0A405JUY6      LVIDADLRNPGLSKMLAS--E-PEVGLVDVILNKASW--TSVARVDR-R------SRLTI
A0A445V3X4      LLVDADLRNPSLHKIFEI--SHDEHGLSSYLTGDLKP--QEITYSSE-I------EQLFV
A0A445VBS2      LLVDADLRNPSLHKIFEI--DHGEHGLSSYLTGDLKP--QEITYSTE-I------AQLFV
A0A407V607      LLVDSDFRRPRVGALFGF--E-GERGLSDVLMEQATP--AE-VVRRA--------GSIDV
T0ZG59          LLVDADMRNPAQHNLGTV--D-NSRGLSNVLAGALTW--REAVVGGE--------NGPAL
A0A3R3TCJ4      VVVDCDIRRRNVSRLLGV--T-AEKGLLDVLDGSAPL--NQAVLQDE-T------SGAWI
A0A3R4EU13      VVVDCDIRRRNVSRLLGV--T-AEKGLLDVLDGSAPL--NQAVLQDE-T------SGAWI
A0A3B1AK25      LLIDADMRRPTIAKTWDF--DPRSPGLSEFIAESAQL--SECVYQIQ-D------SNVHI
A0A3R4E576      LLIDADLRNPGTTRAIAR--H-ADAGLLEALLDGQDL--DRLLLSDD-A------TGLSV
A0A404I461      LLIDADLRNPGTTRAIAR--H-ADAGLLEALLDGQDL--DRLLLSDD-A------TGLSV
A0A408J920      LLLDADIRNPGATRAMAR--H-ASEGLLEVLLEGRSV--QDVLLRDE-K------TRLAF
A0A3R1N912      LLLDADIRNPGATRALGR--H-AGEGLLEVLLEGRNV--RDVLLHDE-K------TGLAF
A0A405ZIS9      LLLDADIRNPGATRAMAR--H-ASEGLLEVLLEGRSV--QDVLLRDE-K------TRLAF
A0A380TGM5      LLIDADLRRPSVHVRLKL--A-REPGLVDLLVGDASL--EQVLQRDE-P------TGAFV
A0A3P5W345      LLIDADLRRPSVHVRLKL--A-REPGLVDLLVGDASL--EQVLQRDE-P------TGAFV
A0A380TDI0      LLIDADFRRSRLTTRITG--ISAQPGLYEVLSGQATA--EDAIQSDP-T------SLADL
A0A380TDN3      LLIDADFRRSRLTTRIPG--ISAQPGLYEVLSGQATA--ADAIQSDP-A------SLADL
A0A3P5WKD3      LLIDADFRRSRLTTRIPG--ISAQPGLYEVLSGQATA--ADAIQSDP-A------SLADL
A0A3R2WIS1      LLIDADLRKGHLQKAFGL--P-RKGGLADVLAGDMSP--EQAIHGQV-I------PNLDV
A0A3R5EJ70      LLIDADLRKGHLQKAFGL--P-RKGGLADVLAGDMSP--EQAIHGQV-I------PNLDV
A0A3R3UIB9      LLVDADLRRPTLAKNFKF--PVGTPGLANLIAGTAKV--DECI--KT-I------EGIDM
A0A409NVE8      LLVDADLRRPTLAKNFKF--PVGTPGLANLIAGTAKV--DDCI--KT-I------EGIDM
A0A0F9U8M8      LLIDADMRKPSICKRFDM--PTYHPGLSNFIAGTDTL--ENCLYQDE-Q------SGITV
A0A381Y0U7      LIVDSDLRRPSMHRYLKV--SNNI-GLTNYLLGQVAI--DEVIQTTE-L------PSLHF
A0A381Z3K5      LIVDSDLRRPSMHRYLKV--SNNI-GLTNYLLGQVAI--DEVIQTTE-L------PSLHF
A0A0F9UWR4      LLIDADLRRPTLARNFDF--PVGTPGLANLIAGTAKV--EDCIQ-TV-D------AQLDM
A0A3R1X0V0      LLIDADLRRPMLAKHFQL--PIGSPGLANLLAGTASL--DDCIQ-QA-D------G-VDV
A0A0F9LFA5      LLIDADLRKPSIAKRFDI--PVFHPGLSNLIVGTEQL--SECIHVDV-Q------SGVTI
A0A1J5R1Y0      LLIDADMRKPRLGRELGL--DDDLVGLSSLASGEREA--KDCMRSVP-E------STLQV
A0A160TC29      VLIDADMRRPTVARKLNM--PPNSRGLSNAVAYPETL--DDCIHHVA-D------LGIDV
A0A3R2TSB1      LLIDADMRRGKLASQFGL--KATT-GLSELIAGTATL--AQAVHAQV-L------PHLDV
A0A3R3XUC2      LLIDADMRRGKLASQFGL--KATT-GLSELIAGTATL--AQAVHAQV-L------PHLDV
A0A407WVH8      LLIDADMRRGKLASQFGL--KATT-GLSELIAGTATL--AQAVHAQV-L------PHLDV
A0A408G2L4      VLIDADMRKGHLHKTLNT--P-ITNGLSDLLVKRCSI--DQAIHKVE-I------DNLHF
A0A405APZ8      LLIDADMRRGRLHEVLSN--D-NQLGLSAVLSGQTTL--DKAISKTE-V------ANLDF
A0A3R1LUZ7      IFIDADLRKGYAHKIFGL--P-NDIGLSEYLSGSADI--KRVVKRVD-S------GQFDF
A0A3R2BGD8      LLIDADMRKGFLHRWLNN--S-AKAGLSDMLSGLIAP--DQAVKKTD-I------VNLDF
A0A3R2U6C3      LLIDADFRKGQLNRYFGL--P-KEDGLFEVLSGTIPL--NRVRKHSV-S------EGVDF
A0A3R3W6C3      LLIDADFRKGQLNRYFGV--P-KEDGLFEVLSGTIPL--TRVRKHSV-S------EGVDF
A0A407XAA6      LLIDADFRKGQLNRYFGV--P-KEDGLFEVLSGTIPL--TRVRKHSV-S------EGVDF
A0A3R5H8M2      LIMDADLRRGYLHKYFNL--D-TQPGLTELLNGQQSL--ETVIRHTE-V------PGLSV
A0A3R2H5L1      LLIDADMRRGYMHKYFDV--D-VKPGLSELLSGQADL--QKVLHKTQ-V------ANLDV
A0A3R1PLZ2      LLIDADMRRGYMHKYFDV--D-VKPGLSELLSGQADL--QKVLHKTQ-V------ANLDV
A0A406JUR4      LLIDADMRRGYMHKYFDV--D-VKPGLSELLSGQADL--QKVLHKTQ-V------ANLDV
A0A409MU65      LLIDADMRRGYMHKYFDV--D-VKPGLSELLSGQADL--QKVLHKTQ-V------ANLDV
A0A3R2CMW0      LIIDADMRRGYLHKYFNH--D-NLPGLAEYLNTQQTL--DSIIKPTE-I------PHLDV
A0A407T0V1      LIIDADLRRGYLHKYFNL--D-TQPGLTELLNGQQSL--ETVIRHTE-V------PGLSV
A0A0F9VQU4      LIVDADLRKGNLHHAFGQ--A-STGGLVEFLSGELTL--EDIIKPTG-I------PHYDV
A0A1W1DYN8      LLIDADMRKGHIHKEYNL--S-RSPGLSELITNQVDK--KVAVHNSE-F------KNIDI
A0A1W1E4Z5      LLIDADMRKGHIHKEYNL--S-RSPGLSELITNQVDK--KVAVHNSE-F------KNIDI
A0A3R1GLT3      LIIDADMRKGTLHKALGA--T-QTPGLSDVLVGKTSL--DDAIRAVPGL------DNLSF
A0A3R3DWA3      LIIDVDMRKGTVHKVLGV--E-LAKGLSDVLAGTARV--EDVISAVPGL------AKMHY
A0A2H9T6C5      LLIDADMRKGRLHHYFAV--H-RGKGLSDILAGNADS--SAI--RGI-N------EKCHL
A0A3R2W4Z8      LLIDADLRKGHLQKAFGL--P-RKGGLADVLSGEMTP--EQAIHAQV-V------PNLDV
A0A3R5D942      LLIDADLRKGHLQKAFGL--P-RKGGLAEILAGDLTP--EQATHVQV-I------PNLDV
A0A0F9KY21      LIIDADMRKGYLQTQFGL--K-WDDGLSDYLSGRLNL--EQVTKPTK-V------EGLSV
A0A404TF61      LLIDVDMRKGYLHKVFGT--P-AENGLSDLLVKRCDL--ATAINKTE-F------EHLDV
A0A406MXU2      LLIDVDMRKGYLHKVFGT--P-AENGLSDLLVKRCDL--ATAINKTE-F------EHLDV
A0A3R4Q9I0      LLVDADMRKGYLNKMFRM--D-VNSGLSDLLAGKIDL--NKATHSTE-V------DNLHV
A0A407TZB0      LLVDADMRKGYLNKMFRM--D-VNSGLSDLLAGKIDL--NKATHSTE-V------DNLHV
A0A0F9W5Q6      VLLDGDMRKGYVHKLLNR--E-PEPGLSNMLVSTHAL--ADIVHKTE-V------ENLHF
A0A404IBN2      LLIDVDMRKGYLHKVFGT--P-AENGLSDLLVKRCDL--ATAINKTE-F------EHLDV
A0A406Y387      LLIDVDMRKGYLHKVFGT--P-AENGLSDLLVKRCDL--ATAINKTE-F------EHLDV
A0A3R1X9G0      LLIDVDMRRGYLHDLLGV--P-YKNGVSDILVNRCDV--ATAIHKTE-I------EGFDF
A0A3R3ZKH7      LLIDVDMRRGYLHDLLGV--P-YKNGVSDILVNRCDV--ATAIHKTE-I------EGFDF
A0A3R2WMV4      VLIDADMRKGHLHKSLAT--P-ISNGLSDLLTKRCSI--EQAINKLE-V------DNLHF
