BYKdb

Dataset for cluster tadcd of phylum nitrospirae

[Download (right click)] [Edit] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G1E4S2      -----------------------------------------------MELKKIFEIIWAR
A0A349BQG7      -----------------------------------------------MELKKIFEIIWAR
A0A1G1HPN4      -----------------------------------------------MELKKIFEIIWAR
A0A354F6L6      -----------------------------------------------MELKKIFEIIWAR
A0A1G1HUY8      -----------------------------------------------MELKKIFEIIWAR
A0A1G1GFA6      ----------------------------------------MLFKNDNLHLLDYWRVLSKR
A0A419FND3      ------MSNIESTIEKATKLRQFISPVKGETLTPENVRLYIEDKDKSPHLRDYFEVILRR
A0A1G3XRU6      -----------MSNHEEKSSSQANIQKIEEFPVSTSLNLAPEEKEEEIHLRDYLHILLRR
A0A0S4L511      -------------MTRDDDSISPQ---------------SAESNGRETVLAEYAGACRRR
A0A2N6GR48      -------------MDRNAEFIPHQ---------------SAQGDAAETALTDYVGACRRR
A0A0K2GIJ9      -----------MERRNGLPADRTA---------------PGAADEPEHPLREYASACRQH
D8PGN0          --------------------MNAK---------------AVMSDESEHTLSEYATACWRH
A0A136JVD6      --------------------MNAK---------------PMVLDEAEQTLSEYATACWRH
A0A3A0BU62      --------------MVKGDSVNAK---------------PMVLDEAEQTLSEYATACWRH
A0A3A4W5D3      ------------------MNTIPQSYP---------------EDKKDIHLYDYLEVLIRR
A0A3N5I7D6      MDKRRNKDSNLLSVSRPGVETSVTPYLRPAEPTVPYYGFS--ESKDDSALVEYWTAIYRR
A0A0S8DH48      --------------------MDVFRYDTQEI-----------QEEPQIDVRHYLRVVHKR
A0A1G1HA47      MRNRKNDDIK--------DRLEIQRYDRRDLPLSTHLEYLDHKVTEEVHLRDYLNVILKR
                                                                 :         .

A0A1G1E4S2      KWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGME----DIAPSL
A0A349BQG7      KWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGME----DIDPSL
A0A1G1HPN4      KWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGME----DIAPSL
A0A354F6L6      KWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGME----DIAPSL
A0A1G1HUY8      KWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGME----DIAPSL
A0A1G1GFA6      RYAAIIVFAFIVGIVTVYSFVATPVYKGSAQILINLEKNP-------TMTFSEGDVAYLQ
A0A419FND3      KWIVLGFLLTVVMTVALLSFLTKPLYKATTTLQIKSENTN-------ILTF---KDVYQG
A0A1G3XRU6      KWTFITFFIVIITTVLIGTFMTTPIYRSTATIKIDRENPQ-------VLKF---EDIYKI
A0A0S4L511      VWLIVVIVVGCAAAAAVWSFMQIPRYQAKATVVVEQVGRS-------GLEY---DRDYRQ
A0A2N6GR48      IWLIVAFAGGVAVVAAVWSLLQTPLYQAKATVVVNQEGPS-------ALDK---DRGYNP
A0A0K2GIJ9      ARLIVLIGCGFAAAAGMWSVLQTPVYQSRATVVIESQAPG-------GLEK---DKSYYH
D8PGN0          RWLIVLVVGCFGIGAAVWSFLQVPVFQAKATVVIDNPTPG-------GLDK---DKSFYP
A0A136JVD6      RWLIVLVAGCFGFGAAVWSFLQVPVYQAKATVVIDNPTPG-------GLDK---DKSFYP
A0A3A0BU62      RWLIVLVAGCFGFGAAVWSFLQVPVYQAKATVVIDNPTPG-------GLDK---DKSFYP
A0A3A4W5D3      KWVVIIFFTVLVATVAVSTYRMTPIYESDTTLLIEEKEPWEGTNIL--------TEFAGM
A0A3N5I7D6      KFLVLAVAALGALAGYIKNLPQQPVYQAVATLEVQDKNE--SFLNI--------GD---L
A0A0S8DH48      RWTIIATFVIVLLTVAINVFTEEPLYQANARMIIEKSNP--NIVSI--------QEVMAI
A0A1G1HA47      KRIVLVFSICIVIITVILTFMMTPLYKSTAVVRIEGESP--NVLSV--------NGVTGV
                    :           :      * : . :   :.                         

