BYKdb

Dataset for cluster orphancd of phylum planctomycetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

96 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A1Z8MCI4      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ------------------------------------------------------------
A0A177QX42      ------------------------------------------------------------
A0A1G2ZG92      ------------------------------------------------------------
A0A1G3A0W0      MNPAEKEFQPQTDPIVQERDYSNGPGKESRSSEIVLSAEEIINPPHV-------------
A0A2E7D3V4      ---------------------------------------MDNSENRP-------------
A0A353BE27      ------------------------------------------------------------
A0A2E0SHG0      ------------------------------------------------------------
A0A358MY60      -----------------------------MDKVKSIIDQQAVPALPR-------------
A0A355GJI7      ------------------------------------------------------------
M5U569          ------MSILSEFQSDRSGSYQTLGSPATGVGMPEGPSG---------------------
L7CND7          ------------------------------------------------------------
A0A0J1B8S4      ----------MTPNSNSTDPTAGKRGPNSFASYPSQNAGTMGLAATG-------------
F2ARR3          ------MELPSNASSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQG-------------
K5D8H6          ------MELPSNASSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQG-------------
M2AKU0          ------MELPSNASSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQG-------------
A0A3L7P7S7      ------------------------------------------------------------
M5T8W8          ------------------------------------------------------------
M5SF00          ----------------------------------------MGQAAMG-------------
A0A2G1WDS1      ----------MTPNSNSTDSTAGKRGPNSFVSYPSQNAGTMGQAAMG-------------
Q7UVS9          ----------MTPNSNSTEPSAGKRGPNSFASYPSQNAGTMGQAAMG-------------
A0A3C1QS25      MRRHACPTLLLDPYVWVHRACLVGTTGTSCECRARISPTRLKLAPPNRCPGRGPRYTEGS
A0A2A2WFP6      ---------------------------------------MLEQLPPH-------------
A0A255QXY0      ---------------------------------------MLPLHSST-------------
A0A1Z8MHR4      ---------------------------------------MLDMPPST-------------
A0A2A2WC24      -----------------------------------MYSSMLDQTSPQ-------------
A0A1G2YRE4      ------------------------------------MNNLEKYADRL-------------
A0A255QXF5      ------------------------------------MQQHTPRQHQG-------------
A0A1I3GSP0      --------------------------------------MTAPQKQPN-------------
A0A2S8F9B8      ----------------------------MTNGNLVIPSDRDRHASKA-------------
A0A368KP63      ----------------------------MSNGNLVIPSDNNRQAASV-------------
A0A3L7P0L2      --------------------------------------MNKRSSLPV-------------
A0A3M1VG27      -----------------MNDDVPFRFADGVAGAPAVSTDRITTVQRP-------------
A0A3L7UX05      ---------MIGPKIPMNNHQNEAMNQSLSPQLPVHQQGYGQGAALW-------------
A0A142XL75      ------------------------------------------------------------
A0A3A0DR44      ---------------------MSSPHVSESALIAQTAGPPALLRPPP-------------
A0A3E0PW54      ---------MVGFRPPGESGTAFALTVSRPPVAPSARHSHERTDMPA-------------
A0A2D5GZ77      ------------------------------------MNTDFQPLDQQ-------------
A0A3D3R1Z6      ------------------------------------MNTDFQPLDQQ-------------
A6BZU4          ------------------------------------MNTDFQPLDQQ-------------
A0A1N6KY57      -----------------------MMLNSNPGSRPDSVNLPATIPPHR-------------
L0DK20          -----------------------MMSNSNFGPQPNSANLPAVVPPHR-------------
A0A2D6ST10      -------------MDHTTRTSDTSAPAAGNETNGANDNGTLSVPAPL-------------
A0A1Z8MPL5      ------------------------------------------------------------
A0A1Z8MBT6      -----------------------MPSERFWTPLQIVLMTTESTSNIA-------------
A0A2A2W6A9      -----------------------MDHQ------------SNQLQPYH-------------
A0A177Q3B7      ------------------------------------------------------------
A0A142XAP8      --------------MARPIAGDPPMMQPPYQVPQSGG-PVPVALSPF-------------
A0A2Z3HEL7      --------------MARPIAGDPPASPPPAPFPTPGGVPAPVAPSPF-------------
A0A3L7Q373      ----------------------------MWWRLPETSDVTQRSQLPV-------------
A0A353Z859      --------------------------MSTDQMNGQGAMVPVRRNEVG-------------
A0A2E0AW64      -----------------------------------------MNLSTS-------------
A0A351FZ59      -----------------------------------------MNLSTS-------------
A0A2E0X6Y6      --------------------------------------------MNS-------------
A0A3M1TFJ0      ------------------------------------------------------------
M5T666          ------------------------------------------------------------
M5U6N6          ----------------------------------------------M-------------
A0A1C3EBY9      --------------------------------------------MRQ-------------
D5SX64          --------------------------------------------MRQ-------------
A0A354GX32      -----------------------MMPHDPNAMKTKTASPAGPITPAA-------------
M5RUI3          -----------------------------------MQSNANRVNGND-------------
A0A2S8FCC0      ----------------MSTDQTSLPVERTNREIRFDSPIDLTPGSSN-------------
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      ------MEPFRSSSFINGIPTVLSQEQGASAPTPVELLPVDRIVPGY-------------
A0A142WPR7      ------------------------------------------MGIRG-------------
A0A2Z3GZZ5      ----------------------------------------------M-------------
A0A2E6AG00      ------------------------------------------MTRQS-------------
A0A1G3A880      ------------------------------------------------------------
A0A2E8ATT1      ------------------------------------------MSRDS-------------
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A1Z8MCI4      ---------------------------------------MDDLDKIETSQAIGLGLILQT
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      --------------------MNDIEKISAGRIISTELAGYGTMASNASNSEGASMNLWPA
A0A177QX42      ------------------------MFHLEIRVSTTTTDWQAPNNPALEEQPNEKGLDFFT
A0A1G2ZG92      ----------------------------------------------------MEFLKIWE
A0A1G3A0W0      -----------------------------------TPWPNRLMRAGGSGPSVPLANDILG