A0A3R3BQL7      VLIDADMRKGHLHKSLAT--P-ISNGLSDLLTKRCSI--EQAINKLE-V------DNLHF
A0A3R4AM40      VLIDADMRKGHLHKSLAT--P-ISNGLSDLLTKRCSI--EQAINKLE-V------DNLHF
A0A3R2HMB7      VLIDADMRKGHLHKSLAT--P-ISNGLSDLLTKRCSI--EQAINKLE-V------DNLHF
A0A3R4QTV3      VLIDADMRKGHLHKSLAT--P-ISNGLSDLLTKRCSI--EQAINKLE-V------DNLHF
A0A3R4YGM2      VLIDADMRKGHLHKTLNT--P-ITNGLSDLLVKRCSI--DQAIHKVE-I------DNLHF
A0A3R1WG16      VLIDADMRKGHLHKTLDT--P-ITNGLSDLLVKRCSI--EQAINKVE-I------DNLHF
A0A3R3R2K7      VLIDADMRKGHLHKTLDT--P-ITNGLSDLLVKRCSI--EQAINKVE-I------DNLHF
A0A3R3TSL3      VLIDADMRKGHLHKTLDT--P-ITNGLSDLLVKRCSI--EQAINKVE-I------DNLHF
A0A3B0VME9      LLIDTDLRKPGLHKIFGQ--KDNSIGLSSFLAGTADI--DEVIMKTE-F------PNLFF
A0A3B1DSR1      LLIDADMRHRSVHLLFGL--RHNI-GVSDVLTGEIEF--LNAVQKTG-F------KNLSA
A0A0F9I1G8      LLMDADLRKPHLHKIFTQWSDGTRPGLSSYLAGVID---KNLIQKTD-I------DNLWF
J9FGR8          MLIDGDMRHGSLSAYAGS--PKK--GLSNYLSGQAATWQEVTVDHPH-N------PNLKL
A0A0W8FS74      LVVDCDLRRSSLHDKFGV--NKVP-GLSEVLTGDTTF--REVLHDTG-I------PGIDV
A0A3B0V744      VIVDLDLRKPKIHLAFEQ--KENANGVSSILIGKGKI--EECIQNST-I------QNLDF
A0A405V7W6      IVIDLDLRKPKVHLGLNV--TNDK-GISNLIIKQATL--DECIRTSE-I------ETLDF
A0A1W1D4H7      ILLDLDLRKSSFHTEFEV--KNDV-GVSNYLIAQNKL--SEIIQTTN-I------ENLDI
A0A3B1CUQ0      LIIDLDLRKPRIHHIFDI--NREP-GITHLLAGKSDF--KEIIRPTA-T------EHLYV
A0A1W1BK27      LIMDLDLRKPRLYQELNK--SNKL-GMTQYLTGDFEL--ESCIQEVN--------EHLDF
A0A1W1CD04      LLVDLDLRKAKLHQELKQ--KNRM-GMSNYLSGDIEI--IDIIKPLP--------NNLDF
                :.:* *:*                 *.                                 

A0A3B1C250      L--TS-GATPPNPLEFLSSRRLANTFNQVKKAFDTIIIDTPPILLFSDAMVVGQLVDCCI
A0A1J5RCY3      L--PS-GQIPPNPSELLGSRAMVTLLDKLAQLYDLVLIDTPPLLPVTDAAILSRLTGGAL
A0A1J5RUE5      L--TS-GEIPPNPSQLLDSPAMHRVLDEAVKTYDLVVVDCPPVLPVVDASVLGRHVDGVL
A0A0F9JKD8      V--TS-GPLPPNPSELLGSEKFARFLSSMQERYDVLIFDSPPVLTVTDSLVLSKYVDGTI
A0A0F9XPI6      C--LS-GAIPPNAPQLLSNGAFEKFITNAKEYYDLIVVDTAPAVPVTDTLLIADYADVTL
A0A2H9TBF4      M--PA-GMMPPDPTQLFAEEKFKNVLSQLSERFDTVIMDCPPMQGISDTLMISQLCDAVV
A0A3R2R3E8      I--SA-GPIPPNPSELILSDSFQEILETLKATYDIVIIDNPPVGLVTDGVQILAKADVPI
A0A1J5SM24      L--TT-GGRAKNPTQILNSKDFELMISDLKKRYDRVFVDSPPLAAVSDAMIILPLCDGSL
A0A3B1C7A9      I--TC-GTIPPNPSEILGSQQMVDLLARLKTKYDLIVLDSPPIIAVTDSEILSRIADTTI
A0A1J5SPZ5      L--CS-GGRSKTPSELLESNTFAQLLERLKRRFDLIVVDSPPLGAVTDSLLIAERIDEVI
A0A409NWS0      V--PR-GQVPPNPSELLMSERFTQLIEWASKHYDLVLIDTPPILAVTDAAVVGRHAGTTL
A0A3R1PE73      V--PR-GQVPPNPSELLMSERFTQLIEWASKHYDLVLIDTPPILAVTDAAVVGRHAGTTL
A0A3R3CX96      V--PR-GQVPPNPSELLMSERFTQLVKWASENYDLVLIDTPPILAVTDAAVVGRHAGTTL
A0A408NUV2      V--CR-GAVPPNPSELLMHPRFKALLDWASEHYDFVIVDSPPILAVTDAAIVGQHVGASL
A0A3R5LMR4      V--CR-GAVPPNPSELLMHPRFKALLDWASEHYDFVIVDSPPILAVTDAAIVGQHVGASL
A0A3R5Q2V2      V--CR-GAVPPNPSELLMHPRFKALLDWASERYDFVIVDSPPILAVTDAAIVGQHVGASL
A0A404B052      V--CR-GAVPPNPSELLMHPRFKALLDWASEHYDFVIVDSPPILAVTDAAIVGQHVGASL
A0A3R1PAA4      V--PR-GQVPPNPSELLMHQRFADFLRWAGQNYDLVLIDTPPVLAVTDAAIVGHHAGTAL
A0A3R2C7H5      V--PR-GQVPPNPSELLMHQRFADFLQWAGQHYDLVLIDTPPVLAVTDAAIVGHHVGTAL
A0A405AF34      V--PR-GQVPPNPSELLMHQRFADFLQWARQNYDLVLIDTPPVLAVTDAAIVGHHVGTAL
A0A3R2D8P2      I--SR-GMIPPNPAELLMHSNFEKLLKWCSDNYDLVLVDTPPILAVTDAAIIGRHVGTSL
A0A3R2C102      I--PR-GTIPPNPSELLMGSRFNELIKWAEKNYDIVMIDTPPILAVTDAAIIGHNAGTSL
A0A3R2GYI6      I--PR-GQLPPNPSELLMHSRLADLLNWAGGKYDLILIDTPPVLAVTDASIIGRLAGTSL
A0A3R2EM25      I--SR-GKIPPNPSELLMHNRLTEFLEWAGKEYDIVLVDTPPILAVTDAAIVARNVGTTL
A0A3R3FNT7      I--SR-GKIPPNPSELLMHNRLSEFLEWAGKEYDIVLVDTPPILAVTDAAIVARNVGTTL
S0DG33          LSC---GLRPENPAALLMKPRFKDVLERLAGQFDLVIIDTPPFLAVTDASIIANEAGASL
A0A3R2V5T0      LPVST-SNQFAHSSELLSSSGMRKFIDSAREACDYIIVDLAPVVPVIDAKAFAPQVDGFV
A0A405JUY6      LPMTTRGRQVTHTSELLASSGMSQFLESIKDTFDVIVVDLAPLIPVIDAKAFEPYADAFV
A0A445V3X4      I--PA-GPSPPNPVELLSSSKMLSLLNVAIERFDYIIVDGPPVVGLADALVLSNLAHATV
A0A445VBS2      I--PA-GPSPPNPVELLSSSKMLSLLDVAIERFDYIIVDGPPVVGLADALVLSNLAHATV
A0A407V607      V--TA-GKTRLAASGAKIRHRLAPALEAWKLEYDFVLLDMPPLLVLSEVAQAARHTDGVL
T0ZG59          L--AC-GPLPPNPAELLAGPRLATLLAEAQAEYDLVILDSPPVLGLADAPVLGHCAAGTL
A0A3R3TCJ4      L--PL-AKREFTPHEVFNTPAMHDLLKQLRAQFDLVILDTAPLLAIAETRVLASQSDAVV
A0A3R4EU13      L--PL-AKREFTPHEVFNTPAMHDLLKQLRAQFDLVILDTAPLLAIAETRVLASQSDAVV
A0A3B1AK25      M--PS-GTVPPNPLALLSSNRFTTALDHLGKNFDHIIIDSAPCLAVSDALVLSRCASGVI
A0A3R4E576      LPAVV-RQRTPHSSELLASSGMRGLLKKVSEQYDYIVVDLPPLGPVVDARAIADRIDGFI
A0A404I461      LPAVV-RQRTPHSSELLASSGMRGLLKKVSEQYDYIVVDLPPLGPVVDARAIADRIDGFI
A0A408J920      LPTVV-KQRVPHSSELLTSAQMHKLLAEASNAFDYIIVDLPPLGPVVDARAMAGRIDGFI
A0A3R1N912      LPTVV-KQRVPHSSELLTSPQMHKLLAEASGVFDYIIVDLPPLGPVVDARAMASRIDGFV
A0A405ZIS9      LPTVV-KQRVPHSSELLTSAQMHKLLAEASNAFDYIIVDLPPLGPVVDARAMAGRIDGFI
A0A380TGM5      I--AS-GSAARDPSDLLGSKAVKAFLDQACESFDLVVLDSSPLMSVSDACNLAPLAEETV
A0A3P5W345      I--AS-GSAARDPSDLLGSKAVKAFLDQACESFDLVVLDSSPLMSVSDACNLAPLAEETV
A0A380TDI0      M--VS-GASSADRKVLGDAARLEGLLAKLRGRYDLIVIDAPPALALAEGQVIPMVADATL
A0A380TDN3      M--VS-GSSSADRKVLGDAARLEGLLATLRSRYDLIVIDAPPALALAEGQVIPMVADATL
A0A3P5WKD3      M--VS-GSSSADRKVLGDAARLEGLLATLRSRYDLIVIDAPPALALAEGQVIPMVADATL
A0A3R2WIS1      L--TT-GNYPFNPANMMLSSKLGELLNDFSERYDLVVIDSPPVLVAADAAAVAAHAGAVL
A0A3R5EJ70      L--TT-GNYPFNPANMMLSSKLGELLNDFSERYDLVVIDSPPVLVAADAAAVAAHAGAVL