A0A1G1E4S2      SRFSVDSME-----NVIAQVTLLPYMENMIGKLQLRNE-------------ENELMLP-Q
A0A349BQG7      SRFSVDSME-----NVIAQVTLLPYMENMIGKLQLRNE-------------ENELMLP-Q
A0A1G1HPN4      SNFSVDSME-----NVIAQVTLLPYMENMIVKLQLRNE-------------ENELMLP-Q
A0A354F6L6      SNFSVDSME-----NVIAQVTLLPYMENMIVKLQLRNE-------------ENELMLP-Q
A0A1G1HUY8      SNFSVDSME-----NVIAQVTLLPYMENMIGKLQLRNE-------------ENELMLP-Q
A0A1G1GFA6      MKDSDDYFR-----TQIEILNSRGFADKVVKKLLLDKN-------------PYYLEKKSK
A0A419FND3      EMPAEEYYE-----TQYNILKSRNLAKRAVTKLPPEKA-------------SEA-----A
A0A1G3XRU6      EMGEDDYYQ-----TQYKILKSRNLAKRVIRTLKLGEE-------------PEF-----G
A0A0S4L511      GDLSPEYFQ-----TQFELMKSHYIFQRTAQLLHLSEQ-------------PEY-----K
A0A2N6GR48      -DLTPEYFQ-----TQFELMKSHHVFLRTAQLLHLSER-------------PEY-----K
A0A0K2GIJ9      LDNSPEYFQ-----THFELLKSHQVIRRAVDQLKLSNR-------------PEY-----Q
D8PGN0          -DNSPEYFQ-----THFELMKSHFVLQRTARLLDLAER-------------PEY-----Q
A0A136JVD6      -DNSPEYFQ-----THFELMKSHFVLQRTARLLDLAER-------------DEY-----Q
A0A3A0BU62      -DNSPEYFQ-----THFELMKSHFVLQRTARLLDLAER-------------DEY-----Q
A0A3A4W5D3      KPSKVQ--------TEIEMIKSRTIAEKVVKKLYYDINIFDVSGNLNPQITDVTIPDNRI
A0A3N5I7D6      DPNAQRYSADSKLLTEMKMLEGRQLRQRVHDKLALQSD-------------DA-------
A0A0S8DH48      DTWDPDYKE-----TQYKIIESRSVARRVIKKLNLAES-------------EEFNPAPKT
A0A1G1HA47      -PLGADYYQ-----TQYEILKSQSLAEKVIRNLSLDKN-------------KDFLP----
                              .    :       .    *                           

A0A1G1E4S2      NLISTGILYQIRSSIFP-------------------------------------------
A0A349BQG7      NLISTGILYQIRSSIFP-------------------------------------------
A0A1G1HPN4      NLISTGILYQIRSSIFP-------------------------------------------
A0A354F6L6      NLISTGILYQIRSSIFP-------------------------------------------
A0A1G1HUY8      NLISTGILYQIRSSIFP-------------------------------------------
A0A1G1GFA6      P--DNGMINKIKDTVFMLFPG-RTK----------------------------PDNPFPE
A0A419FND3      PVEGPSMMQAVFG---------SIF----------------------------NFGEKPE
A0A1G3XRU6      G--NAGLSHKV-----------ASV----------------------------ASVDVSK
A0A0S4L511      P--RPSILSSTMGDILPAAVA-GVV----------------------------GFKGDVD
A0A2N6GR48      P--NPSALQSLLSSIFPAPPSLDAV----------------------------GPKNGAS
A0A0K2GIJ9      P--QPS----LLDKVLPKWVQ-AWW----------------------------QPKKKEG
D8PGN0          P--KPSAIKQFLKSLLPDSVL-AFV----------------------------KPVKKEA
A0A136JVD6      P--KPSVIRQFVKSLMPESVL-AFV----------------------------RPPKKEE
A0A3A0BU62      P--KPSVIRQFVKSLMPESVL-AFV----------------------------RPPKKEE
A0A3A4W5D3      GKIFAVTFQDNERFIVTDDSLDKDKVIGSGRTGHPFSGGKDISFTLNNAGAGRDASFKIK
A0A3N5I7D6      -------------PLLPDDQLSKWL--------------NSIGFDAIGESPTRAGALEMA
A0A0S8DH48      GVI--VSLKSSIRGM-----LSSLK--------------KAVKGLIKTEPKVAQKPGLMS
A0A1G1HA47      --V--QSIPDKAKELIFNNTLGLLS--------------RLYSSFIVSDHPVREGPVQKV
                                                                            