A0A2E7D3V4      -----------------------------------VERPFEFAVLSENSDKPKVEFDVVQ
A0A353BE27      ------------------------MSDVVLDQRNVNGQPSPVPGGAPEAQSEGSNFDFVQ
A0A2E0SHG0      ------------------------------------MPTAPLPETLSSQSPLHGILDVLS
A0A358MY60      -----------------------------------SGAGQPMPQPAADSVNFDPRVLVST
A0A355GJI7      ------------------------------------------------------------
M5U569          ----------------------------------------------------DSGPDMLA
L7CND7          ---------------------------------------MNEGWRSGGSAEPADAGDLMG
A0A0J1B8S4      -----------------------------------SYPAMNEGWGSADQG---DASDLLG
F2ARR3          -----------------------------------SYPAMNTGWQPTHQAA-NETADIAA
K5D8H6          -----------------------------------SYPAMNTGWQPTHQAT-NETADIAA
M2AKU0          -----------------------------------SYPAMNTGWQPTHQAT-NETADIAA
A0A3L7P7S7      -------------------------------------------MSQEGGRLPEDAMNIFR
M5T8W8          --------------------------------------------MSTPDGPSVDSADMVA
M5SF00          -----------------------------------SYPAMNEGWGSSGSSQTAESADLMG
A0A2G1WDS1      -----------------------------------SYPAMNEGWGSSGSAQTAESADLMG
Q7UVS9          -----------------------------------SYPAMNEGWGSSGSAQTAESADLMG
A0A3C1QS25      DISTGIHHGSTPGDGPLFPRFGWSTFVAQMPVEGRPAWAEMGPPMGT--EPESQRFDFLA
A0A2A2WFP6      ------------------------------------VHSDTGHAMER-DGGRLQGEAIGT
A0A255QXY0      -----------------------------------SSNDLRSIADGS---QDEHGQAVLS
A0A1Z8MHR4      -----------------------------------PVGFDTSGAYGSQNQSPANGESVLT
A0A2A2WC24      -----------------------------------PVNYDSSVTLDP-AQEQHHGETILT
A0A1G2YRE4      -----------------------------------LEQKLVNTGTPPEFNGQGSPDLIKG
A0A255QXF5      -----------------------------------APYHFNGPSSGPDSGGFDPWLIWVT
A0A1I3GSP0      -----------------------------------AAAEFDFAPFGFHKATAGRSIDIVS
A0A2S8F9B8      -----------------------------------DVPGAVIGMRPPEENGMQFGQVLHS
A0A368KP63      -----------------------------------NVPGRVVDVRSSDEDSNRMGQVVHS
A0A3L7P0L2      -----------------------------------AEPDVDFAPLGYHKSQEGRSIDIVR
A0A3M1VG27      -----------------------------------GDVATPGAPSPPIELMRRQQFDPLE
A0A3L7UX05      -----------------------------------NAHQHDSHEPENQSKGMNLATVWRS
A0A142XL75      ---------------------------------------------------MTGRAILNA
A0A3A0DR44      -----------------------------------IQFGGPPKPAPQTGAGITIGFVYRS
A0A3E0PW54      -----------------------------------PQHNVDFAPLGYRQPDEGKSIDILK
A0A2D5GZ77      -----------------------------------SDFGIDGMEENAEVNSSGPGVDIVR
A0A3D3R1Z6      -----------------------------------SDFGIDGMEENAEVNSSGPGVDIVR
A6BZU4          -----------------------------------SDFAIDGMEENAEVNSSGPGVDIVR
A0A1N6KY57      -----------------------------------KDSFADSSAVMGSSTSLDPFMLLKA
L0DK20          -----------------------------------AEVFSVSSPPAGPVAGLDPVAMLKA
A0A2D6ST10      -----------------------------------VLPLSVVNAADGEEATVNFHVLWGA
A0A1Z8MPL5      ------------------------------------------------------------
A0A1Z8MBT6      -----------------------------------SRQSSHSNASTGEGAPIDPWIIWVT
A0A2A2W6A9      -----------------------------------TGPVGRMPVSNEPPNAFDPWLLWIT
A0A177Q3B7      ----------------------------------------MSGPDSGRATAPSPWELLRA
A0A142XAP8      -----------------------------------NYTNQPNIPGPAVAATPTPLGLLNA
A0A2Z3HEL7      -----------------------------------SYTNQPSLPGPTVSSAPTPSGLWNA
A0A3L7Q373      -----------------------------------VAPSIDFAPLGFQKSNDGRSIDIVR
A0A353Z859      -----------------------------------MPGPAVGGAPANSGIVVDQNTVLAA
A0A2E0AW64      -----------------------------------QPPPLNSSTESESAAQLSPMLVLEA
A0A351FZ59      -----------------------------------QPPPLNSSTESESAAQLSPMLVLEA
A0A2E0X6Y6      -----------------------------------ELDSNLAQEGPASSEIVSAAMRFLR
A0A3M1TFJ0      -------------------------------------MDSRESQLGRLEDEDELHEDLWV
M5T666          ----------------------------------------------MLEANEDF------
M5U6N6          -----------------------------------LGFVPRYQATHLLEANEDF------
A0A1C3EBY9      -----------------------------------TPQDSELASSFETEGEGGLSIDWMN
D5SX64          -----------------------------------TPQDSELASSFETEGEGGLSIDWMN
A0A354GX32      -----------------------------------ASTEQAAPAPPGLSAPPGATAVWYA
M5RUI3          -----------------------------------RPIGRLSGPSAGANSQFDPWILWVT
A0A2S8FCC0      -----------------------------------EFPHINDVVEMDDTGGTGISHVFHA
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      -----------------------------------GASLKAVEPPPGLSEMPDLDGLLRA
A0A142WPR7      -----------------------------------DFEDEL--------SEKSDERTVNF
A0A2Z3GZZ5      -----------------------------------ADTDKNTAAPPDDDEPASGLNPLHL
A0A2E6AG00      -----------------------------------TSSVSNLLPTTGSHVLHNAMWLVRS
A0A1G3A880      -------------------------------------------------MVYAVLYFLRV
A0A2E8ATT1      -----------------------------------HYNEQN----STSEAVRAVLRFLRV
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ---------------------------------NIHHQRVDAIATERVKV----------
A0A1G2XSU7      ---------------------------------MVQTTTSNVANLEQVLI----------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      --------------------------------MDYKDSPEFNPVKKANIF----------
A0A0S8H0S8      ------------VLQAAL---------------ERCGGAGLKILQGRPNP----------
A0A1Z8MCI4      ARRHLLWVLPTGFVLCAL---VFLLLHDWKVD-RYQASHWVEIAPNHVAF----------
A0A177PV03      ------------MVLGDA---ASALATKGLSSLEGLSQSEILA-----------------
A0A1G2YIM0      ICRHWRALLVTFMIAAGM---GTPLIWFAVKP-MYESAGAIRISPIVPSIL---------
A0A177QX42      AIMGRKFLVVAFIGIGLG---LGHLHFTRQPP-VFASFAKVMVLRPQSVL----------
A0A1G2ZG92      ILSRRKWIFISAFLGFFG---IVVIGTILITP-TYKAKAKLIIETSDTISSLLSSLGTKG
A0A1G3A0W0      SFLRFKWTVLFVFLLVSA--PAIAIIWMQIVP-KYRARAEVRVRPIVPHL----------
A0A2E7D3V4      IALRHKKIISIGVICGLV---IGHLAYKQAGP-EYEATVKILVSKKADVM----------
A0A353BE27      ILWRWKWLPILGSIVGAC---LGFLYFSRLPE-TFEAAARVQVISSIPAP----------
A0A2E0SHG0      ILRRRIGIILFFVVVGVA---LGTLGILQLKE-KWKSEAQIHIIRRDPNL----------
