BYKdb

Dataset for cluster orphancd of phylum nitrospirae

[Download (right click)] [Edit] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G3XWL5      MKIEREKPNFVISEGTVGFDLSEENYFQTQCKVLKSRNLAKRIIRSLGLDTNPEFIQDME
A0A0F2J1D3      ------------------------------------------------------------
A0A419GMT6      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      NKKSSSNENIILAINRPSEKEIEPKLIDVFIGSINVNPVQRSSLVNVSFASDNPELSARV
A0A0F2J1D3      ------------------------------------------------------------
A0A419GMT6      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      ANTIGESFIELNIESRFEATYKAREWLQGQINIMKAKLEQAEEALNKYASAHGIIFLDEN
A0A0F2J1D3      ------------------------------------------------------------
A0A419GMT6      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      EKGVENENIITKRLSELSTHHTEASADRMNKEALYNTVRSDDSDSSPVVMGNSLIMELKK
A0A0F2J1D3      -----------------------MELAKRIVIDAITIEVYK-------------------
A0A419GMT6      --------------------------ADRISKEAIYKEVRKSDVDYGVVLQDPLIRSLTD
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      NLASLESEYNQKLKTYKPAYPKMVKLKEQIDQIKKKMDSEAKKIITGVKKDYDAALKREK
A0A0F2J1D3      --------------------------------------------------------EKTK
A0A419GMT6      RYVNLESEYFNLLQVHKPEYPKMIRLREQMEKLKETIGTQEQKIINTLSSDYQLALKKEK
A0A2H0YJQ4      ---------------------------------------------------------MSK
A0A2M7FB38      ---------------------------------------------------------MSK
A0A2M8DK40      ---------------------------------------------------------MSK
A0A3C1G280      ---------------------------------------------------------MSR
A0A2H0YFB4      ---------------------------------------------------------MRS
A0A2M7FBY9      ---------------------------------------------------------MRS
A0A1G1GRK8      ---------------------------------------------------------MSR
A0A419FNZ3      ---------------------------------------------------------MSK
A0A2U3QDU5      ---------------------------------------------------------MSR
A0A0S8DM58      ---------------------------------------------------------MSK
A0A3A4WKT5      ---------------------------------------------------------MSK
A0A0K2GDM9      ---------------------------------------------------------MKD
A0A1G1I4J7      ---------------------------------------------------------MSK
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      -----------------------------------------------------------M
                                                                            

A0A1G3XWL5      YLKSEFEVQKKEAINLKDYFVQYQILKREVDTNRELYNGLLQKLKETGVSETLKASNIQV
A0A0F2J1D3      ILKNYLSKYKEELIKLPAISEDNAKVNLELSVNKDIYQKLLEYILQIEIAESMTMSDRIL
A0A419GMT6      FLIAAIEKLRNEVSNLQDKIVQIQILKREVDTNSELYNALLQRLKEVGVSAALTESNVQV
A0A2H0YJQ4      IEEALEKAKQARSGVKENKAVPEAPEETAPRYTHTVFKEVNP---------DMMEENRIV
A0A2M7FB38      IEEALEKAKQARSGVKENKAVPEAPEETAPRYTHTVFKEVNP---------DMMEENRIV
A0A2M8DK40      IEEALEKATRER----QG-GGHEAGGVPQRSSVREAHTAVVAEVAVVNPDPLHLAENRVV
A0A3C1G280      IEQALEKAIKMR----ESMAGGDTGDMLTAMPHKPAQTEFEAGEVRVD---LKGIDRHIV
A0A2H0YFB4      IEKGLEKAIRER----ESRSSPDLF-----KLQKEWNDKSLD---------FSKLSAYLV
A0A2M7FBY9      IEKGLEKAIRER----ESRSSPDLF-----KLQKEWNDKSLD---------FSKLSAYLV
A0A1G1GRK8      TENALEKASRIR----RSPQPVPAG-----RNGEPAATGAQG---------ARIEHPHLV
A0A419FNZ3      IEEALEKANKLR----GPSGDVKSR--------LMDISRRPE---------HQVENEYLV
A0A2U3QDU5      IERALEKANMVR----DREEPVLPEQSVGQADITDVFVTDNT---------ELPKNPYLV
A0A0S8DM58      IEEALEKANKLR----ASNVRKKTQ-------SLNIFERVEP---------REVENDYLV
A0A3A4WKT5      IEEALKKANILR----ESYGNTGNV-------KAHIPSDGEI---------IKTDNQYLV
A0A0K2GDM9      VNPALRAVP--P----PESGSSSAYQRGDSRGDAPVLEKMLG---------RAKPDEHLV
A0A1G1I4J7      IEEALAKIQSKP----RPGGAREPL----PRVDLPAAMNVDR---------DAFIERRIV
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      IKGFIEKIMEMKDNLRRD---------------------------------NLLPHEKTI
                                                                            