A0A1G1E4S2      ---------------VRHIEVLPYKETNMFQINATSRDPEEAMMMANTLAGVFISELQKL
A0A349BQG7      ---------------VRHIEVLPYKETNMFQINATSKDPEEAMMMANTLAGVFISELQKL
A0A1G1HPN4      ---------------VRHIEVLPYKETNMFQINATSKDPEEAMMMANTLAGVFISELQKL
A0A354F6L6      ---------------VRHIEVLPYKETNMFQINATSKDPEEAMMMANTLAGVFISELQKL
A0A1G1HUY8      ---------------VRHIEVLPYKETNMFQINATSKDPEEAMMMANTLAGVFISELQKL
A0A1G1GFA6      SLAQREIDPELVDIILSEMRVETGKEGNIIKIHYLSENPNVAVAMANGIAAAYIEHNMYI
A0A419FND3      NGREDEREAAQINSFIKRIEIQPIKKSQLINISFVSRDPAFASLAANTLADEYINFSLES
A0A1G3XRU6      QNMSEGINKRFVDGFLGRVTVTPEQRSRLVKVSFDSPNQELSAKVANEIAKLYIQFSIES
A0A0S4L511      AQVLGDEDERLLKQFAEAIEIVPIRGARLAHVMATSNDPEFAARIANTLASTYIERTQEL
A0A2N6GR48      EPSSEEVDDRLLKHFSETVEIVPIRGARLAHVVATSEDPKFAAQVANTLASVYIERTQEL
A0A0K2GIJ9      PLAEEAEQERLLKAFLNNVEIMPIRGARLAHVTVSSVDPAFAALAANTLVSVYVERNQEL
D8PGN0          VDSVDDAEEALIKQFAQDIEIMPIRGARLAHVTANAIDPELAAQIANTLVSVYIERNQEL
A0A136JVD6      VDPADDAEEALIKQFAQDIEIMPIRGARLAHVTANAIEPELAAQIANTLVSVYIERNQEL
A0A3A0BU62      VDPADDAEEALIKQFAQDIEIMPIRGARLAHVTANAIEPELAAQIANTLVSVYIERNQEL
A0A3A4W5D3      KES----FYSSVNKLMAATSVAPVKSTNVVKISTRDSNKQMAADMANSIVEFYRQHDIRA
A0A3N5I7D6      AAT---------------LTVSNPRMTRIVHLQSDSTDPIVASDFVNTLAQTYIDYTIEN
A0A0S8DH48      DEEERLPDSGLVSAFIGRISVSPVRDSRLVDIGFTARDPEVAVRTVNALAQAYIDHNMEL
A0A1G1HA47      SPSENAIPTYLINSLIDRLEVTPIKNSQLVKVSFLSDDPEISMNVTNAVAESFIQLDLES
                                    :   .  .:  :     :   :   .* :.  : .     

A0A1G1E4S2      TRQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTV---NLDQEISIAIAKMSELM
A0A349BQG7      TRQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTV---NLDQEISIAIAKMSELM
A0A1G1HPN4      TRQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTV---NLDEEISIAIAKMAELM
A0A354F6L6      TRQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTV---NLDEEISIAIAKMAELM
A0A1G1HUY8      TRQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTV---NLDEEISIAIAKMAELM
A0A1G1GFA6      RIKPFRDAVEWLSARMVELRAKVESSERTLQKYKEERGIA---SFETRENIIAQKLQELV
A0A419FND3      KVGPTLVARKRLEEQVEATRSRLEASERQLNDYIARGQIVFLGKKGDDESLLNQKLAELS
A0A1G3XRU6      RFEATQQARDWLQEQLEDMKAKVERSEEALNKYAADNGIIFLTEGETTETKTVQGQNIIT
A0A0S4L511      NALSKEKAAAWYIAHLDELRKKAEDSQQALYQFRLKHGLM---GGREQQTARAHTNTELD
A0A2N6GR48      NALSKEKAVQWFTNNLEGLRKKAEASQQALYLFRVKHGLL---GGRDRQSVTAQTNSDLD
A0A0K2GIJ9      SSIAREQAARWFTTHLEGLREKVQAAQEALYLYRAKHGLL---TGEERKSLAGQTMAELN
D8PGN0          STNSKEQAAQWFTGHLEELRQKVQNSQQALYLFRAKHGLL---TGEERKTVAAHTLAELN
A0A136JVD6      SANSKEQAAQWFTTHLEELRQKVQNSQQALYLFRAKHGLL---TGEERKSVAAHTLAELN
A0A3A0BU62      SANSKEQAAQWFTTHLEELRQKVQNSQQALYLFRAKHGLL---TGEERKSVAAHTLAELN
A0A3A4W5D3      RSQQALQVIHFVDKQLDTVQGKVDDSLSALAEYKSSAGVT---DLGEGTRAIIKNVTDLE
A0A3N5I7D6      RLDSYQKVGLWLNQQLSDIQSTLQKSEDQLIKYSKESGLL-------LTEGVDLKMNHIQ
A0A0S8DH48      RLGTIQDAMAWMNERIEEERRKVEASERKLQEYREQEGIV-TEFSGEVETVTAQKLAQLN
A0A1G1HA47      TVGASKDARDFLKEQIEIMKDKVEESEKRLNDYASKKEIV---FDKADQNLITQKLSDLS
                       .      .:   .     :   *  :                         : 