A0A358MY60      WRHCWFWATPLGVALGCA---AAFTVYASFVP-MFKASHMLEANQDYIVF----------
A0A355GJI7      ------------------------------------------------------------
M5U569          AIWRYRWAVIIPAILGAA---GGFIAFLKTPE-TFKSATRLMFESDRPAV----------
L7CND7          AIWRYRWAAFVPAILGAV---IGFLVFVKTPE-TFQSGTLLMFESDRAAV----------
A0A0J1B8S4      AIWRYRWAAMGPTILGAM---IGFLVFIKTPE-TFQSATLLMFESDRPAV----------
F2ARR3          AIWRYRWAVLIPTILGLV---AGFLAFVKTPE-TYQSATRLMFESDRPAV----------
K5D8H6          AIWRYRWAVLIPTILGLV---AGFLVFVKTPE-TYQSATRLMFESDRPAV----------
M2AKU0          AIWRYRWAVLIPTILGLV---AGFLVFVKTPE-TYQSATRLMFESDRPAV----------
A0A3L7P7S7      MLQQRMGLIAVLAVLGLV---AGGLFTLRMLP-AYAASVDVMVVKKKGAM----------
M5T8W8          SIWRYRWAVIIPAILGAA---GGFIAFLKTPE-TFKSATRLMFESDRPAV----------
M5SF00          AIWRYRWAALVPTILGAV---IGFLVFVKTPE-TFQSGTLLMFESDRPAV----------
A0A2G1WDS1      AIWRYRWAALVPTILGAV---IGFLVFVKTPE-TFQSGTLLMFESDRPAV----------
Q7UVS9          AIWRYRWAALVPTILGAV---IGFLVFVKTPE-SFQSGTLLMFESDRPAV----------
A0A3C1QS25      MAWRRKWLIAFGLMVGLG---LGFLAYKQQTP-IYTSVAKVMITPKNPAT----------
A0A2A2WFP6      VLWRYKWLIGILLPIGTL---LGYWVNRHKPV-TYRATTRLMFKTDTPLT----------
A0A255QXY0      ILWRFRYLVAICVVIGVG---VGHWYHRQKPA-QYQATSKLMFRSDAPMA----------
A0A1Z8MHR4      ILWRYKWLIGMLLLAGLI---IGYWNYKRTPT-TFLSSTQLMFKSETPLS----------
A0A2A2WC24      VLWRFKWLLAAFVAIGTS---IGYWMYKQKPT-TYRATTQLMFKSDTPIS----------
A0A1G2YRE4      ILHRWYILLLGFSIMCAI---GLPAIWLSIKP-QYTVTGALRFSPVLMNI----------
A0A255QXF5      FRRCWHWAVPAGLVLGSI---AAFGVLSTFEP-QFEAGYRLEANKDWLLD----------
A0A1I3GSP0      FVLSLWKPMAIGLFLGLL---VGVGLYLMMGP-VYSATTSVLVSKKASVP----------
A0A2S8F9B8      LRRQWLAAVVLGLLCAAP---IAVGAWLLQSP-TYTSSAYLRISASEQPL----------
A0A368KP63      LRRQWLASVVLGVLLAVP---IGVGVWLLQAP-KYSSSAYLRISANDQPL----------
A0A3L7P0L2      FAISMWKYLIAGLVLGCG---MGGLAYLYMGP-VYVAGTKITVSKKATVG----------
A0A3M1VG27      IGLRYRVWIGLAILAGLL---LGGLAYWKFGP-TYDAKAQILVSRKASIH----------
A0A3L7UX05      IRRYWWQAGLLWVISSGV---LMFLAFTSVKP-TFLSFALLRVEPPRASI----------
A0A142XL75      VKRRPFTLLGVALLAAGT----GAAVWLFLPLPKATAATVFHVSAQAPSV----------
A0A3A0DR44      FQHWWRVAIPAGLVCALL---AGAAVWLTWTP-KYRAYAIIEIPDRGGVL----------
A0A3E0PW54      FTMSIRNMLIAGLAVGLL---VGVGVYMCLGP-AYQADTRIEVSQKSAIP----------
A0A2D5GZ77      LLLRNKYLLVLGLATGLL---LGQAAYMKLGP-IFSANTKIQVSQKNPVP----------
A0A3D3R1Z6      LLLRNKYLLVLGLATGLL---LGQAAYMKLGP-IFSANTKIQVSQKNPVP----------
A6BZU4          LLLRNKYLLVLGLATGLL---LGQAAYMKLGP-IFSANTKIQVSQKNPVP----------
A0A1N6KY57      LRRRWAMALGIGLVGAGV---IGFTTYLLVPAAKYTARSMLHVNSVQPRI----------
L0DK20          LRRRWPLALGAGLLGGAV---LAFATYFLVPPAKYTARSMLHVSSTQPRI----------
A0A2D6ST10      FRRRWLLASVLGLIFGVA---AAAAAWELLPA-PFTATAQVRINSFDPFF----------
A0A1Z8MPL5      ------------MLFAIP---AGLGTWFLVPV-NYTAHSLMQSRRNTLIF----------
A0A1Z8MBT6      FRRCWVWAVPIGLVIGTI---GAVMVLKSFQP-EYTARYIVAANQDWVIY----------
A0A2A2W6A9      LRRCWYWAFPVGIVLGVI---AAFVVLQSFVP-RFRATHQLAANKDWLID----------
A0A177Q3B7      FRRCWFPATSLGLLVALL---AAGAVWYLLPN-RFTATTLLHVSAQEPTI----------
A0A142XAP8      FRRRWVLGTFIGGLVAVA---VAVGIWLALPTGKHQVRALVQLQPKQVEF----------
A0A2Z3HEL7      FRRRWVLSTFVGALVAAA---VAVGAWLAMPAGKHQVRALVQLQPQHAYI----------
A0A3L7Q373      FAMSIWKSLAIGLMAGCG---LGVLAYLYSGP-TYVAETQIMVSKKASIS----------
A0A353Z859      MRRRWLIATALGLTGALV---GAATTWLLIPV-TYTTRAELRVKAVNYTP----------
A0A2E0AW64      ARRWWAIATPVGLLAGLI---VAAILYLQFEP-LYEAKALLRITTPISFD----------
A0A351FZ59      ARRWWAIATPVGLLAGLI---VAAILYLQFEP-LYEAKALLRITTPISFD----------
A0A2E0X6Y6      LIRRRQNVLLVALALCSA---VGAAVYIAAPR-YYASTAKLLIIEQKSDQ----------
A0A3M1TFJ0      YLQTLRRQLPLVLVVAGACTLLATLRTLRLPA-VYAATASLRLVREPPDP----------
M5T666          ------------VVFKGVMPVVKDLARTENSL-FFNPIVLDPVLADP-------------
M5U6N6          ------------VVFKGVMPVVKDLARNEKSL-FFNPIVLDPVLADP-------------
A0A1C3EBY9      LVFRYRWWLCAGVVLGLG---LGIAAYIKLGP-EYMAIGQVMVSRRNAVP----------
D5SX64          LVFRYRWWLCAGVVLGLG---LGIAAYIKLGP-EYMAIGQVMVSRRNAVP----------
A0A354GX32      IRRRWLTILVLGLGLGSL---GAAAAWYIMPA-KYTATATLRLNPQSPRG----------
M5RUI3          FRRNWLWAVPVGMVLASL---AAFGVFKSFVP-VYRASHLLEANSQWVVF----------
A0A2S8FCC0      VRRRWLPAFSIGVLLAAV---AATSVWLLDVP-EYTARALLRISSRHGTL----------
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      LRRRWLFALLGGLLCSSL--SAAAVYLYLPPP-KYTARALVHVAEKRPRE----------
A0A142WPR7      LALTWRY-LWLLILFGGVGTGAAYLHFLKQPP-IYQSSSTVLVTGDRQQQ----------
A0A2Z3GZZ5      VMRRWQF-LAVGLIIGGV---LGALIYSTSAP-QYQSTAQVLVVKKGVEV----------
A0A2E6AG00      VRYRKHY-LIGALVASGL---VGAVYFFTADR-IYEASSQLLVQQMSPVV----------
A0A1G3A880      VRYRRSV-MVTALLITGL---LGGLYFTTATR-YYEADASLLILQTGGDV----------
A0A2E8ATT1      IRYRKSY-LIVALTTAVL---LGSVYYFTAAR-IYEAKASLLITQSSPDV----------
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -------------------------------SIKELTRGNS--------------SPTVR
A0A0S8H0S8      ------------------------------------------------------------
A0A1Z8MCI4      --SDVRARGGSDAKGEEA-------------LLKSPMVLESVLA-----------QPFIK
A0A177PV03      -------------------------------VLKGGFGANRVFK----------------
A0A1G2YIM0      --FSDRDSEQAMPNYMNFMNTQAE-------LIASFQVLNRA-------------ADDLK
A0A177QX42      --PNEDPERGTKKSANAVNLLENHQYLLTQPKILKGAVDPPIKDDASEEEKKHAKEASLS
A0A1G2ZG92      TKIGGVIPPKTGKTGSTDYETDIA-------LAKIRPLIEKLIS-----------LLNIK
A0A1G3A0W0      --VFRTDENGAIPFYDSFVNTQVS-------YMRSSTVLQRVLD-----------QPAIR
A0A2E7D3V4      --DKDNLADTKGAGGRGEHIA----------LIMSPLIVGAAIE-----------EAGLD
A0A353BE27      --VKNPYFSGGQEVNRIDESM----------IIRSQAVLRLAVS-----------LGRLG
A0A2E0SHG0      --ATEAAESTSPGDFRRMEDELANQMK----IMSSYKIVSAGLESGLEEDGKPVNLLTCP
A0A358MY60      --ENVLAESSNLEATEKQ-------------IILSDIVLDDVVS-----------KADIQ
A0A355GJI7      ------------------------------------------------------------
M5U569          --LDTMTGDVLG--GVPSIDILRS-------QLFSDTVTKNAFE-----------DDSF-
L7CND7          --IDTMTGDLIG--GVPSIEILRS-------QLFSDKVTEYAFE-----------NENM-
A0A0J1B8S4      --IDTMTGDRIG--GVPSIEIIRA-------QLFSDEVNRSALS-----------DGNM-
F2ARR3          --MDTMTGDVLG--GVPSIDILRS-------QLFSDIVLAKTFA-----------DENM-