A0A3R3UIB9      L--CA-GAVPPNPLELLSSERFTKLIEQLKDSYDRVIIDSPPIQAVSDATILAIHADAQI
A0A409NVE8      L--CA-GAVPPNPLELLSSERFAKIVEHLKGLYDRVIIDSPPTQAVSDATILATHSEALI
A0A0F9U8M8      M--PC-GQLPPNPLELLSSNKFSKVIEQLKEKFDRIIIDTAPIQAVSDSLMISKSVDSVI
A0A381Y0U7      I--PS-GKLPSSSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCV
A0A381Z3K5      I--PS-GKLPSSSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCV
A0A0F9UWR4      L--TA-GAVPPNPLELLASPRFAKFLERVKDRYDHILIDSPPTQAVSDSVLMSTYADSVI
A0A3R1X0V0      L--AA-GTVPPNPQELLASPLFSQLLEQLSERYQRIVIDTPPCLAVSDALLMSTLADFVL
A0A0F9LFA5      M--PS-GQIPSNPLELLSNARFSEVIDDFKAQYDHIIIDTPPTQAVSDALVIAQSVDSVI
A0A1J5R1Y0      I--TA-GAVPPNPLELLLSQRFQETIAALSREFDLVILDSPPVHLVSDAIILSTLATGVV
A0A160TC29      I--PA-GPIPPNPLELLASKNFSALLETLKGRYDRIIIDSAPTHAVSDATYLSTLVDGVV
A0A3R2TSB1      I--TT-GKLPLDPATMMGSTAFTRLLETLSALYDAVVIDAPPILLATETVAMSPDVGTLM
A0A3R3XUC2      I--TT-GKLPLDPATMMGSTAFTRLLETLSALYDAVVIDAPPILLATETVAMSPDVGTLM
A0A407WVH8      I--TT-GKLPLDPATMLGSTAFTRLLETLSALYDAVVIDAPPILLATETVAMSPDVGTLM
A0A408G2L4      I--SR-GQVPPNPSELLMHANFRELLAELSERYDLVIIDTPPLLAVTDAAIVGREAGISL
A0A405APZ8      L--PR-GKVPPNPSELLMHERFAEFVKWAAANYDMVLIDSPPILAVTDASIIGRLVGTSM
A0A3R1LUZ7      I--SR-GTNPPNPAELLMRGNLEELIEWASKNYDLVIVDTPPVLAVTDPTIISRCAGTTL
A0A3R2BGD8      V--PR-GQVPPNPSELLMHQRFADFLRWAGQNYDLVLIDTPPVLAVTDAAIVGHHAGTAL
A0A3R2U6C3      I--AT-GAVTFDPSELLASPVFGETLRELATQYDMVILDTAPVLSSPDAAVVGTHAAAVM
A0A3R3W6C3      I--AT-GAVTFDPSELLASPVFGATLRELSSQYDMVILDTAPVLSSPDAAVVGTHAAAVM
A0A407XAA6      I--AT-GAVTFDPSELLASPVFGATLRELSSQYDMVILDTAPVLSSPDAAVVGTHAAAVM
A0A3R5H8M2      I--SR-GKSPANPSELLSSTQFKALLEQLSEKFDHVIIDTPPVLAVTDGIIISQYTGVNL
A0A3R2H5L1      I--TR-GKSPTNPSEILSSTQFKELLEQLQSQYDHIIIDTPPVLAVTDGIIISQYTGVNL
A0A3R1PLZ2      I--TR-GKSPTNPSEILSSTQFKDLLETVQSQYDHIIIDTPPVLAVTDGIIISQYTGVNL
A0A406JUR4      I--TR-GKSPTNPSEILSSTQFKDLLETVQSQYDHIIIDTPPVLAVTDGIIISQYTGVNL
A0A409MU65      I--TR-GKSPTNPSEILSSTQFKDLLEQLQSQYDHIIIDTPPVLAVTDGIIISQYTGVNL
A0A3R2CMW0      I--TR-GKSPVNPSELLSSAKFAAMFEQLSPMYDHIIIDTPPVLAVTDGIIISQYAGVNL
A0A407T0V1      I--SR-GKNPANPSELLSSNQFKNLLEQMSEKFDHVIIDTPPVLAVTDGIIISQYTGVNL
A0A0F9VQU4      I--TR-GVSASNPSELLMRPGFEQALEDLSEMYDMVIVDTPPVLAVTDACVAGKHCGTTL
A0A1W1DYN8      L--TT-GALPPNPSELLMHKNFGQYLTEFSKDYDLILIDTPPILAVTDATVIAQLCGITF
A0A1W1E4Z5      L--TT-GALPPNPSELLMHKNFGRYLTEFSKDYDLILIDTPPILAVTDATVIAQLCGITF
A0A3R1GLT3      I--AR-GDVPPNPSELLMHRNFTELLEQVEKRFDLVIIDTPPILAVTDAAVIAHHAGTCL
A0A3R3DWA3      M--TR-GDIPPNPAELLMHPRFEQMLEELAGVYDLVIVDTPPILAVTDAVIVAKHAGSTL
A0A2H9T6C5      L--TA-GRIPPNPSELLMSQSFSAFLEKASDVYDVVLVDTPPILAVTDAAIIGRQCSQTF
A0A3R2W4Z8      L--TT-GAYPFNPANMMLSSALGELLNDFSERYDLVVIDSPPVLVAADAAAVAAHAGAVL
A0A3R5D942      L--TT-GAYPFNPANMMLSAALGELLNDFSERYDLVVIDSPPVLVAADAAAVAAHAGAVL
A0A0F9KY21      I--TR-GQIPPNPSELLMHSNFSKLVEEVSTAYDIIIVDTPPILAVTDPAIVSAHCGTTL
A0A404TF61      I--GR-GQIPPNPSELLMHANFSAFLEQVSAQYDLVILDTPPLLAVTDAAIVGRQSGTSL
A0A406MXU2      I--GR-GQIPPNPSELLMHANFSAFLDQVSAQYDLVILDTPPLLAVTDAAIVGRQSGTSL
A0A3R4Q9I0      I--TR-GQIPPNPSELLMHSNFTRFLEQVSSQYDLVIIDTPPILAVTDAALVGRQAGTSL
A0A407TZB0      I--TR-GQIPPNPSELLMHSNFTRFLEQVSSQYDLVIIDTPPILAVTDAALVGRQSGTNL
A0A0F9W5Q6      I--SR-GQIPPNPSELLMHANFETLLKKLSSMYDLVIVDTPPVLAVTDAALVGRLAGTSL
A0A404IBN2      I--GR-GQIPPNPSELLMHANFSAFLDQVSAQYDLVILDTPPLLAVTDAAIVGRQSGTSL
A0A406Y387      I--GR-GQIPPNPSELLMHANFSAFLEQVSTQYDLVILDTPPLLAVTDAAIVGRQSGTSL
A0A3R1X9G0      M--SR-GERPPNPSELLMRSSFTELLNKVSSMYDLVILDTPPLLAVTDAAIVGRQCGTSL
A0A3R3ZKH7      M--SR-GERPPNPSELLMRSSFTELLNKVSSMYDLVILDTPPLLAVTDAAIVGRQCGTSL
A0A3R2WMV4      I--SR-GQVPPNPSELLMHANFRELLAELSKLYDVVIIDTPPLLAVTDAAIVGREAAINL
A0A3R3BQL7      I--SR-GQVPPNPSELLMHANFRELLAELSKLYDVVIIDTPPLLAVTDAAIVGREAAINL
A0A3R4AM40      I--SR-GQVPPNPSELLMHANFRELLAELSKLYDVVIIDTPPLLAVTDAAIVGREAAINL
A0A3R2HMB7      I--SR-GQVPPNPSELLMHANFRELLAELSKLYDVVIIDTPPLLAVTDAAIVGREAAINL
A0A3R4QTV3      I--SR-GQVPPNPSELLMHANFRELLAELSKLYDVVIIDTPPLLAVTDAAIVGREAAINL
A0A3R4YGM2      I--SR-GQVPPNPSELLMHANFRELLAELSERYDLVIIDTPPLLAVTDAAIVGREAGISL
A0A3R1WG16      I--SR-GQVPPNPSELLMHANFRELLAQLSERYDVVIIDTPPLLAVTDAAIVGRDAGISL
A0A3R3R2K7      I--SR-GQVPPNPSELLMHANFRELLAQLSERYDVVIIDTPPLLAVTDAAIVGRDAGISL
A0A3R3TSL3      I--SR-GQVPPNPSELLMHANFRELLAQLSERYDVVIIDTPPLLAVTDAAIVGRDAGISL
A0A3B0VME9      I--PS-GPIPPSPAELLASSTMRAFIAAAAREYDYLILDAPPFHGFAEILILSNMVDGVI
A0A3B1DSR1      L--TA-GEEPENPAELLASPTFKKMLSEAKSQFDFILIDTPPLLAVSDPCIVAPQTDGLL
A0A0F9I1G8      V--PS-GPIPPNPVELLASNRFTELMAVCNQKFDRIILDAPPHHGFADILVLSRQVGGVV
J9FGR8          I--PV-GTVPPNPTELLENGKLARLVDALKAEFDYIFIDCPPVDIIADTQIIAQVADRTL
A0A0W8FS74      I--TA-GTTPPNPAELLGSEAMRQFLITHRDEYDHIFIDAPPVLAVTDAPVLTTMSDIVL
A0A3B0V744      I--TA-GAIPPNPSELILRKEFGEMIENLKLKYEVVILDTPPVGLVTDGLLAMQKADLPL
A0A405V7W6      I--SA-GPIPPNPSELILSESFFEILEELKSRYDLVIIDNPPVGLVTDGVQILAKADVPI
A0A1W1D4H7      I--PT-GPLPPNPSELILSKAFTKMLEVLKKKYDYIIIDTPPAGLVTDAIIVMNYSDLSL
A0A3B1CUQ0      I--PA-GIIPPNPSELLSQQDLRDFLDKTRKEFDYILIDSPPVLPVTDSLLLGRLADASF
A0A1W1BK27      F--PA-GAIPPNPSELLMSEKFDKTIKKLFLTYDYILFDTSPIGSIIDAKILLPYSDIVL
A0A1W1CD04      I--SA-GAKPPNPSELLMSEKFNKAINELEKHYDYIIFDTAPIGIVTDANMILKHTDIVL
                                     .   .       : :..* .*     :           .