A0A1G1E4S2      KQKEDNIIDLAEEEARLKALKGQGNIKGD----------LGITPEALVDNPQIKILMDRL
A0A349BQG7      KQKEDNIIDLAEEEARLKALKGQGNIKGD----------LGITPEALVDNPQIKILMDRL
A0A1G1HPN4      KQKEDNIIDLAEEDARLKALKGQVNIKGD----------LGITPEALIDNPQIKILMDRL
A0A354F6L6      KQKEDNIIDLAEEDARLKALKGQVNIKGD----------LGITPEALIDNPQIKILMDRL
A0A1G1HUY8      KQKEDNIIDLAEEDARLKALKGQVNIKGD----------LGITPEALIDNPQIKILMDRL
A0A1G1GFA6      SEVVRIEGRRQEAEIRYNQIKSVIDSPEL-----------LATVPDVMNNLVIQGLRIEE
A0A419FND3      RELDTATANRISREAVYQEAKRSGTNYNF-----------------VLENPLIQALTKDY
A0A1G3XRU6      RKLAELSTELVQATSDRISKEALYREAQQGEGSL---------LSAVQGNPLIQTLKKDH
A0A0S4L511      SELVRAEMKQAEAKSRLEQIESILRSRTGHNGAIETDWSSLDASTEVLSSTLMQTLRAQD
A0A2N6GR48      SELVKAEMKRAEAQSRMEQLQSVLRNRTDRNGVIEIDWSSLDALTEVLSSPLIQTLRAQE
A0A0K2GIJ9      SQLVKTEMAKAAAYSRLQQVESALNTQGQ--PGSGGGWPELDSLTQVLNSQLIQMLRAQE
D8PGN0          SQLVKTEMAKAEAHSRFLQIRAVLNPQGA--GTAGVDWSKLDSQIQVLNSPLIQTLRAQE
A0A136JVD6      SQLVKTEMAKAEAHSRFLQIRSVLNPQGA--GTAGLDWSKLDSQIQVLNSPLIQTLRAQE
A0A3A0BU62      SQLVKTEMAKAEAHSRFLQIRSVLNPQGA--GTAGLDWSKLDSQIQVLNSPLIQTLRAQE
A0A3A4W5D3      KARAQLQVEKYQVGSLYEEIRKNISSV-------------SPSALSVFNDPVVENMIIRL
A0A3N5I7D6      TQLLDADTDVLNKKFKYEMARSLDPNS----------------VTPILEDSLVGAYRMEL
A0A0S8DH48      SQVVQAESSRVEAETRYKQALQLKDNPLI-----------LDSIPEVLSNSLIQSIKKSE
A0A1G1HA47      AALNSITAERMQKEGLYREVRESGASN-----------------PVILGNQLILGLKKDF
                                                              :  .  :       

A0A1G1E4S2      AGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSRKIAALK
A0A349BQG7      AGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSRKIAALK
A0A1G1HPN4      AGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSRKIAALK
A0A354F6L6      AGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSRKIAALK
A0A1G1HUY8      AGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSRKIAALK
A0A1G1GFA6      LRIKKDISELSEKYGPRHPHMMKIVSELNTVQKNLVEEA------RKMLSAAKTEYEIAK
A0A419FND3      IGLESQYSSLLNVHKPEYPKMQRLEKQMEDLKKRIAFEE------QKIISSLDSDYRIAL
A0A1G3XRU6      ASREAEYYQLSKKFKPEYPKMGRLKEEMDKIEARINTET------RKIVSSIEKDFKAAQ
A0A0S4L511      IRVSGQVAELEDTYGPLHPKLIHAKAEMQDLHERIEQEV------QKIFDSVKQEYDSAR
A0A2N6GR48      IRASGQVAELSEKYGPLHPKLARADAELQDLRERIRQEV------QKIFDSVKHEYNAAV
A0A0K2GIJ9      IALSSQVADLSEKYGPLHPDRAQKHAELQNLRQRIKQEV------QKIYDSLKHEYNMTV
D8PGN0          ITVSAQVAELSEKYGALHPKLAHMKAELQDLRQRIQQEV------QKIYDSVKHQYDMAL
A0A136JVD6      ITVSAQVAELSEKYGPLHPKLAHMKAELQDLRQRTQQEV------QKIYDSVKHQYDMAL
A0A3A0BU62      ITVSAQVAELSEKYGPLHPKLAHMKAELQDLRQRTQQEV------QKIYDSVKHQYDMAL
A0A3A4W5D3      SSLEVNRQSLLSDYTEKHPQVVALSAEINALRGRAHSSI------MNILKSLEN------
A0A3N5I7D6      MRKESALSELKTALKPEHYRLKRLTDELKERQKQLKLEE------SKVIQRLHDEYKSAE
A0A0S8DH48      VELYNRISELSGKYGKEHPKMKAANSELGSLQKRKTSEI------NRIIDSLRNEFEVAQ
A0A1G1HA47      SSLEAEYYNLSKVYTPDYPKMKSLKSQMDAIQRRIEEET------SRIADSVNSDYKASV
                                 :        ::         .           .          