K5D8H6          --MDTMTGDVVG--GVPSIDILRS-------QLFSDTVLNKTFN-----------DENM-
M2AKU0          --MDTMTGDVVG--GVPSIDILRS-------QLFSDTVLNKTFN-----------DENM-
A0A3L7P7S7      --ASDFRTAMLD--DYVAIQV--T-------IIKSDRVLREAAQLLQQGEIAGGVAQAT-
M5T8W8          --LDTMTGDVLG--GVPSIDILRS-------QLFSDTVTKNAFE-----------DESF-
M5SF00          --IDTMTGDLIG--GVPSIDILRS-------QLLSDKVTRNAFE-----------NESM-
A0A2G1WDS1      --IDTMTGDLIG--GVPSIDILRS-------QLLSDKVTRNAFE-----------NESM-
Q7UVS9          --IDTMTGDLIG--GVPSIDILRS-------QLLSDKVTRNAFE-----------NESM-
A0A3C1QS25      --V-----IIPGFEGMPSGPGVKQDHEHDAVLTSTTFIRDSVVS-----------NPELD
A0A2A2WFP6      --LDTSTGLVRG--GIPSGNLMQS-------LISSDAIAGRVHL-----------SEQL-
A0A255QXY0      --LDTSTGLIRG--GLPSGQLLKS-------LINSRAIVGRVKN-----------DRQL-
A0A1Z8MHR4      --LDTATGLVQG--GVPSGNLMES-------LVISDAIVKRVAM-----------SPQL-
A0A2A2WC24      --LDSNTGIVRG--GIPSGKLMQS-------LITSDAIVRRVAA-----------NPEL-
A0A1G2YRE4      --LTGEQNSAQISMLTEAELITSE-------RVIQRVADNLANR-----------NLSFF
A0A255QXF5      --RGVMPTPDDLAKS------EGP-------IIASPIVLSSILA-----------NDTLH
A0A1I3GSP0      --ANNGEANRYGERGD-----HVQ-------LIQTDLIVERAFK-----------DHGLN
A0A2S8F9B8      --AFRTVEQAGRDDYRTFKSTQRQ-------LMITPFVLNKALS-----------REDIM
A0A368KP63      --AFKTVEQAARNDFRTFKNTQVQ-------LMITPFVLSKALG-----------KDGII
A0A3L7P0L2      --ETEARLYGGRSE-------HIS-------AIKSDEVVRIAYE-----------KYGLK
A0A3M1VG27      --LKSDDLRTYGERSE-----HVA-------LIMSPMIVRKAVA-----------LRRLD
A0A3L7UX05      --LGPSMNTLGIDQIKRTH--MQL-------IKAPDVLSDAVSE-----------YPEIV
A0A142XL75      --LGQADGQANFVSYRAS---QIA-------TIKRQRTLNNVIK-----------VPAVE
A0A3A0DR44      --LPTSPDTSPRFAQT-----QLR-------SIASSVVLTPALA-----------DPEIA
A0A3E0PW54      --MDERSINFSGERTE-----HVH-------LIKSDAIVSRAVR-----------DHGLG
A0A2D5GZ77      --IKDGEIQTFGELTA-----HID-------VIKSPRIVGEAVK-----------EAKLN
A0A3D3R1Z6      --IKDGEIQTFGELTA-----HID-------VIKSPRIVGEAVK-----------EAKLN
A6BZU4          --IKDGEIQTFGELTA-----HID-------VIKSPRIVGEAVK-----------EAKLN
A0A1N6KY57      --LLTTGEVHTEYGAYQRT--QLA-------LLHSRLVLSSALK-----------QPEVA
L0DK20          --LLKVGENETDFVAYQRT--QLA-------LLKSRLVLGTALK-----------DPEVA
A0A2D6ST10      --FFKVDNQTPRFETYKQT--QMI-------LVRSPLVLMAALR-----------SPELA
A0A1Z8MPL5      --DVQNAEESGWEAQEQLIRGYRV-------LNTAL-------------------NDGLM
A0A1Z8MBT6      --KGINEAPRDLAASEKTWVIDHP-------GVIQAVMGDQTVC-----------KAPSL
A0A2A2W6A9      --RGVMPTPDNLSSSERMLITSPI-------VLSQVLDNPEFQA-----------FSLQD
A0A177Q3B7      --LATSEAHTDFGLYQKA---QAA-------LISSRLVLNAVLK-----------RDAIA
A0A142XAP8      --VNKTQEDFEAYRRHQ----MFL-------L-KSRDVFTRALA-----------DPAVS
A0A2Z3HEL7      --TNKGQEDFEWYRRRQ----IYL-------LTKDRDLFNRVLA-----------DPAVS
A0A3L7Q373      --DQEARRYGDRGE-------HVR-------VIATDIIARIAYE-----------KYGLN
A0A353Z859      --GGGLKQGEELRGEVYRQT-LGR-------MVQGPIVLKQVVR-----------REEVA
A0A2E0AW64      --GSKNKADRSFLANQFAVLYSVV-------TLEPLLADKEIAT-----------IPDLV
A0A351FZ59      --GSKNKADRSFLANQFAVLYSVV-------TLEPLLADKEIAT-----------IPDLV
A0A2E0X6Y6      --LASVNDADGSDNTMATQ--REI-------VVSPVVLRRAIER-----------LAPED
A0A3M1TFJ0      --IQAKYAYRWDGIPQEYLNSEIR-------DMTSLSLARAVIE-----------SNSVI
M5T666          ---------------------SLR-------NVPTLV-----------------------
M5U6N6          ---------------------QLR-------SAPSLS-----------------------
A0A1C3EBY9      --LKEQSAIGDWGERSE----HIA-------LIMSPMIASEAVR-----------LGKLD
D5SX64          --LKEQSAIGDWGERSE----HIA-------LIMSPMIASEAVR-----------LGQLD
A0A354GX32      --VNETSEDYTNLRSYLAGW------------VKSDPVLDATLK-----------KQEVG
M5RUI3          --KDVIPVIEDIAATEKPLFFNSI-------ILDPVLADPALRK-----------APSLA
A0A2S8FCC0      --LKQNGEANGDFEVYKLT--QRQ-------LIRGSFVINAALR-----------DTEVL
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      --LFETRESEVGFRTYQET--QVI-------LVKSRKVLEAALN-----------PPAIA
A0A142WPR7      --ANPLGTESGFAQGITQTMPHQM-------LIGSPLVVRKAVE-----------THDLR
A0A2Z3GZZ5      --TKEGDGRIVEDH---------V-------ATQVTLIKSEKIR-----------LAAAA
A0A2E6AG00      --ASGPIGQVGXXXGMLPTY-EKL-------FASAVVLNGAIXR-----------IVEMP
A0A1G3A880      --LTPSLSVDGAKQEIIPTY-CQL-------IESAVVLQGA--------------IARLG
A0A2E8ATT1      --WNGAASSEVGRHGLIPTY-EQL-------FSSAVILNGATQR-----------LARLP
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      -------------------------------------------------------SLQWK
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      -----------------------------------------------------------T
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      KPEPGKESQEPETPVKYDVDDAL--------------INNYLSKLTVQMTGNSD-----I
A0A0S8H0S8      -------------------------------------VAYLKEALKIEAGKKDD-----I
A0A1Z8MCI4      ELKPTTDGGPRN-------------------------LAYLVENVALTSKGAQG-----R
A0A177PV03      -----------------------------------------------------DGVTNNV
A0A1G2YIM0      TKNVAMVGRDP--------------------------FTFLRDAASNGRLIIEPAKKSEL
A0A177QX42      RLASLAASSNP--------------------------AATIATGLRVIRSEVSE----DV
A0A1G2ZG92      DRHGKTIRPDKLTELSLISKLKN--------------KVLPRPYIEVNQYKDAD-----M
A0A1G3A0W0      QTQWYKNPRSSLMQRFYGNKAPP--------------LERLRDTLSVRPRQRTE-----I
A0A2E7D3V4      GLPSMLTSGDP--------------------------EEDIVDGLKVERSAGHDRSLLNV
A0A353BE27      EQPEFVGLASEDIVSA---------------------LQDVGSPLVIEPADKDDQTT--L
A0A2E0SHG0      SLLEEVKEGETVVDYVIQHLFLS--------------TQGEEGNVAVSGGH--------W
A0A358MY60      AVGFSDPVQS---------------------------VNTIRDGLGIETAGTQT-----L
A0A355GJI7      ------------------------------------------------------------
M5U569          DAFRAKFNDDPRAFAGMSSKALQ-----------------FSPDVQGTRSASSL-----V
L7CND7          VVFQESLGGRPSGLAGLAFESLK-----------------FETDIEDARSASSL-----V
A0A0J1B8S4      NVFREQFHGSPVELAALASKMLE-----------------FETDLKDERSASSL-----V
F2ARR3          RPFRDRFENNPNLFAGLANGALE-----------------FETDLQGVRGASSI-----V
K5D8H6          RPFRDRFENNANLFAGLANGALE-----------------FETDLQGVRGASSI-----V
M2AKU0          RPFRDRFENNANLFAGLANGALE-----------------FETDLQGVRGASSI-----V