A0A3B1C250      LSIRSDQTTHNMAQDAVKRLTSSQLKPLGVVL-SYANTKG------------GKSYGGYY
A0A1J5RCY3      VVVGAGKLQRQQLAEAMGALETVGARVLGLVL-NRLAKTP------------SDSYTYY-
A0A1J5RUE5      LVIGLRQVRRQQVRSALAAITAVGATPLGLVITNAVDDGA------------GAPYSYRR
A0A0F9JKD8      VVARAAKTSYEAVRKGLRQLNDVGSNVLGLLI-NAIDARK---------------GGYYY
A0A0F9XPI6      FVIRAGVTDKAILHGASEDSHRDKLKNMAYVL-NDVHARN------------IKSYNYGY
A0A2H9TBF4      YVVEAGRASKTAISHSTGRLLQNSVPLTGVVL-NKVNTRR-------GHEDGY------Y
A0A3R2R3E8      YIFKAHYSKRIFAGRVRELFEMNQISHLNIIL-NGTKAYK-------GK--------YGY
A0A1J5SM24      FTIFFNKVRRKAAQFVAHKLTDSNVPNFGAVL-NGLNLAV-------SG--------YYY
A0A3B1C7A9      LVAASGETEIELLKKSAELLQHDSDSFIGVVL-NKFTFKS------------------GY
A0A1J5SPZ5      YVCRFNRAYRKHIKLYIKALRSGKNEILGIVL-NGLSPRR-------IE---------YY
A0A409NWS0      MVARYAVNTLKEVETSLSRFEQNGIEVKGVIL-NSIFRRA-------TG---------YQ
A0A3R1PE73      MVARYAVNTLKEVETSLNRFEQNGIDVKGVIL-NSIFRRA-------TG---------YQ
A0A3R3CX96      MVARYAVNTLKEVETSLSRFEQNGIEVKGVIL-NSIFRRA-------TG---------YQ
A0A408NUV2      LVARFAKTAVKEVEVAIRRFEQNGVAIKGILL-NAVEKKA-------SS---------YY
A0A3R5LMR4      LVARFAKTAVKEVEVAIRRFEQNGVVIKGILL-NAVEKKA-------SS---------YY
A0A3R5Q2V2      LVARFAKTAVKEVEVAIRRFEQNGVVIKGILL-NAVEKKA-------SS---------YY
A0A404B052      LVARFAKTAVKEVEVAIRRFEQNGVVIKGILL-NADEKKA-------SS---------YY
A0A3R1PAA4      MVVRFEVNTVRQIETSIRRFEQNGVAIKGVIL-NGMVKKT-------AT-----------
A0A3R2C7H5      MVVRFEVDTLRQIETSIRRFEQNGVAIKGVIL-NGMVKKT-------AT-----------
A0A405AF34      MVVRFEVDTVRQIETSIRRFEQNGVAIKGVIL-NGMVKKT-------AT-----------
A0A3R2D8P2      MVARFDVNTTKEVMLSIRRFEQNGVDIKGVII-NAVVRKA-------AS---------HY
A0A3R2C102      MIARFSVNTVKEMEISIRRFNQNGIDIKGVIL-NAVEKRA-------SS---------YY
A0A3R2GYI6      MVARFGVNTVKEVDFSIRRFDQNGINIKGVIL-NAVEKRA-------SN---------YY
A0A3R2EM25      LVARYGVNSLKEIEVSIRRFEQNGMEIKGIIL-NAVEHKS-------GS-----------
A0A3R3FNT7      LVARYGVNSLKEIEVSIRRFEQNGMEIKGIIL-NAVEHKS-------GS-----------
S0DG33          LVLRSGMQSEEEIADTVKKMERAEGRISGAVF-NGIPLRR-------ST----RNYG---
A0A3R2V5T0      FVTEWGKTPIQMVQNLMANEPQIANKTLGIVL-NKTDMTE-------LQ----RYAGPGG
A0A405JUY6      FVTEWGATPAKAVQSVLQSEPQIAAKTIGVIL-NKTDLSE-------LH----KYADPGA
A0A445V3X4      FVVASGVPRLSVVDGSIKRLRSAKATLIGGVL-TKVDHDS-------SR---YSYYGYSY
A0A445VBS2      FVVASGIPRLSVVDGSIKRLRSAKATLIGGIL-TKVDQDS-------SR---YSYYGYSY
A0A407V607      MLANLQQVPPDALLAGVQQLQSLRAPVIGLVA-ISQMVAQ-------S------KGGY--
T0ZG59          LVIEAGGARIDHIRDALKRLRAARARVVGAAI-TKLDARH-------G------AYGYGY
A0A3R3TCJ4      FLTRWRKTPAKASNAALQTLRQSDAKIAGVVL-TLVDVNE-------QA-----RYGYGD
A0A3R4EU13      FLTRWRKTPAKASNAALQTLRQSDAKIAGVVL-TLVDVNE-------QA-----RYGYGD
A0A3B1AK25      LVVKADATPYPVAQDAIKRLHQSNARIIGGVL-NNVSKSK-------KG---G-YGNYGK
A0A3R4E576      FVAEWGATARRVAIEVLNANPQVRDKCIGVIL-NKVDQDR-------LK---L-YHDYGS
A0A404I461      FVAEWGATARRVAIEVLNANPQVRDKCIGVIL-NKVDQDR-------LK---L-YHDYGS
A0A408J920      FVTEWGKTARRAVRNTVENEVHIRKKCLGVIL-NKVDTEK-------LK---L-YRAYGS
A0A3R1N912      FVTEWGKTARRAVRNTIENEVHIRKKCLGVIL-NKVDTEK-------LK---L-YRAYGS
A0A405ZIS9      FVTEWGKTARRAVRNTVENEVHIRKKCLGVIL-NKVDTEK-------LK---L-YRAYGS
A0A380TGM5      FVIQWGKTGREVVKLALEKLTETQGVPRGIVL-SRVDTAK-------IR-----LYGYGD
A0A3P5W345      FVIQWGKTGREVVKLALEKLTETQGVPRGIVL-SRVDTAK-------IR-----LYGYGD
A0A380TDI0      LVVRWGKTRKRVVRYTMDQLTRFGMPLHGVVL-NMVDVRK-------QA-----YYGYGD
A0A380TDN3      LVVRWGKTRKRVVRYTMDQLTRFGMPLHGVVL-NMVDVRK-------QA-----YYGYGD
A0A3P5WKD3      LVVRWGKTRKRVVRYTMDQLTRFGMPLHGVVL-NMVDVRK-------QA-----YYGYGD
A0A3R2WIS1      LVARDNLTQLGELNESVKRLAHAGQQVNGVVF-NGMDLSR-------RH---YGSYGYKY
A0A3R5EJ70      LVARDNLTQLGELNESVKRLAHAGQQVNGVVF-NGMDLSR-------RH---YGSYGYKY
A0A3R3UIB9      YVIKSESTSVPLARRGVGQLLQSNSPVTGVVL-NQVDIKK-------AQ-----KHGYHY
A0A409NVE8      YVIKSEASPIPLVQKGVGQLLQSNAPVTGVVL-NQVDVRK-------AQ-----KHGYHY
A0A0F9U8M8      YVVKSDDTHLSIIKNGIGRLLQDKAKLAGVVL-NHVDTDK-------VA---K-TQG--Y
A0A381Y0U7      LVVQYRKYPQLMTQRAKGMVTKVGGELVGVVL-NNINI---------SQ---D-SYYYYY
A0A381Z3K5      LVVQYRKYPQLMTQRAKGMVTKVGGELVGVVL-NNINI---------SQ---D-SYYYYY
A0A0F9UWR4      YVIKSESTSISMAQKGVGQLLQSGASIVGVVL-NQVDVKK-------AA---K-K-G-EY
A0A3R1X0V0      YVVKSDATAVPLVHKGIGQLLQGNAPVKGIVL-NQVDVTA-------AG---S-KGG-RY
A0A0F9LFA5      YVVKSDITRIKPIKAGIERLFEAKAHVAGIVL-NQVDMSK-------SK---D-EHSHGY
A0A1J5R1Y0      FVMKANSTPYQVAQRCLRALQGAKATLFGVVL-NQLDFKK-------AE---S-HYG-DY
A0A160TC29      YVVKADETKDKLITSGIARLHDSNARILGVLL-NQMDV-E-------KE---A-RYGGHY
A0A3R2TSB1      LVARAGDSELGDLVESAKRLAHVGAAFHGVVL-NAQDARQ-------RH---N-AYGYDY
A0A3R3XUC2      LVARAGDSELGDLVESAKRLAHVGAAFHGVVL-NAQDARQ-------RH---N-AYGYDY
A0A407WVH8      LVARAGDSELGDLVESAKRLAHVGAAFHGVVL-NAQDARQ-------RH---N-AYGYDY
A0A408G2L4      IVTRFGVNPAKEIELTIRRFAQNGIELKGAVF-NGVEKRA-------AS---Y----YGN
A0A405APZ8      IVARYNVTTLKEVEVSVRRFENSGVNIKGVVF-NAQERKS-------AG---Y----Y--
A0A3R1LUZ7      MVIRHEVNTLPEVVAAIKRFEMNNVSVKGVIL-NAVVKRA-------TN---Y----Y--
A0A3R2BGD8      MVVRFEVNTVRQIETSIRRFEQNGVTIKGVIL-NGMVKKT-------ATDAGY----Y--
A0A3R2U6C3      VVVRSGMNTVGEIRETAKRLIQAGAPVDGVLF-NGLKLLP-------ER---F-GFRSKY
A0A3R3W6C3      VVVRSGMNTVGEIRETAKRLIQAGAPVDGVLF-NGLKLMP-------ER---F-GFRSKY
A0A407XAA6      VVVRSGMNTVGEIRETAKRLIQAGAPVDGVLF-NGLKLMP-------ER---F-GFRSKY
A0A3R5H8M2      VIARYAKTQMKELELTLNRFEQAGVKVNGFIL-NDIQRSA-------GS---------GY
A0A3R2H5L1      IVARYAKSQMKELELTLNRFEQAGVKVNGFIL-NDIQRAS-------AG--------YGY
A0A3R1PLZ2      IVARYAKSQMKELELTLNRFEQAGVKVNGFIL-NDIQRAS-------AG--------YGY
A0A406JUR4      IVARYAKSQMKELELTLNRFEQAGVKINGFIL-NDIQRAS-------AG--------YGY
A0A409MU65      IVARYAKSQMKELELTVNRFEQAGVKVNGFIL-NDIQRAS-------AG--------YGY
A0A3R2CMW0      VIARYAKSQMKELELTVNRFEQVGVKVNGFIL-NDIQRGT-------GG---Y---GYGY
A0A407T0V1      VIARYAKTQMKELELTLNRFEQAGVKVNGFIL-NDIQRSA-------GS---------GY
A0A0F9VQU4      LVTRFDRNSVREILMAKKRLESSGLEIQGAIL-NGVKISS-------RG---A------S
A0A1W1DYN8      VLLHYGMHSMSEIRATINRLRQNNIETKGFIF-NGIKAHG------------------GY
A0A1W1E4Z5      VLLHYGMHSMSEIRATINRLRQNNIETKGFIF-NGIKAHG------------------GY
A0A3R1GLT3      LVARFGLNQPKELMLARKRFEQNNVQLKGAIF-NAVERRA-------TG---Y-------
A0A3R3DWA3      MVTRFGINQPKEILLSMKCFERNGVQVKGAIF-NAVEKRA-------TG---Y-------
A0A2H9T6C5      LVAWAEKNTASEISYAAKRLQQAKVNVKGCIL-NGMVHTS-------SR---Y-------
A0A3R2W4Z8      LVARDNLTQLGELNESVKRLAHAGQQVNGVVF-NGMDLSR-------RH---YGSYGYKY
A0A3R5D942      LVARDNLTQLGELNESIKRLAHAGQQVNGVVF-NGMDLSR-------RH---YGSYGYKY
A0A0F9KY21      LVARFGQNHVREIELTRNRFEQNGIDVKGVVF-NGVVKKA-------SN---A----YGY
A0A404TF61      IVTRFALNPVREIELTMRRFAQNGIELKGAIF-NGVEKRA-------SA---K----YGY
A0A406MXU2      IVTRFALNPVREIELTMRRFAQNGIDLKGAIF-NGVEKRA-------SA---K----YGY
A0A3R4Q9I0      IVTRFGVNAAKEIAVTKRRFEQNGIVVKGAIF-NAVERKA-------SA---Y-----GY
A0A407TZB0      IVTRFGVNAAKEIAVTKRRFEQNGIVVKGAIF-NAVERKA-------SA---Y-----GY
A0A0F9W5Q6      IVTRFGLNPVREIEQTLQRFRNNGVDIKGAIF-NAVEKKA-------SA---Y-----GY
A0A404IBN2      IVTRFALNPAREIELTMRRFAQNGIELKGAIF-NGVEKRA-------SA---K----YGY
A0A406Y387      IVTRFALNPVREIELTMRRFAQNGIELKGAIF-NGVEKRA-------SA---K----YGY
A0A3R1X9G0      IVARFGLNPAREIELTINRFAQNGIKLAGAIF-NGVERRA-------SA---N----YGY
A0A3R3ZKH7      IVARFGLNPAREIELTINRFAQNGIKLAGAIF-NGVERRA-------SA---N----YGY
A0A3R2WMV4      IVTRFGVNPAKEIELTIRRFAQNGIELKGAIF-NGVEKRA-------SS---Y----YGN
A0A3R3BQL7      IVTRFGVNPAKEIELTIRRFAQNGIELKGAIF-NGVEKRA-------SS---Y----YGN
A0A3R4AM40      IVTRFGVNPAKEIELTIRRFAQNGIELKGAIF-NGVEKRA-------SS---Y----YGN
A0A3R2HMB7      IVTRFGVNPAKEIELTIRRFAQNGIELKGAIF-NGVEKRA-------SS---Y----YGN
A0A3R4QTV3      IVTRFGVNPAKEIELTIRRFAQNGIELKGAIF-NGVEKRA-------SS---Y----YGN
A0A3R4YGM2      IVTRFGVNPAKEIELTIRRFAQNGIELKGAVF-NGVEKRA-------AS---Y----YGN
A0A3R1WG16      IVTRFGVNPAKEIELTIRRFAQNGIELKGAVF-NGVEKRA-------AS---Y-------
A0A3R3R2K7      IVTRFGVNPAKEIELTIRRFAQNGIELKGAVF-NGVEKRA-------AS---Y-------
A0A3R3TSL3      IVTRFGVNPAKEIELTIRRFAQNGIELKGAVF-NGVEKRA-------AS---Y-------
A0A3B0VME9      LTTQLNRTPRDGVEYFRKAVTNVGGRILGTLV-NKVPTGK-----------TGSRYYGGY
A0A3B1DSR1      LILRLKKDSRADITRAAELLDTHNIDVLGAIV-NGVEISP---------------DEQTY
A0A0F9I1G8      LVSSIGETTRDALRHFKKGILNVQGTILGCII-NKVNLTK------------RYGYRAYY
J9FGR8          FVVRAGLLDRSMLPVLQGMYDDKRFQGMAMIL-NGTESSR-------------GRYSYRY
A0A0W8FS74      LIMEAGRVPIKAAQHMREMLSNVQAPVAGFVL-NDKTGSGETYGYYGSRYYRYGRYGKGY
A0A3B0V744      YVIKADFSKRSFVQNVNRVLATGQFNNLSIIL-NATTTSE-------------------T
A0A405V7W6      YIFKAHYSKRIFAGRVRELFEMNQISHLNIIL-NGTKAFK----------------GK-Y
A0A1W1D4H7      FLVRANYTKKEFIKNIDKLVKEYKENRVGIIF-NGATINS----------------Q--Y
A0A3B1CUQ0      IIIKLGETSFPAVEQAVKQLRSVDVNVAGAII-NKIKPSA----------------G--Y
A0A1W1BK27      LVVRANVAEKGFIEHFNNLRKETEIQSSGIIL-NDVKHDK----------------SSSY
A0A1W1CD04      LIVKAGSAEKDFINNFNKMVKDKNIESSGIIL-NGVKISK----------------GKNY
                                                                            