A0A1G1E4S2      AHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLS
A0A349BQG7      AHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLS
A0A1G1HPN4      AHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLS
A0A354F6L6      AHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLS
A0A1G1HUY8      AHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLS
A0A1G1GFA6      SRETSLKRALDEQKQEFLDLSRKSIEFNVIAGESESNKLFYEMLLKKLQEASLSSGINIS
A0A419FND3      KREDVLSRAIEGLRREVLGFQQQMVQYQILKREVDTNGELYSSLLTRLKEVDVSTTLSES
A0A1G3XRU6      RREDSLRSTLEKYKKEALDLNDRMVQYLILKRESDTNRELYNGLLQRLKETGVSASLTSS
A0A0S4L511      GRVRVIKEAASRHRQEKIKLEQYEVDYGILEREAESTQHLYDIFLKQTKEADLSAGLRSA
A0A2N6GR48      SRVRVIKDAAGRHRQEKILLERHEIEYGTLERDAESTQHIYNVFLKQTKETDLSVGLGSA
A0A0K2GIJ9      AQERAVQAAIARYGNDKIRLEKNEIEHGMLEREAESSLHVYNLFLKATKESDLSAGMQTN
D8PGN0          AQDKAVKEAITRYSSDKIRLEQNEIEHSMLERDAETSQHLYDVFLKATKETDLSSGLRAN
A0A136JVD6      AQDKAVKEAITRYNTDKIRLEQNEIEHSMLERDAETSQHLYDVFLKATKETDLSSGMRAN
A0A3A0BU62      AQDKAVKEAITRYNTDKIRLEQNEIEHSMLERDAETSQHLYDVFLKATKETDLSSGMRAN
A0A3A4W5D3      -KTENLSAEIERFKTQLRELPDREKKLADLTRNVEVSSSLHKFLMEKVNEANIMSASTLS
A0A3N5I7D6      GHRDVLLGAYREQADAVAGQGEKLIYYNMLKREVEASRELYSSMSKQVKQASIASALAAS
A0A0S8DH48      AREASLKAALERQKQESLELNKKAIEYSVLKREAEGARELYDLLIRRFKETSVTEEIDAG
A0A1G1HA47      KKEENLLRALNVQKQMALSFRDTISDYEVLKREVDANKDLYNTLLKRFNEVGVSAMSSAT
                 .   :                       :  .      .:. :     : .:       

A0A1G1E4S2      NIRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYD-N
A0A349BQG7      NIRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYD-N
A0A1G1HPN4      NIRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYD-N
A0A354F6L6      NIRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYD-N
A0A1G1HUY8      NIRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYD-N
A0A1G1GFA6      NAQIIDNAVTPKSPVSPRRGLYIFLAAIAGVFGGVFAAFFVDYLDDTIKGQADVDSIL-G
A0A419FND3      NIQILDRAEVPGSPFKPLKAQNMALSLIVGLLGGVFFAFFAEYFDNTVKNADDIEKKS-R
A0A1G3XRU6      NIQVLDWAEVPQSPHKPRKTLNLLLATIIGLFGGIGLSFFVEYIDNTIKTPEDLEKTI-S
A0A0S4L511      NVYLADPAVPNAIPVKPKKQLNIMLGLLVGLMTGVGLALFLEARDRTLRGPDDLGRYLPK
A0A2N6GR48      NVYLADPAVPSSIPVKPKKQLNTILGLLLGLMTGVGLALVLEARDRTLKGPTDLERYLPK
A0A0K2GIJ9      NVYLADPATPSAVPAKPKTKLNIVLALMTGLMSGVGLAIVLEARNKKLQDPGDVERYLPE
D8PGN0          NVYLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAPADVERYLPN
A0A136JVD6      NVYLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAPADVERYLPN
A0A3A0BU62      NVYLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAPADVERYLPN
A0A3A4W5D3      QTQIVDEAVASLRPVMPNVMLNIILSMIVGLIGGMALAFFIDYLDNSIKFTYDVEKRL-G
A0A3N5I7D6      NVTFVDRSDPPVKPYKPQALREVVLGGSVGLFLGVVLVFVRRTTDQKFRSPGEVSLCL-N
A0A0S8DH48      NIRIIDRAEYA-YQVSPNTRRDMRLAAVIGLMLGLGLAFFIEYLDNTIKSPEEVEPYF-K
A0A1G1HA47      NIQLLDRAVYPKAPYKPNVPFNFLLSLFFGLTGGVGLAFLAEYFDNTVKDTDIIERKI-N
                :  . : :        *       *.   *:  *:   :.    . ..     :      