A0A3L7P7S7      DTAGAPKTDAPTGTVSATVNRFQGKEIQDLIDYLRAGVGIIKAKEAGSTTASNN-----V
M5T8W8          EVFRSKFGDNPAGFAGASGEALQ-----------------FNADVQDTRSASSL-----V
M5SF00          EVFRESLGGHPSALLGLANKALK-----------------FETDIQDARSASSL-----V
A0A2G1WDS1      EVFRESLGGHPSALLGLANKALK-----------------FETDIQDARSASSL-----V
Q7UVS9          EVFRESLGGHPSALLGLANNALK-----------------FETNIQDARSASSL-----V
A0A3C1QS25      QQVPSIAGLSPEMKLFQIQEGLE-----------------VDLEKDSEN----------L
A0A2A2WFP6      RSIPALRELTDDQFVALVRRGIQ-----------------FQTITDLKDSRDRL-----I
A0A255QXY0      REVAAVRGLTDREVMRLVRQRIR-----------------FDSVTDLKDSHDRL-----I
A0A1Z8MHR4      RQSPSMRGRSEAQVVSAIRGSVR-----------------FHTITAVKDSRDRM-----I
A0A2A2WC24      KSIPSLESSSETQIVSMVRSGIR-----------------FQTLTDQGDSRDRM-----I
A0A1G2YRE4      EAESTDLAGKMKQKLTGDNTKLD-------------AVTKLKRAISSGVISAKAVRNTEL
A0A255QXF5      QFSLADPESR---------------------------EQHLKQRLKIHGGGTKS-----T
A0A1I3GSP0      EIPALANAYDP--------------------------LREVTEGLSVSRSAGQESSFDNV
A0A2S8F9B8      NLPVVRENENP--------------------------LEWLQEALVVSFPGDAE-----I
A0A368KP63      NLPVIAENENP--------------------------LEWLQKELQVRFPGDAE-----I
A0A3L7P0L2      EI--FGNDKDP--------------------------LKSIWENLVVVRESGQETSFDNI
A0A3M1VG27      RLPSLATKKDP--------------------------VAAIITELKAKRVAGTDQSFLNI
A0A3L7UX05      QLPELKNSASP--------------------------EYVMDKKINVIDRVNSE-----L
A0A142XL75      NLAIVRKSPNP--------------------------VAWLDHAIKIDAPANSE-----Y
A0A3A0DR44      KIPEIKRQVAP--------------------------LEFLEETLKVSGEGGSE-----L
A0A3E0PW54      ELPAFQKSKDP--------------------------VMDIIDSLTVKRSAGSDQSFVNL
A0A2D5GZ77      QLSTLAGEKDP--------------------------TQDIIDSLKVKRISGNDRAFLNI
A0A3D3R1Z6      QLSTLAGEKDP--------------------------TQDIIDSLKVKRISGNDRAFLNI
A6BZU4          QLSTLAGEKDP--------------------------TQDIIDSLKVKRISGNDRAFLNI
A0A1N6KY57      KLPILTKVSDP--------------------------IEWLENELKVDFAPGSE-----I
L0DK20          KLEVITKAVDP--------------------------IEWLEKELQVDFASGSE-----I
A0A2D6ST10      GLSEWTDPGQNT-------------------------QEWLEENLEVSSRASE------F
A0A1Z8MPL5      ELEYIKEAQEDGIDPIDYLANVL-------------IIEVPDSEKEMKGYGGQ------I
A0A1Z8MBT6      ADPTTR-------------------------------ETNLRKNLSVAGAGTKD-----K
A0A2A2W6A9      PDPDVR-------------------------------DQKLRSSLSIGSAGSRS-----T
A0A177Q3B7      SLAILPRDPEKQ-------------------------IAWLQAELKVDYKTGPE-----F
A0A142XAP8      SLDTVKQSEDP--------------------------VAMLEDTIRVAVAAPE------I
A0A2Z3HEL7      SLALVKTADDP--------------------------VAMLEDAVRVSVAAPE------M
A0A3L7Q373      QISNFAGAYDP--------------------------LKAVWEDLQVKRVAGQESSFDNI
A0A353Z859      KLPTITDQEDP--------------------------LIFFEKNMRVTNPATE------F
A0A2E0AW64      EADDP--------------------------------IAELKRNLSIKSAYRDS----NQ
A0A351FZ59      EADDP--------------------------------IAELKRNLSIKSAYRDS----NQ
A0A2E0X6Y6      RIDLVDEAPHEW-------------------------IDRLAALSSSSVTRRTN-----L
A0A3M1TFJ0      ARQLAEDIGSEDPNAL---------------------AMAFLAGVDVHPEETTY-----V
M5T666          -----------DPATA---------------------EANLRKNLSVSSGGTES-----R
M5U6N6          -----------DAETA---------------------EAQLRENLSVSSGGTEA-----R
A0A1C3EBY9      KLKTFAGESDP--------------------------TQMVLDDLKVKRVAGQDRSYLNV
D5SX64          KLKTFAGESDP--------------------------TQMVLDDLKVKRVAGQDRSYLNV
A0A354GX32      DLSEIKAQGEGR-------------------------VAWMKSAALVDDKTGLQ-----V
M5RUI3          DPEYAEVS--------------------------------LRENLKVTSGGNRR-----H
A0A2S8FCC0      RLPMVEQEPDP--------------------------VAWLQSALSVNFPDNAE-----I
A0A3B8ZJM2      MDPKKGVDVSPAEKS---------------------------------ERTITD-----Q
A0A1U7CLW1      SLPTVRKLLDP--------------------------IDWLSGVLMVDFPRGSE-----I
A0A142WPR7      KHPAFAGESDPA-------------------------SRIVRGLNVLADSKTPD-----V
A0A2Z3GZZ5      KARAAGGAGLPADDRAVADMIGT-------------GLTVVRDKDSAGPTIGSG-----V
A0A2E6AG00      TDLQCDLKNYPREDW----------------------VRXLREQXTVRSFRSTH-----I
A0A1G3A880      PQHQVDFRGQPRDQW----------------------IEILEDNLTAVAIRRTN-----I
A0A2E8ATT1      AALRVDFLSVPRDKW----------------------IDVLRANVSARSVRNTN-----I
A0A350KD81      -----------------------------------MAQQFLMGQTRGQAANGNT------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      APVGSAAADGQTTTNVHQERVLAAEEQRRLNLLRKATLQSRLKSVETAVANNEPRDALEV
A0A356ETW1      ---MLPSGDGKEILDPATKRALYFADELSKIERKRIDLQPTLARVQTAVRNGED------
A0A3L7NJY1      --DLVDTGDKTNSLSVVSETIKLLAAEYSEARRATEESRTRAASLNRAIANGED------
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      --------------ELLYEEISSRLSTLKAAIERGESHEALMLLVKTFLQKDQTSNSQT-
A0A1G2XSU7      AKQHLAPTNPELA----------------------RKESLLNALKQRLEELRQQADKNFD
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ISISFTGTHPETL-AKMCNMHAKKFLETHLELRFAASQDAVKWLQDQLVDKKLKVEEAEE
A0A0S8H0S8      ICVSLDSPYPSEA-DLLVNNIVEAFVSSSPGGNRSTAREILKTLRSEKARQAEELTANFQ
A0A1Z8MCI4      YAISFIDNDPVAA-KQLSDAIAESFMAVRTLLDSTQISNVRESLRPAISEWESTVLNQQE
A0A177PV03      LYLSFRGTNRDDC-QVILDAIMQKYDTYLKSKYERLNDKTVREVLNIIKELKKGMDETKQ
A0A1G2YIM0      IRIVMSSKNPREG-EQVVNAIIRAYMAVEVSNSVRGGDEKLSVLEDEYRTLTDKLQRQRK
A0A177QX42      LEISYVGPNAGDC-KKILDSVLASYKRWLESTQAGNRKVLEEILVSAKGDLDRRLGENRQ
A0A1G2ZG92      LEIAAYSPNPFEA-ANMSNKLATLYIEDRLERKREEYKAAKIFIKCQMKEVKEEYYKSLS
A0A1G3A0W0      IDVDFVDPSANEA-KLIVDTVLEQYIRYIAEMSNENEEELYRQLSERHTSLRSEIQGHEE
A0A2E7D3V4      LDITYKNRNKDDA-RQILEAVVDAYEAYLKNSQQEHNSETRELIDEANVKLEAQLQAKMA
A0A353BE27      IRIAYVSEDAETA-AKVVHAVVEGYEKYLADEYKTVGEEIAQLMEGAHADLTKRMRELSE
A0A2E0SHG0      IYATFEHTNKEDT-PRVLQAILNAYQDHVEETYRNPVNDAAENIRADFKKAEEEWESIQA
A0A358MY60      LRITYADPDPNIA-ALVCNEVAASFLEQRERLDNRRVIDLESWLTPSIDLWKAEVQGHER
A0A355GJI7      ------------------------------------------------------------
M5U569          ATLAFESSDRELC-LGAVKAYSSALQRLFAEKHKSSRTELLRLITLATDQLQPKMTELEQ
L7CND7          ATLTFDHSDPELC-EAAVKAYSAAVQQLFSEKHKSSRGELLRLIEDATKVLQPKLSELEE
A0A0J1B8S4      AQMTFENTDPELC-EAAIKAYSAALQKLFADKHKSSRSELLKLISIATNQMQPKMAELES
F2ARR3          ANMTFEHTDPELC-EAAIRAFSSSFQQFFADRHKSSRSELMSLISVATDQLQPKLTELEE
K5D8H6          ANMTFEHTDPELC-EAAIRAFSASFQQFFADRHKSSRSELMSLISVATDQLQPKLTELEE