A0A3B1C250      GDYYGDYYGAEFDEDEDDFITKKSNKSRRGKRKGRSLATVGGIALALTIIAYFLWNPDKS
A0A1J5RCY3      -----------------DYSTETGSTVTKKRSRTAASTSETQRPPAHTGSRRLVPRTGQI
A0A1J5RUE5      PDEIRPHRSQPWRRRRPDEIRQNGADADVDAAVSSTAGPEDPRTPISPEPRE--ARASAV
A0A0F9JKD8      NYYYYHDYNYYYSAKDEEGEE---------------------------------------
A0A0F9XPI6      GEV---------------------------------------------------------
A0A2H9TBF4      GYYDYHGYSDGHQDNKKHPDAQGKRIKTAEIEPESVV-----------------------
A0A3R2R3E8      GYGYGYGYDYYDEEDKKKKKK---------------------------------------
A0A1J5SM24      AQYYDKTYKDYYVVMAKQDPDTPER-----------------------------------
A0A3B1C7A9      GSYYKYYYY--YSNNKDAKKKKFFSKKT--------------------------------
A0A1J5SPZ5      SNYRYYRSYKKYYGAQT-------------------------------------------
A0A409NWS0      -DYGYYEYE--YKSDSK-------------------------------------------
A0A3R1PE73      -DYGYYEYE--YKSDSK-------------------------------------------
A0A3R3CX96      -DYGYYEYE--YKSDSK-------------------------------------------
A0A408NUV2      GNYGYYQYS--YGDKTKA------------------------------------------
A0A3R5LMR4      GNYGYYQYS--YGDKTKA------------------------------------------
A0A3R5Q2V2      GNYGYYQYS--YGDKTKA------------------------------------------
A0A404B052      GNYGYYQYS--YGDKAKA------------------------------------------
A0A3R1PAA4      -DAGYYAFA--YPSHQEKVQ----------------------------------------
A0A3R2C7H5      -DAGYYAFA--YPSHQEKV-----------------------------------------
A0A405AF34      -DAGYYAFA--YPSHQEKV-----------------------------------------
A0A3R2D8P2      -SYGYYNYE--YSSDKK-------------------------------------------
A0A3R2C102      GDYGYYHYE--YRSNEKS------------------------------------------
A0A3R2GYI6      GGYGYYQYS--YTSDKKQ------------------------------------------
A0A3R2EM25      -AYGYYAYE--YK-----------------------------------------------
A0A3R3FNT7      -AYGYYAYE--YK-----------------------------------------------
S0DG33          ---YETNYASDVGDLEATR-----------------------------------------
A0A3R2V5T0      SEHYHEKFSAYYGDAKPPVKEEA-------------------------------------
A0A405JUY6      PERLRSNYLSYYRDYKEVAAE---------------------------------------
A0A445V3X4      SYSYGTKTVQALDKPSV-------------------------------------------
A0A445VBS2      SYSYGTKTVQALDKPSV-------------------------------------------
A0A407V607      ----YLMAGEGLIS----------------------------------------------
T0ZG59          NSYDYGDAYGGKTSRRNA------------------------------------------
A0A3R3TCJ4      PGYYYSSYKNYYAT----------------------------------------------
A0A3R4EU13      PGYYYSSYKNYYAT----------------------------------------------
A0A3B1AK25      YSYYDGCYYGSYGYTND-------------------------------------------
A0A3R4E576      NDYYYSRYSRYYHESN--------------------------------------------
A0A404I461      NDYYYSRYSRYYHESN--------------------------------------------
A0A408J920      SEYYHSRYTRYYHD----------------------------------------------
A0A3R1N912      SEYYYSRYTRYYHD----------------------------------------------
A0A405ZIS9      SEYYHSRYTRYYHD----------------------------------------------
A0A380TGM5      AAYYDRTVREYYTRGSA-------------------------------------------
A0A3P5W345      AAYYDRTVREYYTRGSA-------------------------------------------
A0A380TDI0      AGYYYGKRAKYYTS----------------------------------------------
A0A380TDN3      AGYYYGKRAKYYTS----------------------------------------------
A0A3P5WKD3      AGYYYGKRAKYYTS----------------------------------------------
A0A3R2WIS1      GGYRYTEY-KYKEA----------------------------------------------
A0A3R5EJ70      GGYRYTEY-KYKEA----------------------------------------------
A0A3R3UIB9      GGY-YDYY-GYTNPQKTDAQTTQGSKA---------------------------------
A0A409NVE8      GGY-YDYY-GYTNNQPQKV-----------------------------------------
A0A0F9U8M8      NGYY-------DYYSYGKKNT---------------------------------------
A0A381Y0U7      SGYY-------YDYYYKSREKEESADETQDGEKEAKLVANADIGGEDEKPKY--------
A0A381Z3K5      SGYY-------YDYYYKSREKEESADETQDGEKEAKLVANADIGGEDEKPKY--------
A0A0F9UWR4      SGYY-------DHYGYSEQNA---------------------------------------
A0A3R1X0V0      DGYY-------DYYSYSDSPT---------------------------------------
A0A0F9LFA5      YDY------------YDYSQKPEQPNA---------------------------------
A0A1J5R1Y0      SGYG--------SYGKDAAGYYMKESS---------------------------------
A0A160TC29      SGYY-------DGYGYTTTEQS--------------------------------------
A0A3R2TSB1      GPYGLPPNIYPPALGHTPRAEPERATS---------------------------------
A0A3R3XUC2      GPYGLPPNIYPPALGHTPRAEPERATS---------------------------------
A0A407WVH8      GPYGLPPNIYPPALGHTPRAEPERATS---------------------------------
A0A408G2L4      GGYGYYNYE--YASDKS-------------------------------------------
A0A405APZ8      -GYGYYNYS--YESKND-------------------------------------------
A0A3R1LUZ7      -AYGYTNYTYDYTDKNK-------------------------------------------
A0A3R2BGD8      -AFAYPS----HQEKVQ-------------------------------------------
A0A3R2U6C3      GGYRYSRAA--YYGDFKQNGPK--------------------------------------
A0A3R3W6C3      GNYRYSRAA--YYGDFKQNGPK--------------------------------------
A0A407XAA6      GNYRYSRAA--YYGDFKQNGPK--------------------------------------
A0A3R5H8M2      GYNYAYAYK--ANKELD-------------------------------------------
A0A3R2H5L1      GYNYAYAYK--AQKED--------------------------------------------
A0A3R1PLZ2      GYNYAYAYK--AQKED--------------------------------------------
A0A406JUR4      GYNYAYAYK--AQKED--------------------------------------------
A0A409MU65      GYNYAYAYK--AQKED--------------------------------------------
A0A3R2CMW0      GYNYAYGYK--ASKNND-------------------------------------------
A0A407T0V1      GYNYAYAYK--ANKELD-------------------------------------------
A0A0F9VQU4      GYYGYGTYK--YQ-----------------------------------------------
A0A1W1DYN8      GKYAHYHYE--YKTQE--------------------------------------------
A0A1W1E4Z5      GKYAHYHYE--YKTQE--------------------------------------------
A0A3R1GLT3      --YSYGYYE--YKSTR--------------------------------------------
A0A3R3DWA3      --HSYGYYE--YASDKA-------------------------------------------
A0A2H9T6C5      GQYGYYHYA--YGDKA--------------------------------------------
A0A3R2W4Z8      GGYRYTEYK--YKEAGLASE----------------------------------------
A0A3R5D942      GGYRYTEYK--YKEEAA-------------------------------------------
A0A0F9KY21      --YGYYNYE--YKSDK--------------------------------------------
A0A404TF61      ADYGYYNYE--YKSESV-------------------------------------------
A0A406MXU2      ADYGYYNYE--YKSENV-------------------------------------------
A0A3R4Q9I0      GSYSYYQYE--YASDKK-------------------------------------------
A0A407TZB0      GSYSYYQYE--YASDKK-------------------------------------------
A0A0F9W5Q6      GNYGYYQYE--YKSDGK-------------------------------------------
A0A404IBN2      ADYGYYNYE--YKSESV-------------------------------------------
A0A406Y387      ADYGYYNYE--YKSESV-------------------------------------------
A0A3R1X9G0      SGYGYYHYE--YKDEKAKA-----------------------------------------
A0A3R3ZKH7      SGYGYYHYE--YKDEKAKA-----------------------------------------
A0A3R2WMV4      GSYAYYNYE--YASDKS-------------------------------------------
A0A3R3BQL7      GSYAYYNYE--YASDKS-------------------------------------------
A0A3R4AM40      GSYAYYNYE--YASDKS-------------------------------------------
A0A3R2HMB7      GSYAYYNYE--YASDKS-------------------------------------------
A0A3R4QTV3      GSYAYYNYE--YASDKS-------------------------------------------
A0A3R4YGM2      GGYGYYNYE--YASDKS-------------------------------------------
A0A3R1WG16      GTGGYYNYE--YASDKS-------------------------------------------
A0A3R3R2K7      GTGGYYNYE--YASDKS-------------------------------------------
A0A3R3TSL3      GTGGYYNYE--YASDKS-------------------------------------------
A0A3B0VME9      KYYKYYSYDYEYGRDA--------------------------------------------
A0A3B1DSR1      GNYYSSEQQEETKNNLAEAMVSQS------------------------------------
A0A0F9I1G8      KYYQAYNYDYGEDNKRKRVKKLKSDREK--------------------------------
J9FGR8          GYYYGHGNYYSQQ-----------------------------------------------
A0A0W8FS74      GYGYGYGYGYYSDDEPNRCKNPQRWEKVLNFIPEKLRKEIKKRFKF--------------
A0A3B0V744      GYGYGKKSAYYET-----------------------------------------------
A0A405V7W6      GYGYGYGYGYGYYEEESKKKKKG-------------------------------------
A0A1W1D4H7      GYY-GY-YNYYK------------------------------------------------
A0A3B1CUQ0      GYYHNY-YHYYYGDESPEEKKNT-------------------------------------
A0A1W1BK27      GYGYGYGYGV--------------------------------------------------
A0A1W1CD04      GYGYGYGYGYGYGEE---------------------------------------------
                                                                            