A0A1G1E4S2      TPLLGTIYNYGKALPQ-------------------------------LISGMEIRSPAYE
A0A349BQG7      TPLLGTIYNYGKALPQ-------------------------------LISGMEIRSPAYE
A0A1G1HPN4      TPLLGTIYNYGKALPQ-------------------------------LISGMEIRSPAYE
A0A354F6L6      TPLLGTIYNYGKALPQ-------------------------------LISGMEIRSPAYE
A0A1G1HUY8      TPLLGTIYNYGKALPQ-------------------------------LISGMEIRSPAYE
A0A1G1GFA6      LPFLGLVPAAKGTGPLYIT--------------------------------ADPRSVMAE
A0A419FND3      LPVLGLVP-ISKTDPKALT---------------------------GSAG-PGDGMPFVE
A0A1G3XRU6      LPSLGVVPNLGKQSDRSSI---------------------------SMITFEDKKSPLSE
A0A0S4L511      VSLLGVMPLLPKTKIGEGV---------------------------SLLT-QQSSGVAAE
A0A2N6GR48      ISLLGVLPLLPKTGTGDSA---------------------------HLLT-DQSSGATAE
A0A0K2GIJ9      VSLLGVVPLLPKASTPEKA----------------------------LVH-PDAMSPAAE
D8PGN0          VSLLGVVPLLSKSAAQEKA----------------------------LAP-PNALTPVAE
A0A136JVD6      VSLLGVVPRLSKAAAQKKA----------------------------LAP-PNALTPVAE
A0A3A0BU62      VSLLGVVPRLSKAAAQKKA----------------------------LAP-PNALTPVAE
A0A3A4W5D3      LPVFGRIPVVQANKA-------EFITGEEAVHANHS----------SLITLESAKSITAE
A0A3N5I7D6      TNELGAVPSVEGLRENGTLQIRMRFSGGKPGSTLPLFPSTLRKNSKEIEVWSARKSLFSE
A0A0S8DH48      VPLLGVVLGHQVKGRRE-----EDMNKKDELVTLKD----------P-------KSAVSE
A0A1G1HA47      LPTLGIIPDFEIATQKARFQVIDKISPRKGTAPSRL----------PMPLHPQKGGPVAE
                   :* :                                                    *

A0A1G1E4S2      AFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLAR-EDKKVLLIDTDLRR
A0A349BQG7      AFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLAR-EDKKVLLIDTDLRR
A0A1G1HPN4      AFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLAR-EDKKVLLIDTDLRR
A0A354F6L6      AFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLAR-EDKKVLLIDTDLRR
A0A1G1HUY8      AFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLAR-EDKKVLLIDTDLRR
A0A1G1GFA6      SFRTIRTSVMLSSVEKPPKVIVITSTFPKEGKTTIASNLAVAMAQMGE-RVLLIDADMRK
A0A419FND3      AFRTIGTYIQFSNTVKPPKQILVTSPLAKDGKTMFAVNVARSLVKSSRGKGIVVDADLRR
A0A1G3XRU6      AFRSIGTYIQFSSPIRPPKTMLVTSARKAEGKTSMAVNLAVTLAS-SWGKGIVIDADMRN
A0A0S4L511      HVRIIRTSVLLSRPDELPSCVLITSPGEGEGKTTLSVNLAVALAQLENTKVLLIDADLRN
A0A2N6GR48      SIRIIRTSVLLSSPNKLPSCVLITSPGESEGKTTLSVSLAIALAQLKNARVLLIDADFRK
A0A0K2GIJ9      SIRIIRTGLLLSRPDTLPSRVLITSPGDNEGKTTLAVNLALALARLERRRVVLVDVDFRK
D8PGN0          SFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLAMAMAQLEDTLVVLIDVDFRN
A0A136JVD6      SFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLAMAMAQLEDTQVVLIDVDFRN
A0A3A0BU62      SFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLAMAMAQLEDTQVVLIDVDFRN
A0A3A4W5D3      SFRSLRTNLQFAVMEKKGKIFHLTSSEASEGKTTITANLGITLAL-MGSRTLIIDLDLRK
A0A3N5I7D6      SFQGVVTSIL--SIAEEDKCFLITSPEAGAGKTSVVSNIGMTLAE-IGYRAVMVDADLRR
A0A0S8DH48      SYRGIRTRILFSSTVSQPKSILIVSAMEGEGKTISAANLAVIMAR-TGSRVLLLDCDMRK
A0A1G1HA47      AFRSIGAFIVLSSASTPPKTILVTGPGEKVGKTTICVNIARALLE-SLGKGIIIDADLRR
                  .     :         . . :...    ***    .:.  :        :::* *:*.