A0A1G3XWL5      IDRAEIPESPYKPNKRLNIILSIIVGLFGGIGLAFFVEYLDNTIKTPEDLEKRVSLPTLG
A0A0F2J1D3      VEPAELPEEQKYPWNKLNYILGFILAVFWAFTVALFLEYIDDTIKDPDELKQTSKQPLLG
A0A419GMT6      LDRAQVPRSPFKPKKGFNAALSLILGLFGGVFLAFFVEYFDQTIRTPQDVEKWSRLPVIG
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      FIPFHGDYEGDLPVEYITHADSKSPVSEAYCTLRTFLLLSTGGR-PPRIIAITSPAREEG
A0A0F2J1D3      SIPKTKVF---KDIKNISNLPPTSPFVEAYRTIRNSLLFASIDK-PVKTFLVTSSIEKEG
A0A419GMT6      MVPLIKDN---LRESSSSVSDNTQVLTESFRSIGTWIKFANSSV-KPRQILVTSPLEGEG
A0A2H0YJQ4      -----------------TLAGKSSHITEQYRMLRTQILQRTEGN-GDNCLMVTSAADGEG
A0A2M7FB38      -----------------TLAGKSSHITEQYRMLRTQILQRTEGN-GDNCLMVTSATDGEG
A0A2M8DK40      -----------------VASGPSLGASDAYRQLRATLMLAADHQ-RL-AFVVTSPLQGDG
A0A3C1G280      -----------------SLTDPYSQGAEEYRKLRVRLLRATQKN-FLNTIMVTSSGVGEG
A0A2H0YFB4      -----------------TILDSKSLAAEQFKRLRTQVMKKMRSR-MENTLMVTSATRGEG
A0A2M7FBY9      -----------------TILDSKSLAAEQFKRLRTQVMKKMRSR-MENTLMVTSATRGEG
A0A1G1GRK8      -----------------TSRSTFSPVAEEYKKLKARVMRMTKQEPFRNVLLVTSSVGGEG
A0A419FNZ3      -----------------TITRPDSPVAEEYRRLKSILIRETKAD-FLNTIMVTSSVDGEG
A0A2U3QDU5      -----------------TLNEPDSPIAEEYKKLKSMVVKMTKQGKFQNTLMVTSTVAEEG
A0A0S8DM58      -----------------SLNEPNSPVAEEFRKLKSMLLRITKKD-FLNTVMITSSISGEG
A0A3A4WKT5      -----------------TLTQPGSPVAEEYRRLKSMLIRETKAN-FLNTVMITSAVEAEG
A0A0K2GDM9      -----------------SLLTPATFEAEQYRTLGLMLEQRRQTG-LLQVVAMTSPTMGDG
A0A1G1I4J7      -----------------TAVFESGPAVEEYKKLRTRVLAWLRAA-EGNVVMLASAGGKEG
A0A1G1F9B9      -------------------------ISEAYSSIRTLLLFSTAGK-PPKVMMITSPLREEG
A0A1G1GZ72      -----------------RSGNIQTVITEQYRLLRSRLSSLNGSH-GNKVIAVTSTQKGEG
                                           : :  :   :            . ::*.   :*