A0A3B1C250      LLSALPTLDIGIGSTAEEPKGEALSKPWSPQTGAKGDPSVKPEPAQKNSRTMKPNKPKAK
A0A1J5RCY3      RAVSAAEVAPRGEIDDPMGDLFPPTGPQRTSAWPGERMSGGTTEDWSSHQV---------
A0A1J5RUE5      QNANAAADAPDADV-------------------PAGGDGQNRKKNVASPTA---------
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A3R2R3E8      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A409NWS0      ------------------------------------------------------------
A0A3R1PE73      ------------------------------------------------------------
A0A3R3CX96      ------------------------------------------------------------
A0A408NUV2      ------------------------------------------------------------
A0A3R5LMR4      ------------------------------------------------------------
A0A3R5Q2V2      ------------------------------------------------------------
A0A404B052      ------------------------------------------------------------
A0A3R1PAA4      ------------------------------------------------------------
A0A3R2C7H5      ------------------------------------------------------------
A0A405AF34      ------------------------------------------------------------
A0A3R2D8P2      ------------------------------------------------------------
A0A3R2C102      ------------------------------------------------------------
A0A3R2GYI6      ------------------------------------------------------------
A0A3R2EM25      ------------------------------------------------------------
A0A3R3FNT7      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A3R2V5T0      ------------------------------------------------------------
A0A405JUY6      ------------------------------------------------------------
A0A445V3X4      ------------------------------------------------------------
A0A445VBS2      ------------------------------------------------------------
A0A407V607      ------------------------------------------------------------
T0ZG59          ------------------------------------------------------------
A0A3R3TCJ4      ------------------------------------------------------------
A0A3R4EU13      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A3R4E576      ------------------------------------------------------------
A0A404I461      ------------------------------------------------------------
A0A408J920      ------------------------------------------------------------
A0A3R1N912      ------------------------------------------------------------
A0A405ZIS9      ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A3P5W345      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3P5WKD3      ------------------------------------------------------------
A0A3R2WIS1      ------------------------------------------------------------
A0A3R5EJ70      ------------------------------------------------------------
A0A3R3UIB9      ------------------------------------------------------------
A0A409NVE8      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A3R1X0V0      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A3R2TSB1      ------------------------------------------------------------
A0A3R3XUC2      ------------------------------------------------------------
A0A407WVH8      ------------------------------------------------------------
A0A408G2L4      ------------------------------------------------------------
A0A405APZ8      ------------------------------------------------------------
A0A3R1LUZ7      ------------------------------------------------------------
A0A3R2BGD8      ------------------------------------------------------------
A0A3R2U6C3      ------------------------------------------------------------
A0A3R3W6C3      ------------------------------------------------------------
A0A407XAA6      ------------------------------------------------------------
A0A3R5H8M2      ------------------------------------------------------------
A0A3R2H5L1      ------------------------------------------------------------
A0A3R1PLZ2      ------------------------------------------------------------
A0A406JUR4      ------------------------------------------------------------
A0A409MU65      ------------------------------------------------------------
A0A3R2CMW0      ------------------------------------------------------------
A0A407T0V1      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A3R1GLT3      ------------------------------------------------------------
A0A3R3DWA3      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A3R2W4Z8      ------------------------------------------------------------
A0A3R5D942      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A404TF61      ------------------------------------------------------------
A0A406MXU2      ------------------------------------------------------------
A0A3R4Q9I0      ------------------------------------------------------------
A0A407TZB0      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A404IBN2      ------------------------------------------------------------
A0A406Y387      ------------------------------------------------------------
A0A3R1X9G0      ------------------------------------------------------------
A0A3R3ZKH7      ------------------------------------------------------------
A0A3R2WMV4      ------------------------------------------------------------
A0A3R3BQL7      ------------------------------------------------------------
A0A3R4AM40      ------------------------------------------------------------
A0A3R2HMB7      ------------------------------------------------------------
A0A3R4QTV3      ------------------------------------------------------------
A0A3R4YGM2      ------------------------------------------------------------
A0A3R1WG16      ------------------------------------------------------------
A0A3R3R2K7      ------------------------------------------------------------
A0A3R3TSL3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A405V7W6      ------------------------------------------------------------
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

A0A3B1C250      PTAKKQPIAKFSTPRSGSAKPKPIPAILTLPAADGKSLQGKRVEIVASSTTGDTRVTGGG
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A3R2R3E8      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A409NWS0      ------------------------------------------------------------
A0A3R1PE73      ------------------------------------------------------------
A0A3R3CX96      ------------------------------------------------------------
A0A408NUV2      ------------------------------------------------------------
A0A3R5LMR4      ------------------------------------------------------------
A0A3R5Q2V2      ------------------------------------------------------------
A0A404B052      ------------------------------------------------------------
A0A3R1PAA4      ------------------------------------------------------------
A0A3R2C7H5      ------------------------------------------------------------
A0A405AF34      ------------------------------------------------------------
A0A3R2D8P2      ------------------------------------------------------------
A0A3R2C102      ------------------------------------------------------------
A0A3R2GYI6      ------------------------------------------------------------
A0A3R2EM25      ------------------------------------------------------------
A0A3R3FNT7      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A3R2V5T0      ------------------------------------------------------------
A0A405JUY6      ------------------------------------------------------------
A0A445V3X4      ------------------------------------------------------------
A0A445VBS2      ------------------------------------------------------------
A0A407V607      ------------------------------------------------------------
T0ZG59          ------------------------------------------------------------
A0A3R3TCJ4      ------------------------------------------------------------
A0A3R4EU13      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A3R4E576      ------------------------------------------------------------
A0A404I461      ------------------------------------------------------------
A0A408J920      ------------------------------------------------------------
A0A3R1N912      ------------------------------------------------------------
A0A405ZIS9      ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A3P5W345      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3P5WKD3      ------------------------------------------------------------
A0A3R2WIS1      ------------------------------------------------------------
A0A3R5EJ70      ------------------------------------------------------------
A0A3R3UIB9      ------------------------------------------------------------