A0A1G1E4S2      PRLETLMGIK----NQSGLTNVLVGDITIED-----AICHTSIDKVDLLPSGTTSLDPGR
A0A349BQG7      PRLETLMGIK----NQSGLTNVLVGDITIED-----AICHTSIDMVDLLPSGTTSLDPGR
A0A1G1HPN4      PRLETLMGIK----NQSGLTNVLVGDITIED-----AICHTSIDMVDLLPSGTTSLDPGR
A0A354F6L6      PRLETLMGIK----NQSGLTNVLVGDITIED-----AICHTSIDRVDLLPSGTTSLDPGR
A0A1G1HUY8      PRLETLMGIK----NQSGLTNVLVGDITIED-----AICHTSIDMVDLLPSGTTSLDPGR
A0A1G1GFA6      PYIDKVFGMD----NSIGISNVIARHSDFPD----AVRTMPDFPNLSILPGGRIAPDPSE
A0A419FND3      ATIHSSFDLD----NSTGLSSYLSGAIGYDD-----LIKKLPHLGIDCITSGPVPANPSE
A0A1G3XRU6      PQLHKILGLD----NSKGLSSFLTGLLEFDN----GLIQKTDIPNLDVITAGIIPPNPSE
A0A0S4L511      PSHKYIHGVQREGIDTNGLANFLAGRASLRE-----IIYRTDLANLSVIPRGDRPPNPSE
A0A2N6GR48      PAHRYIHGIQRDGSQTKGLAGFLSGSIKLEE-----IIHRTDIPNLSVIPRGKRPSNPSE
A0A0K2GIJ9      PNPHRIYEVGLHKTSAPGLAQLLAGQADIAD-----VVHDSFVPNLSIVPSGDRPGNPTE
D8PGN0          QHIHPLYDVGSPEQPPKGLGHLLRGEAGLDE-----VVHQTFVKNLSVIPHGGRPANPTE
A0A136JVD6      QQIHPLYEVGSPEQPPKGLGHLLRGEASLAD-----VVHQTFVSNLSVIPHGGRPANPTE
A0A3A0BU62      QQIHPLYEVGSPEQPPKGLGHLLRGEASLAD-----VVHQTFVSNLSVIPHGGRPANPTE
A0A3A4W5D3      PRIHQIFGIN----KEPGITHLLTQKATANE-----ITETASIEHLYIIPAGLIPPNPSE
A0A3N5I7D6      PRLHKIFGLD----NTWGLSDLIDSAKPIDSYPIEALAKPTSVDGVFVLPSGPPHPHISR
A0A0S8DH48      PRMNSIFGLE----REKGVSNILVGDCSISD-A----VHKTDIENLNLIPCGQIPPNPSE
A0A1G1HA47      PALHYHFNMD----NSTGLSTFLSGNMEFDS-TEGVLIKPASEKGLSVITSGPVPPNPSE
                        :        *:   :       .              :  :. *        

A0A1G1E4S2      VIESQKLMSLIASLSQVYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKKITPQAIIR
A0A349BQG7      VIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKKITPQAIMR
A0A1G1HPN4      VIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKKITPQAIMR
A0A354F6L6      VIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKKITPQAIMR
A0A1G1HUY8      VIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKKITPQAIMR
A0A1G1GFA6      LLSSSLMKDLLNGLRDRFDRIIIDSPPLNAVSDPLILSSLADSVIMVIWGGVTGRDVVKK
A0A419FND3      LFNSLRMKELIDTLSGEYDYVIVDSPPVLGMSDSLVLSAFIEAVIVVVRASNTPADALAQ
A0A1G3XRU6      LLGSQRLKDLLYELVPLYSFIIFDSPPLLGLSDSLILSTVSDGVIMVVRSDSTPKEAALQ
A0A0S4L511      LLHSKQLRELLNRCREERYHVILDAPPVLPVTDPVILASQVDGVLLVASAGQTTREACRA
A0A2N6GR48      LFHSKQMSVLLNRCREEGYHVILDAPPVLPVTDPAILASQVDGVLMVASVGQTTREACRL
A0A0K2GIJ9      LLHSKYLTQLLEWALRQDCHMILDCPPTLPFADTAVLASKVDGVLMVVCAGKTTREACRL
D8PGN0          LLHSKSMAQLLKWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGETTRDACHL
A0A136JVD6      LLHSKSMAQLLNWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGETTRDACHL
A0A3A0BU62      LLHSKSMAQLLNWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGETTRDACHL
A0A3A4W5D3      LLSQQNLKDFLDEAREEFDYILLDSPPTLPVTDAQLLGRLADATFIVLELGVTKLPAAEQ
A0A3N5I7D6      LLYSSRAREIIVRLREEFDMVLIDTPPLLKVADARVLARYVDDTILVLRAGKTSRAMGAA
A0A0S8DH48      LLGSKAMREMLATLGRSYERIVIDSPPITAVTDAVVLSKAVDGVVVVLQANKTERVLAKR
A0A1G1HA47      LLGSARMQDLLYALQATFEFILVDAPPVMGLPDAIYLSKIVDGTVLVAKAGETMKNELTE
                :: .     ::         ::.* **   . *.  :.   : ..:*             