M2AKU0          ANMTFEHTDPELC-EAAIRAFSASFQQFFADRHKSSRSELMSLISVATDQLQPKLTELEE
A0A3L7P7S7      LKVSFQSGSSTEC-VQALKAVIKGYKNYLDKEYNLADDQFMTRLERSSTVARREAQQLRE
M5T8W8          ATLAFESTDSELC-VGAVKAYSAALQKLFAEKHKSSRTELLRLITMATDQLQPKMVELEK
M5SF00          ASLSFEHSDPELC-EAAVKAYSAALQQLFAEKHKSSRGELLRLIRDATDNLQPKLSELEE
A0A2G1WDS1      ASLTFEHSDPELC-EASVKAYSAALQQLFAEKHKSSRGELLRLIRDATDNLQPKLSELEK
Q7UVS9          ASLSFEHSDPELC-EAAVKAYSAALQQLFAEKHKSSRGELLRLIRDATDNLQPKLSELEK
A0A3C1QS25      YLVSFSSPNQEDC-DRVLWGVLNGYQEYLNRKYKATGQELKGILDDLKRNYDAKAEELQA
A0A2A2WFP6      AAVHFDGHDPEVC-VAAVNAVSDSIRSHFQEERELRVNEFEQLVSQAQEKLLPQQAELEE
A0A255QXY0      AVLSFEHDDPQVC-EAAVDAVSRAIGAHFQEERESTINEFTRLINKAQDKLLPQQLALER
A0A1Z8MHR4      VGLNYQSQDPYAC-VAAINGFYSAIRQHFDAERQATIKEIENLVNNARNKLLPDQEKLEQ
A0A2A2WC24      AALNFDGRDPQVC-VATVNAVSQAISQHFERERQSTINEVGELVRNAMDKLIREQKDLES
A0A1G2YRE4      LKLTMVSKKSEEA-QQIINAFINAYMAVEVSSSSEEQDRKLNLLDAERKLLEDKLRSTND
A0A255QXF5      MVVTYTDADKNFS-AEVCNAIVGAYLQKRDEYDNLRISRLVQYLGRQIDELKRRVEEQKE
A0A1I3GSP0      LSITYLHPDKRIA-RAVVQAMVEAYRDYLEDTRDENAQQLYKSLLERQQQLENDVKSLEA
A0A2S8F9B8      LQVSLTNADRQAA-MKLVNAVVGAYKDEVIESERLARVQRLENLERVYNETETKARQKRS
A0A368KP63      LQVSMSSADPTTA-MKIVNAVVGAYQEEVIESERMARVRRLDNLERVYNETEAKARSKRS
A0A3L7P0L2      LNISFTSADKVEA-KKVVSAVIDAYADWLEAKRGSGSQLLYKTLLDQKKMMDEERTRLED
A0A3M1VG27      IELTYSNRYAQDA-VAVLDAIVAAYSQYLQESQKEHTNELLTLIHTATVDLRKQLEAKQQ
A0A3L7UX05      IEVQMVGTSPQNA-TDIVNAVVRSYLKQAGRWANETTTAQIGKLTRELERRNKEVEDLRN
A0A142XL75      MRVSLEGDDATES-KIILEHLKTAYLADVDLRDNGAKWSRLQKLEETKRGYRSELEKFHK
A0A3A0DR44      YRIEYVGENAKDA-ATIVNGVIRVYLGKLVADEKTRREEMLVQLENVKLKREAEIRSIRE
A0A3E0PW54      IDISYLHPDKNAA-GAVVRGLVAAYEDYLEAKQDSNSQELRESLARRQTELAEEIERLQS
A0A2D5GZ77      LTLTYENPNAKDA-RVVTQAIVDAYKRYLHEVREENTEDIIQQLKQAEKQIATELKLKKS
A0A3D3R1Z6      LTLTYENPNAKDA-RVVTQAIVDAYKRYLHEVREENTEDIIQQLKQAEKQIATELKLKKS
A6BZU4          LTLTYENPNAKDA-RLVTQAVVDAYKRYLHEVREENTEDIIQQLKQAEKQIATELKLKKS
A0A1N6KY57      LRISISAEKPDLP-MLLVNAVTQAYLDEIVDVEMKQSRQRYDLLKSTWNRYQENLREKRQ
L0DK20          LRISINGEKPHEP-MLLVNAVTQAYIDEIVDVETKQRRQRYDLLKETWNRYQENLKEKRK
A0A2D6ST10      ISISLSGERPTEL-KDTVNAVMGAYLQEEVAGAAAARRERLTKLENLFAKRRAELETKRR
A0A1Z8MPL5      LRISMRGDDPDQL-KQILEAVTDAYLEEVVTEERAEWLKQKDVLQAQYLEKVDELRLKRE
A0A1Z8MBT6      MMIKYTDTDRDAA-AAVCNAVVAEYLQRRAEFDGTQSRRLISVIEKQIDELDVEISAKEA
A0A2A2W6A9      LTVSYTDTDKQFA-ADVCNAIVESYLQKRDEFDNRRIGRLESWLTPQVEQLRRKVEEREH
A0A177Q3B7      MRLSLTAERAADV-KTLVGEITDVYLKEVVYKERTRKLERLKHLQEIQSKYEESLRSHRE
A0A142XAP8      LEVTLTGNNIEDM-KVILDHVVRRYVDDATVLDRKQRDDQSAALQATLTSIEKKLSDQKS
A0A2Z3HEL7      LEVTLTGNHLDDM-KVLLDRLIKRYLDDTNAFDNRSRTEEREHLRNRRSEVQNEIAQGER
A0A3L7Q373      LSIAYQSKDPKLA-KQVVESIVAAYGDWLEAQKDNNARDLYETKLTQKNALDEERKALEK
A0A353Z859      LQMSLTGNNPADL-APILNAVVEVFLREVAQREAQERTKIVNSIDAAKADTRAKLGDFIK
A0A2E0AW64      WYLTYRSTDPQVA-AMLANRIYESFIRTKGDFDVSLRSALLSRLEELRKDKEDDVDRLRQ
A0A351FZ59      WYLTYRSTDPQVA-AMLANRIYESFIRTKGDFDVSLRSALLSRLEELRKDKEDDVDRLRQ
A0A2E0X6Y6      IDVKFRSKRPDTA-AAVVRAIIDSYLEWVRDTHQGAAGAEKRRLTEKLARREQELEEFEA
A0A3M1TFJ0      VDVTYTSSHEERC-ALYANALAEAYTRQRKSLWGQKTRQTEASVAVVVSRLGATLAASRK
M5T666          LVVSYTDTDREAA-AVVCNAVVDSYLRQRDSFDDTRVNNLERWLEPEIQRWEQEVEERQQ
M5U6N6          LVVGYTDTDREAA-AMVCNAVVESYLRQRDSFDDTRINNLERWLEPEIQRWEQEVESRQQ
A0A1C3EBY9      LDVTFQSASADDA-RHVVKAVIDAYASYLNESRSEKTTEVFKTAQDAHDTLQKSLREKEE
D5SX64          LDVTFQSASADDA-RHVVKAVIDAYASYLNESRSEKTTEVFKTAQEAHDTLQKSLREKEE
A0A354GX32      LRLSLSGDQPDEM-AKVVNEWAATCDSLYTASEEAKIKERIKQVLKNYQDGTTHLRNKKN
M5RUI3          LVVSYEDSDGVAA-ATVCNAVVDSYLRQRDAFDQARMVKVERGLEPEIQRWQQEVEQRHH
A0A2S8FCC0      MEVRLSGENSKAI-SKIVNAVVQAYMDEVVDAEAISRTTRLSSLERAYSETENDLRSKRS
A0A3B8ZJM2      LKISYIAGDPDTA-MAVVNAIVLGYQKFLDEEYKFVDDEVIKLFNEVKKKLDQDLVAHKN
A0A1U7CLW1      LSISMTASCPPLDLSTLVNAIADSYLTEIVDKERLARVERLERLKELFADYQKDLTEKRL
A0A142WPR7      IRMSFRDSDPEVC-QVALEAVLDGYRSYLGETHQTTSKDVAELIKEAKDVLLKQLETKED
A0A2Z3GZZ5      LNLTLREPDPELC-KRLLEAVIAAYQAELYSIYEKASQDRIATLDRLLEAVKGQRKAAGE
A0A2E6AG00      IEIRYRSQRADAA-EAVVGAIVDACLEFMDEYHRNVASEVVAILHKERKEVEQQLVTRDR
A0A1G3A880      IRVSYQSRSASAA-VAVIRAVMQSYFDFIEKTHRGTAGQIMDVLGQEKVRVEAKLDEKKA
A0A2E8ATT1      IELSCRSRDPAAG-EAVVGAVVDSYLEFIERNHKDVSVEVVTILEKERQVTEAKLEQKKR
A0A350KD81      ----------SEG---------------------QIASPGTSQVDRARTALETHLMPLLI
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      LIRRFLAQDGAAG---------------------SEFQQQQ---QQDIAIFESRLLPLIL
A0A356ETW1      LRRHWITVADVVG---------------------QEMMMRSFGLSPADIQTQASLEQTLL
A0A3L7NJY1      ILQFAMEALDSAG---------------------RQLIEQSMGLGSSDALHVQRINEELL
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      -------------------------------------------------VVSGATERQQL
A0A1G2XSU7      EM----------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ALILYKEK------------------QNIVGLGETAGIIEQKLEGLKSNLTEIKIEKIKL
A0A0S8H0S8      AMEEFKRA-----------------NGIISLADGKGSIMAQRLGELSAALTVAEVEAILA
A0A1Z8MCI4      RLQ-------------LAARSAGIPLDEMTQQREFLASLKRAHMDATMQLKAVQQELSSL
A0A177PV03      KEDAWLAKNP----------------PPTEVSETLLTNLRTRRSNETILRDSLQRQVKDL
A0A1G2YIM0      IVRQMAEE------------------FGTSALTGRQDMMLQQVTMLQSEMTRIQTQKLSL
A0A177QX42      KYDDFRNTATLIF----------QDNKGINYYEERLRKIEDERHQKMIALQELQATRNAM
A0A1G2ZG92      ALSDFKISKKTVNLDTETQNLINKIATLQGEYEDNEKTILESRRK----IVDSNKKLKEM
A0A1G3A0W0      FVANLSKT-----------LGTATPGELVSSKRVRLDQTKARLNELKQSIALLEWKKKAL
A0A2E7D3V4      AYVDFRQSAPLQWKRPPGTE--SSPADVVNVHQDRLEAIDAERRKNLLEREDLQSKIAVF
A0A353BE27      SASQFKEANPD-----IVFIGDDVNDPYHATWETLHKKLIDIRSR--------KSEIDAL
A0A2E0SHG0      KYKNFVESSQ------FYTSDSDSVNVYLNTLNDYETQLRLLQFQRYASESRLEIIKESL
A0A358MY60      RISELSKS-----------TLGFDPNNPVESLEYDLSTLSNLRKE----VQDMRVQESWL
A0A355GJI7      ------------------------------------------------------------
M5U569          RYRDFRTSAP------LV---WNEEGKAVNPHRERQLYLTERRSELFEQARQKSIELASI
L7CND7          NYREFRTNAS------LV---WDENGKAINPHRERQLYLTARRSELFETLRSESVELSAI
A0A0J1B8S4      RYREFRQDAP------LV---WDENGQAINPHRERQLYLTARRSELFEELRKKAIELTAI