A0A409NVE8      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A3R1X0V0      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A3R2TSB1      ------------------------------------------------------------
A0A3R3XUC2      ------------------------------------------------------------
A0A407WVH8      ------------------------------------------------------------
A0A408G2L4      ------------------------------------------------------------
A0A405APZ8      ------------------------------------------------------------
A0A3R1LUZ7      ------------------------------------------------------------
A0A3R2BGD8      ------------------------------------------------------------
A0A3R2U6C3      ------------------------------------------------------------
A0A3R3W6C3      ------------------------------------------------------------
A0A407XAA6      ------------------------------------------------------------
A0A3R5H8M2      ------------------------------------------------------------
A0A3R2H5L1      ------------------------------------------------------------
A0A3R1PLZ2      ------------------------------------------------------------
A0A406JUR4      ------------------------------------------------------------
A0A409MU65      ------------------------------------------------------------
A0A3R2CMW0      ------------------------------------------------------------
A0A407T0V1      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A3R1GLT3      ------------------------------------------------------------
A0A3R3DWA3      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A3R2W4Z8      ------------------------------------------------------------
A0A3R5D942      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A404TF61      ------------------------------------------------------------
A0A406MXU2      ------------------------------------------------------------
A0A3R4Q9I0      ------------------------------------------------------------
A0A407TZB0      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A404IBN2      ------------------------------------------------------------
A0A406Y387      ------------------------------------------------------------
A0A3R1X9G0      ------------------------------------------------------------
A0A3R3ZKH7      ------------------------------------------------------------
A0A3R2WMV4      ------------------------------------------------------------
A0A3R3BQL7      ------------------------------------------------------------
A0A3R4AM40      ------------------------------------------------------------
A0A3R2HMB7      ------------------------------------------------------------
A0A3R4QTV3      ------------------------------------------------------------
A0A3R4YGM2      ------------------------------------------------------------
A0A3R1WG16      ------------------------------------------------------------
A0A3R3R2K7      ------------------------------------------------------------
A0A3R3TSL3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A405V7W6      ------------------------------------------------------------
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

A0A3B1C250      FGSSTAAGDMSKWIGEGWEKMNTEGIEAACPVWEAGLRSSTAESVVLIVGRYSGLTKAKV
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A3R2R3E8      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A409NWS0      ------------------------------------------------------------
A0A3R1PE73      ------------------------------------------------------------
A0A3R3CX96      ------------------------------------------------------------
A0A408NUV2      ------------------------------------------------------------
A0A3R5LMR4      ------------------------------------------------------------
A0A3R5Q2V2      ------------------------------------------------------------
A0A404B052      ------------------------------------------------------------
A0A3R1PAA4      ------------------------------------------------------------
A0A3R2C7H5      ------------------------------------------------------------
A0A405AF34      ------------------------------------------------------------
A0A3R2D8P2      ------------------------------------------------------------
A0A3R2C102      ------------------------------------------------------------
A0A3R2GYI6      ------------------------------------------------------------
A0A3R2EM25      ------------------------------------------------------------
A0A3R3FNT7      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A3R2V5T0      ------------------------------------------------------------
A0A405JUY6      ------------------------------------------------------------
A0A445V3X4      ------------------------------------------------------------
A0A445VBS2      ------------------------------------------------------------
A0A407V607      ------------------------------------------------------------
T0ZG59          ------------------------------------------------------------
A0A3R3TCJ4      ------------------------------------------------------------
A0A3R4EU13      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A3R4E576      ------------------------------------------------------------
A0A404I461      ------------------------------------------------------------
A0A408J920      ------------------------------------------------------------
A0A3R1N912      ------------------------------------------------------------
A0A405ZIS9      ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A3P5W345      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3P5WKD3      ------------------------------------------------------------
A0A3R2WIS1      ------------------------------------------------------------
A0A3R5EJ70      ------------------------------------------------------------
A0A3R3UIB9      ------------------------------------------------------------
A0A409NVE8      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A3R1X0V0      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A3R2TSB1      ------------------------------------------------------------
A0A3R3XUC2      ------------------------------------------------------------
A0A407WVH8      ------------------------------------------------------------
A0A408G2L4      ------------------------------------------------------------
A0A405APZ8      ------------------------------------------------------------
A0A3R1LUZ7      ------------------------------------------------------------
A0A3R2BGD8      ------------------------------------------------------------
A0A3R2U6C3      ------------------------------------------------------------
A0A3R3W6C3      ------------------------------------------------------------
A0A407XAA6      ------------------------------------------------------------
A0A3R5H8M2      ------------------------------------------------------------
A0A3R2H5L1      ------------------------------------------------------------
A0A3R1PLZ2      ------------------------------------------------------------
A0A406JUR4      ------------------------------------------------------------
A0A409MU65      ------------------------------------------------------------
A0A3R2CMW0      ------------------------------------------------------------
A0A407T0V1      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A3R1GLT3      ------------------------------------------------------------
A0A3R3DWA3      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A3R2W4Z8      ------------------------------------------------------------
A0A3R5D942      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A404TF61      ------------------------------------------------------------
A0A406MXU2      ------------------------------------------------------------
A0A3R4Q9I0      ------------------------------------------------------------
A0A407TZB0      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A404IBN2      ------------------------------------------------------------
A0A406Y387      ------------------------------------------------------------
A0A3R1X9G0      ------------------------------------------------------------
A0A3R3ZKH7      ------------------------------------------------------------
A0A3R2WMV4      ------------------------------------------------------------
A0A3R3BQL7      ------------------------------------------------------------
A0A3R4AM40      ------------------------------------------------------------
A0A3R2HMB7      ------------------------------------------------------------
A0A3R4QTV3      ------------------------------------------------------------
A0A3R4YGM2      ------------------------------------------------------------
A0A3R1WG16      ------------------------------------------------------------
A0A3R3R2K7      ------------------------------------------------------------