A0A1G3XWL5      KTTTAINTAISFAR-SGAKVLIIDADMRRPKLHRLFDVDNT-SGLSTYLSGIE-ELTEDL
A0A0F2J1D3      KSSIASNLAVTFSA-EDKNVLLLDLDLRRPSAHTFFNKTSA-KGITNVLADTM-TL-DEA
A0A419GMT6      KTLVSINTAMSLLN-VVGKGVIIDADFRRPCVHTSLDLDNS-TGLSSFLSGTS-EF-DQL
A0A2H0YJQ4      KTTTAINLAVSIAQEVQKNVLLVDADLRRPSIHKMLGLKPE-KGLVHYLMDQV-PL-EDL
A0A2M7FB38      KTTTAINLAVSIAQEVQKNVLLVDADLRRPSIHKMLGLKPE-KGLVHYLMDQV-PL-EDL
A0A2M8DK40      KSITTLNLGYAIAQELQLDAVVVDTDLRRPVLAKFLGIEGQ-RGVSDYLNDPSVTL-DDV
A0A3C1G280      KSITAINLAVSIANEIDHTVLLVDGDLRRPSLHRYLGIEPS-LGLSDYLMGKT-AL-SNA
A0A2H0YFB4      KTTTALNLAVSVAQGMNETVLMMDTDFRKPGVHTYLGIEAK-KGLVDFLRGEA-EI-PEL
A0A2M7FBY9      KTTTALNLAVSVAQGMNETVLMMDTDFRKPGVHTYLGIEAK-KGLVDFLRGEA-EI-PEL
A0A1G1GRK8      KSVTAANLALSLARDYDHSVVLIDADTRKPSLHTLLNVKPG-IGLADCVADDI-DI-GSA
A0A419FNZ3      KSLTAVNLAITLAQEIDHTILLIDADLRKPMIHEYLGISHK-YGLADYLSGDI-DF-SEI
A0A2U3QDU5      KSITAMNLAITLACEYDHTVLLVDADLRRPSLSHLLGIETS-PGLSDCLLNGL-DI-KDA
A0A0S8DM58      KTITAINLAVTIAQEIDHSILLIDADLRRPMIHNYLGMNPK-YGLSDYLLKDI-DI-SEI
A0A3A4WKT5      KSLTAVNLALTLSQEIDHTILLVDADLRKPTLHEYLGISCK-YGLSDYLTRDI-DL-SEI
A0A0K2GDM9      KTLTAINLAGAVSQSPSARVLLMDVDFRKPSIAAQLGLRDNIVGLRDAALNAGLRL-KDV
A0A1G1I4J7      KSLTAVNLAVSVARELHQTALLIDADLRRPHLHQLLDVKGQ-PGLSDFLMGEG-DL-SGL
A0A1G1F9B9      KTTTAINTAISLTK-SDARVIIVDADMRRPRLHKVFKVENI-SGLSSFLSGNT-EFSEEL
A0A1G1GZ72      KSITSVNLAIVMAEDTKKKVLLIDGDMRKPSIHAFFNCKSE-YGLVDLLTNKI-DI-ESI
                *:  : * .  .        :::* * *.*     :       *:          :    

A0A1G3XWL5      MKETNIPNLHVITSGPIPPNPAELLNSLRLKELINSL---YLYNFIIFDTPPVIGLPDSL
A0A0F2J1D3      IEKTDIKGLDLLLSGPIPPDPSRLIESEKIKNIIEALKQKYS--LIIIDTPPVVSVNDAV
A0A419GMT6      IKKSSVTGLDVITSGPMPHNPSEVLNSDRMRELMDALSAMYD--FIVIDSAPLLGLSDSL
A0A2H0YJQ4      LIRTGVEKLTFLPAGGTLPNSTEIFNSSRMKNFIREVKDRYKDRYVIFDTTPILSTADPV
A0A2M7FB38      LIRTGVEKLTFLPAGGTLPNSTEIFNSSRMKNFIREVKDRYKDRYVIFDTTPILSTADPV
A0A2M8DK40      VVRLAGGPLWVSAGTVRLHNTSELLGSRRMEQFCGELRHRFPTAILLFDSPPILPAPDAM
A0A3C1G280      LVRTGVGKLVLLPAGTPPQNPSELLSSERMKETVRELKNRYKDRYVIFDSSPVLATADTL
A0A2H0YFB4      LVKTEIPKLILLPSGQPPENPSELLSSERMSQLIREIKSRYEDRFIILDTSPINVFTDAS
A0A2M7FBY9      LVKTEIPKLILLPSGQPPENPSELLSSERMSQLIREIKSRYEDRFIILDTSPINVFTDAS
A0A1G1GRK8      LVKVGNGNLQFVPAGKRHENPVELFSSQRMRTVILEMKSRYPDRYIIIDTPPVLLFAETK
A0A419FNZ3      VVKAGIGNLMFIPAGHVAVNPVELLASEKMNAFIKEIKHRYVDRYVIIDTPPILPFADAI
A0A2U3QDU5      LVKTGIGKMVFLPSGSHVSDPVELLLSRRMQELLSDIKHRYADRYVIIDTPPVLPFAEVH
A0A0S8DM58      LVKTGIGKMVLLPAGKTVPNPQELLSSVKMEYLIKELKQRYMDRYIIIDTPPILSFAEAI
A0A3A4WKT5      LVKTGIGNLLIIPAGHTVENPVELLSSVRMKTLIHELKHRYMDRYVIIDTPPILPFADAI
A0A0K2GDM9      VRRHPAWNLSIATAGRAQGLPHEIIKSARFAELLNEARRDYE--WIFLDTPPLMLAPDCL
A0A1G1I4J7      FHSTGIPKLTLVPAGTPTARSPELLASQRMSEFLEEVRRRYKDRIVILDAPPVLPATDAV
A0A1G1F9B9      IKHTDVPWLDVLTSGPLPPNPAELLSSSRFRDLIDGLHPLYN--FILFDTPPMLGLADAA
A0A1G1GZ72      LVPSGVNNLTILPAGGPVESPSDIIANPRFKEGIERLKKRFD--YIIMDSPPIIPFADMN
                .       : .  .      .  :: . .:          :    :.:*:.*:    :  