F2ARR3          RYREFRTNAP------LV---WDQNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAI
K5D8H6          RYREFRTNAP------LV---WDQNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAI
M2AKU0          RYREFRTNAP------LV---WDQNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAI
A0A3L7P7S7      DLRLI--EEQ------LQ---KNTTSGVVN----RQKLLQEKSNGLMNRLDR--------
M5T8W8          RYRDFRTDAP------LV---WNEEGKAVNPHRERQLYLTERRSELFEQARQKSIELAAI
M5SF00          DYRAFRTKAS------LV---WNENGEAINPHRERQLYLTERRSELFETLRSQSVELSAV
A0A2G1WDS1      DYRAFRTKAS------LV---WNENGEAINPHRERQLYLTGRRSELFETLRSQSVELSAV
Q7UVS9          DYRAFRTKAS------LV---WNENGEAINPHRERQLYLTERRSELFETLRSQSVELSAV
A0A3C1QS25      KIQEQVEAHG------EKLAFWNAEG-IINLEQQRMQELDAHIRQLELQKTEYQSQLDRI
A0A2A2WFP6      AYKSFRESAP------LE---WDPNGQVVNPHRHRQFQLQSFRDQLEQKQRQLDGELRFA
A0A255QXY0      DYKEFRREAP------LE---WDTQGNVINPHRQHYDHLQTMRQGLERRRRQLGTELTFV
A0A1Z8MHR4      EYRRFRETAP------LQ---WDLDGQAINPHRERQVMLQKNRLDLEQQLRLLSSDLRLA
A0A2A2WC24      EYLTFRDNAD------LE---WNVEGQAINPYRERQFQLQSYRTDLEQKKRELNSDLRLA
A0A1G2YRE4      SIRQLGTE--------------YGSXXXIDRQDMKLRRVTALQST----LTAVEARRISL
A0A255QXF5      AVAKFARE--------ASGAAPGER-VAEIESAESFLLIEKLRSQ----ISNLEIQLAMI
A0A1I3GSP0      EYQKFRHDAPVFLKASPIVSINGMPAPAQNQYETELASIETAQNENLRKRSSIQARLATL
A0A2S8F9B8      DLRQLAET--------LGTSDSETLSLAQQGSVQHYGLVRNELAQVRFDLMRSEGELDFL
A0A368KP63      DLRTLAET--------LGTSDSDTLSLAQQGSVQHYGLVRNELAQVRFDLMRAQGELDFL
A0A3L7P0L2      EYEKWRGESPFYISSSPVVSAQGVPTSMPSPYQANLQDLVTRRNLNRDQLRKTKIKIDQL
A0A3M1VG27      EYLRFRAEAPF-----LWRRPTVADESSQDVISVHIDEVQKIQQA----LSGVTVEQTVV
A0A3L7UX05      NIKLLGSE--------LGAADPELIKDRSRLTLEDYTRMSRDLSQLEFERITAESRVERL
A0A142XL75      QIDTIAAA------------------LGTKDEATLMTFDSFLRDELRLAQRDLQNARENL
A0A3A0DR44      KIVEIEKT----------VVGKVPAKGDTGAAGSVLSPVFALQQR----LVEIEADREVL
A0A3E0PW54      EYHAFRADSPYYLPTPPTVAVNGSVIPGKNPYQARVEKIGTDLSR----NRVLQSEIASR
A0A2D5GZ77      EYQKFRENAPL-----YWESTPGSEAAVAGSTNVHQERVKAIDNE----RRLNLLKLTEL
A0A3D3R1Z6      EYQKFRENAPL-----YWESTPGSEAAVAGSTNVHQERVKAIDNE----RRLNLLKLTEL
A6BZU4          EYQKFRENAPL-----YWESTPGSEAAVAGSTNVHQERVKAIDNE----RRLNLLKLTEL
A0A1N6KY57      QLKGLTEL-----------AGSDNKSTIATIHQHELDRLGRAEDE----LSRIQSELRSL
L0DK20          ELKRLTEL-----------AGSDDKKTIANIHQHELDRLGRAEDE----LARVQSELRGL
A0A2D6ST10      RTETLSEQ--------TGAITEGQRDWKYQNDLAIQRSLIAEFRQVKVQLINLRFDQTHL
A0A1Z8MPL5      DLQELAKT--------VGTSDPD---TANATQQLLLDQILYLRRQ----ISEVREQSVQK
A0A1Z8MBT6      EVRQYEVE--------AQGFSSNNQ-VSVIEDQSQTSRLRELIDQ----RFELEQQISLI
A0A2A2W6A9      LVSQLAKE--------AHGVAPGEK-VAALENSDSLSVAQKLRNQ----ISDLEIELAML
A0A177Q3B7      TVRKLILALGSGDAQVLAVKQRYAAEALGQAERELLQTQSELRRA----RLAGEVKRRRI
A0A142XAP8      KLELAGRT--------NGTTGAEATSNALALLQKQHVEADALFVGAGREIEKAEAELKVV
A0A2Z3HEL7      VIEFTARN--------LGVNGTGDANGSTQLLHIKFGELDRMFTAANHELGDLQSQLSVY
A0A3L7Q373      EYSQWRADVPFYINTTPAVTAQGTPLAQQSIYQAKLSDVITRQSANEALLRSTRSKIGIL
A0A353Z859      TKERLVKK--------LG----GDNETAAEAAKARESFYADIRKQ----SVMAKIEKTKI
A0A2E0AW64      DFRNEA----------IRNLNWDPY-AVAQTESDPGASALSYEKQ----LAKLAIDQAIV
A0A351FZ59      DFRNEA----------IRNLNWDPY-AVAQTESDPGASALSYEKQ----LAKLAIDQAIV
A0A2E0X6Y6      GLRALRRQ--------VGHL--AVS-SKDGLTDPIIQQALRVNEM----LMDAQQQRLQL
A0A3M1TFJ0      KLEEFLSS--------N--------------------------------------QTPLF
M5T666          RVHMLSEK--------ALGFAPGRN-VDRAESESSMSRLADLRSQ----VGELEIELALF
M5U6N6          RVHMLSEK--------ALGFAPGQN-LDRAESESNLSRLSDLRAQ----IGELKIELALF
A0A1C3EBY9      AYLKFRESAPLQWRAPIGAI--AAD-GTSGATNVHQERVIAVEEQ----RRLNLLRRTEI
D5SX64          AYLKFRESAPLQWRAPIGAI--AAD-GTSGATNVHQERVIAVEEQ----RRLNLLRRTEI
A0A354GX32      ELQARRDL--------LGLK--DPL-TLGKELDSTQDLLKTPQSQ----RLLLELDLAKS
M5RUI3          RVQKLSET--------LVGFAPGQK-IAALENESNMTLMAELRSR----ISDLRVKIAIA
A0A2S8FCC0      EFRRLADT--------LGTG--DTA-SLSLVQQNALQQFAALRSE----LTKVQLELLRA
A0A3B8ZJM2      GYDKFLVD--------IKQQ--GVLFNVTEPVNHFFEAAMRNQQQ----LTAKRLEANQI
A0A1U7CLW1      KFKEMAGS--------IGTS--DKQ-AAAVRQQMMVEHLGLARQE----LLKLNSDVRKS
A0A142WPR7      EYHKFRQD--------APLL--FAK-EEGA-KNIHQERLAGIEQA----RSALLIALHEK
A0A2Z3GZZ5      HRITHLTE--------LRGI--TTE-D----VSSVRTRVSALRDQ----ARALRTDISNL
A0A2E6AG00      QLLNTKRS--------LGDL--GMR-DASNSLHPLVQRVVQINDS----LIEAQQKRIRL
A0A1G3A880      ALLAARRN--------FGDL--GIK-PGGQVVHPLVQRAVRLNEA----LVEAQEKRVEL
A0A2E8ATT1      SLLELKRQ--------IKDF--GLR-EGS--IHPEVQRVLQLNKA----IMEVQEERLQL
A0A350KD81      QKNRLERD----------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      EEKQLLRD----------------------------------------------------
A0A356ETW1      ADQALLES----------------------------------------------------
A0A3L7NJY1      DLRSRLRD----------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      DTQL--------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      KALS--------------------------------------DQIKQYSKDPTLTKLIPE
A0A0S8H0S8      KAEY-----------------------------------------DAARAMMNDPGRMRY
A0A1Z8MCI4      PDAD------------------------------------------LSDSEGVRVAELED
A0A177PV03      DHAI-----------------------------------------KIGQGAEMFNDMRRV
A0A1G2YIM0      EAQI----------------------------------MMLEKAEEETLPLEKVLTMKNE
A0A177QX42      KDAL---------------------------------------SRGASKEALLLMANMLK
A0A1G2ZG92      EKFR-----------------------------------KESKELTRSDALKSLQTKLDG
A0A1G3A0W0      IDDS------------------------------------------NNVAFASSPAIQSE
A0A2E7D3V4      EEAI-----------------------------------------ASGQSMESLTMLVKF
A0A353BE27      TTQV-------------------------------------RKSLNKGHSPESLMRLLAM
A0A2E0SHG0      KPEN---------------------------------REKYNDFQRLALISAESVERMGL
A0A358MY60      ETAV----------------------------------------TRQLDTNATPFNLNEE
A0A355GJI7      ------------------------------------------------------------
M5U569          KSIA-----------------------------------------KEGKDPTVSLSIIGQ
L7CND7          ESIA-----------------------------------------READDPLVRLSIIGQ
A0A0J1B8S4      DSIS-----------------------------------------NEAKDPLVRLSIIGQ