A0A3R3TSL3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A405V7W6      ------------------------------------------------------------
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

A0A3B1C250      PLELLGEELPIFAVCAKYRGKNAYYVLAAPSPANLKKTQKIIRSRLNIKSVKGNYPQKLV
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A3R2R3E8      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A409NWS0      ------------------------------------------------------------
A0A3R1PE73      ------------------------------------------------------------
A0A3R3CX96      ------------------------------------------------------------
A0A408NUV2      ------------------------------------------------------------
A0A3R5LMR4      ------------------------------------------------------------
A0A3R5Q2V2      ------------------------------------------------------------
A0A404B052      ------------------------------------------------------------
A0A3R1PAA4      ------------------------------------------------------------
A0A3R2C7H5      ------------------------------------------------------------
A0A405AF34      ------------------------------------------------------------
A0A3R2D8P2      ------------------------------------------------------------
A0A3R2C102      ------------------------------------------------------------
A0A3R2GYI6      ------------------------------------------------------------
A0A3R2EM25      ------------------------------------------------------------
A0A3R3FNT7      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A3R2V5T0      ------------------------------------------------------------
A0A405JUY6      ------------------------------------------------------------
A0A445V3X4      ------------------------------------------------------------
A0A445VBS2      ------------------------------------------------------------
A0A407V607      ------------------------------------------------------------
T0ZG59          ------------------------------------------------------------
A0A3R3TCJ4      ------------------------------------------------------------
A0A3R4EU13      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A3R4E576      ------------------------------------------------------------
A0A404I461      ------------------------------------------------------------
A0A408J920      ------------------------------------------------------------
A0A3R1N912      ------------------------------------------------------------
A0A405ZIS9      ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A3P5W345      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3P5WKD3      ------------------------------------------------------------
A0A3R2WIS1      ------------------------------------------------------------
A0A3R5EJ70      ------------------------------------------------------------
A0A3R3UIB9      ------------------------------------------------------------
A0A409NVE8      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A3R1X0V0      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A3R2TSB1      ------------------------------------------------------------
A0A3R3XUC2      ------------------------------------------------------------
A0A407WVH8      ------------------------------------------------------------
A0A408G2L4      ------------------------------------------------------------
A0A405APZ8      ------------------------------------------------------------
A0A3R1LUZ7      ------------------------------------------------------------
A0A3R2BGD8      ------------------------------------------------------------
A0A3R2U6C3      ------------------------------------------------------------
A0A3R3W6C3      ------------------------------------------------------------
A0A407XAA6      ------------------------------------------------------------
A0A3R5H8M2      ------------------------------------------------------------
A0A3R2H5L1      ------------------------------------------------------------
A0A3R1PLZ2      ------------------------------------------------------------
A0A406JUR4      ------------------------------------------------------------
A0A409MU65      ------------------------------------------------------------
A0A3R2CMW0      ------------------------------------------------------------
A0A407T0V1      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A3R1GLT3      ------------------------------------------------------------
A0A3R3DWA3      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A3R2W4Z8      ------------------------------------------------------------
A0A3R5D942      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A404TF61      ------------------------------------------------------------
A0A406MXU2      ------------------------------------------------------------
A0A3R4Q9I0      ------------------------------------------------------------
A0A407TZB0      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A404IBN2      ------------------------------------------------------------
A0A406Y387      ------------------------------------------------------------
A0A3R1X9G0      ------------------------------------------------------------
A0A3R3ZKH7      ------------------------------------------------------------
A0A3R2WMV4      ------------------------------------------------------------
A0A3R3BQL7      ------------------------------------------------------------
A0A3R4AM40      ------------------------------------------------------------
A0A3R2HMB7      ------------------------------------------------------------
A0A3R4QTV3      ------------------------------------------------------------
A0A3R4YGM2      ------------------------------------------------------------
A0A3R1WG16      ------------------------------------------------------------
A0A3R3R2K7      ------------------------------------------------------------
A0A3R3TSL3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A405V7W6      ------------------------------------------------------------
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

A0A3B1C250      RIIDRGR
A0A1J5RCY3      -------
A0A1J5RUE5      -------
A0A0F9JKD8      -------
A0A0F9XPI6      -------
A0A2H9TBF4      -------
A0A3R2R3E8      -------
A0A1J5SM24      -------
A0A3B1C7A9      -------
A0A1J5SPZ5      -------
A0A409NWS0      -------
A0A3R1PE73      -------
A0A3R3CX96      -------
A0A408NUV2      -------
A0A3R5LMR4      -------
A0A3R5Q2V2      -------
A0A404B052      -------
A0A3R1PAA4      -------
A0A3R2C7H5      -------
A0A405AF34      -------
A0A3R2D8P2      -------
A0A3R2C102      -------
A0A3R2GYI6      -------
A0A3R2EM25      -------
A0A3R3FNT7      -------
S0DG33          -------
A0A3R2V5T0      -------
A0A405JUY6      -------
A0A445V3X4      -------
A0A445VBS2      -------
A0A407V607      -------
T0ZG59          -------
A0A3R3TCJ4      -------
A0A3R4EU13      -------
A0A3B1AK25      -------
A0A3R4E576      -------
A0A404I461      -------
A0A408J920      -------
A0A3R1N912      -------
A0A405ZIS9      -------
A0A380TGM5      -------
A0A3P5W345      -------
A0A380TDI0      -------
A0A380TDN3      -------
A0A3P5WKD3      -------
A0A3R2WIS1      -------
A0A3R5EJ70      -------
A0A3R3UIB9      -------
A0A409NVE8      -------
A0A0F9U8M8      -------
A0A381Y0U7      -------
A0A381Z3K5      -------
A0A0F9UWR4      -------
A0A3R1X0V0      -------
A0A0F9LFA5      -------
A0A1J5R1Y0      -------
A0A160TC29      -------
A0A3R2TSB1      -------
A0A3R3XUC2      -------
A0A407WVH8      -------
A0A408G2L4      -------
A0A405APZ8      -------
A0A3R1LUZ7      -------
A0A3R2BGD8      -------
A0A3R2U6C3      -------
A0A3R3W6C3      -------
A0A407XAA6      -------
A0A3R5H8M2      -------
A0A3R2H5L1      -------
A0A3R1PLZ2      -------
A0A406JUR4      -------
A0A409MU65      -------
A0A3R2CMW0      -------
A0A407T0V1      -------
A0A0F9VQU4      -------
A0A1W1DYN8      -------
A0A1W1E4Z5      -------
A0A3R1GLT3      -------
A0A3R3DWA3      -------
A0A2H9T6C5      -------
A0A3R2W4Z8      -------
A0A3R5D942      -------
A0A0F9KY21      -------
A0A404TF61      -------
A0A406MXU2      -------
A0A3R4Q9I0      -------
A0A407TZB0      -------
A0A0F9W5Q6      -------
A0A404IBN2      -------
A0A406Y387      -------
A0A3R1X9G0      -------
A0A3R3ZKH7      -------
A0A3R2WMV4      -------
A0A3R3BQL7      -------
A0A3R4AM40      -------
A0A3R2HMB7      -------
A0A3R4QTV3      -------
A0A3R4YGM2      -------
A0A3R1WG16      -------
A0A3R3R2K7      -------
A0A3R3TSL3      -------
A0A3B0VME9      -------
A0A3B1DSR1      -------
A0A0F9I1G8      -------
J9FGR8          -------
A0A0W8FS74      -------
A0A3B0V744      -------
A0A405V7W6      -------
A0A1W1D4H7      -------
A0A3B1CUQ0      -------
A0A1W1BK27      -------
A0A1W1CD04      -------
                       

© 1998-2019