A0A1G1E4S2      IKAIFERARLKPLGVILN----KFVDRHYSGSYYYGDYYNYYYQDRKSKWGLWSGKLLGA
A0A349BQG7      IKTIFERARLKPLGVILN----KFVDRHYSGSYYYGDYYNYYYQDRKSKWGLWSGKLLGA
A0A1G1HPN4      IKTIFERARLKPLGVILN----KFVDRHYSGSYYYGDYYNYYYQDRKSKWGLWSGKLLGA
A0A354F6L6      IKTIFERARLKPLGVILN----KFVDRHYSGSYYYGDYYNYYYQDRKSKWGLWSGKLLGA
A0A1G1HUY8      IKTIFERARLKPLGVILN----KFVDRHYSGSYYYGDYYNYYYQDRKSKWGLWSGKLLGA
A0A1G1GFA6      SMQSLKGVNAKILGVVIN----NLAMSK---RDGYQYYYSYYSYSEGKGIEKTV------
A0A419FND3      TVKLLRGVNARILGVVLN----GLDVGT---RYGYPYYYQPNGRDKEGNGRTAGR-----
A0A1G3XRU6      ARKSLQGVNAKILGVVLN----AIKQSNLKYGSYSYYYSYYYGEEDDHKGKKKRREKGDK
A0A0S4L511      AIDQLTSAGGRILGIVLQ----KVRVST------NLYPSYV---GKKFEENGIPL-----
A0A2N6GR48      AIQRLTAAGGNILGIVLQ----NVQVPE------SSYYCHVPEEGDQAEENGVFSDADHW
A0A0K2GIJ9      AIQRMAFAGGKMLGVVMQ----KARVED------SPYYTAYYQEQA--------------
D8PGN0          AVQRIKQAGGRLLGVVMQ----KAPVAE------SSYYYGAYQQQR--------------
A0A136JVD6      AIQRIKQAGGRLLGVVMQ----KAPVAD------SPYYYGAYQQQR--------------
A0A3A0BU62      AIQRIKQAGGRLLGVVMQ----KAPVAD------SPYYYGAYQQQR--------------
A0A3A4W5D3      TIRKFRSVGVNVAGAIIN--KDRPSNGYGYYNY-YSYYYGDDAPTGNGKKPLFKFWKKAG
A0A3N5I7D6      AYSQLVQDGRSVLGTILNDWNPKMDVPYGYSSRLYQEGYGATPKSGSASPPASGSA----
A0A0S8DH48      AIEQMQAVNAHIFGIILN----RLDERMTKYYHLYSYFYRDYSEEKNLEEKSHRKFWKMK
A0A1G1HA47      IKRVFRTIDAKILGVILNGVK-KCDLKYGTYNYYYSSYYSSYFKDK--------------
                    :        * :::                                          

A0A1G1E4S2      IGNKKGHS--------
A0A349BQG7      IGNKKGHS--------
A0A1G1HPN4      IGNKKGHS--------
A0A354F6L6      IGNKKGHS--------
A0A1G1HUY8      IGNKKGHS--------
A0A1G1GFA6      ----------------
A0A419FND3      ----------------
A0A1G3XRU6      A---------------
A0A0S4L511      ----------------
A0A2N6GR48      TSSSK-----------
A0A0K2GIJ9      ----------------
D8PGN0          ----------------
A0A136JVD6      ----------------
A0A3A0BU62      ----------------
A0A3A4W5D3      QA--------------
A0A3N5I7D6      ----------------
A0A0S8DH48      EKKRKEKERRKTSMIT
A0A1G1HA47      --------------VS
                                

© 1998-2019