A0A1G3XWL5      ILSSYTDGVMLIAKSGKTTKETTLETRRMLEAVGAKILGIVLNAVDQSAMRYSHYYNYYR
A0A0F2J1D3      VIGKLVDGAVYVVEAGRASGSMVNHFVDAASKANINIFGLILNKFRPHASNYYHYYQHYR
A0A419GMT6      ILSASVDSVMLVVKSGQTPKDALIQSNKVLLKVATKILGVVLNG-TDIKKKYGYSYCHTS
A0A2H0YJQ4      VLSQSMDGIIFVVQADRTQRGDLAEALALLQGRN--ILGIVMNNHSDTGETYYYEA----
A0A2M7FB38      VLSQSMDGIIFVVQADRTQRGDLAEALALLQGRN--ILGIVMNNHSDTGETYYYEA----
A0A2M8DK40      TLVQWLDGGIIVVSAGKTSRRALSDAVRQFGANR--IAGVVVNRSDRSSYGYGYGYRYYY
A0A3C1G280      SLSNYMDGIIFVVQASETSPRDAQRALSLIKGRP--VLGAVFN--NVPPYLAKSHQRYSY
A0A2H0YFB4      ILIPLVEGVLMVVQDGVTPREYVLRAISQIEREK--LLGICLNMISAP--ESLQDSYYYY
A0A2M7FBY9      ILIPLVEGVLMVVQDGVTPREYVLRAISQIEREK--LLGICLNMISAP--ESLQDSYYYY
A0A1G1GRK8      MISALADGIIFVVREGLAPLQHIIEALDLLKEEQ--LLGIVYNDAGPEGVNGTYPYHSYY
A0A419FNZ3      AVGSVVDGVVFVIKEGRTQKKSIENAMNLMRNLR--VLGIVFNHASEENLDGHYYNTYYY
A0A2U3QDU5      SLASGVDGLIYVVREGLAPLNGIKEALGMLKGCN--VLGFVFNGVELDMMDDYHRYYNYR
A0A0S8DM58      SIGHCVDGVIYVVKEGQTQRKAVQNGLHLLKDIN--VFGVIFNAVRGMNSNGYHKGTDYY
A0A3A4WKT5      SLGSLVDGVLFIVKEGRIQKKSLENAVHLIKDLK--ILGVVFNYAHAENLEGHYSRYYYY
A0A0K2GDM9      ILGRNVDGFLMVVYANKTSRQEVAEALNSLGPSK--LLGLVYNGDDRLLSSYNYGAYYMT
A0A1G1I4J7      ILANHVDGIVFVVRAGGSAREDVQQAVRQFDPRK--VIGVALNGAVDTGHYSAYGYHYVT
A0A1G1F9B9      ITSTHTDGVILVVRSGQTPKEAAQQARKILDSVNAKVLGVVLNAINESNFKYGYYSYYQY
A0A1G1GZ72      ILGDIVDGILLVVKAETTPKERVVDALKSLNKEN--IIGVVLNDSKKRLTKIYY------
                      :. : :                        : *   *                 

A0A1G3XWL5      SYYRSYGDENKK---------
A0A0F2J1D3      YYKK-----------------
A0A419GMT6      YGNDKQVKKIPFIIKAS----
A0A2H0YJQ4      ---------------------
A0A2M7FB38      ---------------------
A0A2M8DK40      GGYGYGGEGAPTAETGEKDG-
A0A3C1G280      QYAGKAKPEKSNGGSGEHDEP
A0A2H0YFB4      RDYDKEGK-------------
A0A2M7FBY9      RDYDKEGK-------------
A0A1G1GRK8      RHYHSRT--------------
A0A419FNZ3      NRTKK----------------
A0A2U3QDU5      RYYSRGGNGKK----------
A0A0S8DM58      AY-------------------
A0A3A4WKT5      NYKKKEKK-------------
A0A0K2GDM9      PE----SG-------------
A0A1G1I4J7      SPVMAGVG-------------
A0A1G1F9B9      YYQNYGSSEEK----------
A0A1G1GZ72      ---------------------
                                     

© 1998-2019