F2ARR3          QSIA-----------------------------------------DEAEDPIVGLSIIGQ
K5D8H6          QSIA-----------------------------------------DEAEDPIVGLSIIGQ
M2AKU0          QSIA-----------------------------------------DEAEDPIVGLSIIGQ
A0A3L7P7S7      ---V-----------------------------------------RARQEELTDQMRLAG
M5T8W8          QSIA-----------------------------------------EEGKDPLVSLSIIGQ
M5SF00          ESIA-----------------------------------------READDPLVRLSIIGQ
A0A2G1WDS1      ESIA-----------------------------------------KEAEDPLVRLSIIGQ
Q7UVS9          ESIA-----------------------------------------KEADDPLVRLSIIGQ
A0A3C1QS25      AQLE-----------------------------------------EEGKTQAVIVFILEQ
A0A2A2WFP6      ESMR-----------------------------------------SRHKNPLMVAMIIGQ
A0A255QXY0      TNMR-----------------------------------------TQQRHPELVARVISE
A0A1Z8MHR4      QKTI-----------------------------------------QRHQDPAIVAQVIGL
A0A2A2WC24      INTR-----------------------------------------KLHSDPVLVAQIIGH
A0A1G2YRE4      EAQV--------------QFL--------------------EQIKEQSITPEDMLRIRNE
A0A255QXF5      DAGVSIRNPSADDN---------------------------IDDLPMTHFVPPYIPVVKG
A0A1I3GSP0      DRKL-----------------------------------------KDNASREELEFWVMH
A0A2S8F9B8      TSSN-------------------------------------KAKMEAQAVAGNATAEPGK
A0A368KP63      TSSN-------------------------------------SSSQAADKAQAEPSKEVEK
A0A3L7P0L2      KEMM----------------------------------------ANPEERETLQAWIMNS
A0A3M1VG27      RSKI--------------RAL--------------------EEAIASGRSPRELTALVKL
A0A3L7UX05      RGEL-------------------------------------AQPPVIAQRQNLQDAVYQA
A0A142XL75      ELAKPTPKIGINSLDEEGAALTLPWDLGVVEIVPPLSPAELRAQIDAEIRQDAQLKQLAE
A0A3A0DR44      NAQIAAYG---------------------------------QPVASKPPKIPDDVLDVEV
A0A3E0PW54      IATL-------------------------------------EELQASGESREALEFFVIH
A0A2D5GZ77      KSKI--------------DSL--------------------KAAIASGESKETLELLAQQ
A0A3D3R1Z6      KSKI--------------DSL--------------------KAAIASGESKETLELLAQQ
A6BZU4          KSKI--------------DSL--------------------KAAIASGESKETLELLAQQ
A0A1N6KY57      RIES--------------EVL--------------------HEKAALNQMMVTPAMIADA
L0DK20          RVEH--------------EVL--------------------QEDVARNSSMITPAMIVDA
A0A2D6ST10      ENDK--------------------------------------------------ASGQPA
A0A1Z8MPL5      QRDLRAYEQQVGSLALAGSIL--------------------PEDIEAELSENEDLAEYQV
A0A1Z8MBT6      EQDLESIEAGENPLAVISGDL--------------------LEEMDEQDFTPPRSMVKKR
A0A2A2W6A9      DAGVGIRNPSESDDIIVP---------------------------SVAEFVPPEIRVQRG
A0A177Q3B7      KAIT-------------------------------------EKGLSGSATPIDLEVDADP
A0A142XAP8      QKQL-------------------------------------ED--KDPKT-PPDPAIVTQ
A0A2Z3HEL7      QDQL-------------------------------------EERKRDPKKFAADTQLLKL
A0A3L7Q373      KEMMANPEERESIQTYIMSSL--------------------AASSSPGGEGGSGAGLVST
A0A353Z859      NAEL---------------------------------SLRERQEKIEGKDLDEQLIDLHL
A0A2E0AW64      QYQI-----------ERAQGI--------------------HQKVEENLNAQSESIEISD
A0A351FZ59      QYQI-----------ERAQGI--------------------HQKVEENLNAQSESIEISD
A0A2E0X6Y6      QATL--------------AAV--------------------EEAVATGADVFQHLAGLEE
A0A3M1TFJ0      ERQE--------------ELL--------------------IQQIDANNRAL-EAVRRDR
M5T666          DATK--------------DLPVALPPSETAQLPDA-PVVPTLAETEVQKAAIREADIQEA
M5U6N6          DATE--------------DFP-ALPLENTSSSPQAIPSVPAVADIKVQKRIVNESDIKSA
A0A1C3EBY9      NSRI--------------QAL--------------------QKAQDQGESTSTMEMLIRR
D5SX64          NSRM--------------QAL--------------------QKAQDQGESTSTMEMLIRR
A0A354GX32      ESEL--------------SIL--------------------NERIKAPEKLTVSETAVEE
M5RUI3          DASRVSAAGEAEFVPPVEAAV--------------------IPSAVVERHVPSEQEILNA
A0A2S8FCC0      RANVLGMEPREAPVEKDAVVA--------------------KKPVVDGDKEAPEASVANS
A0A3B8ZJM2      KSIL--------------DTV--------------------ETAMKSGDFRAQELLLLIN
A0A1U7CLW1      QARL--------------NVL--------------------ASKPELEPTSNQTVSTLDT
A0A142WPR7      TAEL--------------DSL--------------------KNAMARGGNREALALIINA
A0A2Z3GZZ5      DAQV--------------ELV--------------------SRTGPAPEDRQLAFVQLTA
A0A2E6AG00      QATY--------------DAV--------------------QLAMREGRDLRQYVTAVEP
A0A1G3A880      QSAL--------------AAI--------------------QNAVRSGADLQHHLLSVEE
A0A2E8ATT1      QASL--------------TSV--------------------RSAVRSGKDLRQHLINLEP
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      IVKDGSINTLKAKY----------------------------------------------
A0A0S8H0S8      FAEQGSRSHLAQAGPDDAELA---------------------------------------
A0A1Z8MCI4      GEATDLTR----------------------------------------------------
A0A177PV03      SAHPQTGNTKLDEKL---------------------------------------------
A0A1G2YIM0      ILRNDAQEQSLS------------------------------------------------
A0A177QX42      PNGDEKSDPAASLQPKVDPFMEKM------------------------------------
A0A1G2ZG92      YLVDIAQ-----------------------------------------------------
A0A1G3A0W0      YSDDEEWRK---------------------------------------------------
A0A2E7D3V4      YISTSEKAVAPQTIVTGLPGQENTAQL---------------------------------
A0A353BE27      VSGGGTASANGAWDLEVFRQEQAQTRIRTDEMSRRLEQ----------------------
A0A2E0SHG0      ILSVENLGVQIATNTATTEVSQANQILRAKTADTEFDTL---------------------
A0A358MY60      LLVPEPTNADIKRFVENSQEVTRQRGIVAEQET---------------------------
A0A355GJI7      ------------------------------------------------------------
M5U569          LVGTTFD---IPEVMQTRQDLREGDAELKQLELDQQL-----------------------
L7CND7          LLGKTFK---IPDSAQISQNMREGDAQLAQIELDQQL-----------------------
A0A0J1B8S4      LIGKNFE---IPDSKRISQDMRDGDVELAQIELDQQL-----------------------
F2ARR3          LIGKTFE---VPGKAVFNQNVREGDEELAQIKLDQQL-----------------------
K5D8H6          LIGKTFE---VPGKAVFNQNVREGDEELAQIKLDQQL-----------------------
M2AKU0          LIGKTFE---VPGKAVFNQNVREGDEELAQIKLDQQL-----------------------
A0A3L7P7S7      TLSQTDL---LPGV---------GDSPASEVNLTRNQ-----------------------
M5T8W8          LVGKTFK---IPETLQTRQDLREGDAQLKQLELDQQL-----------------------
M5SF00          LMGKTFE---MPESNQISQNMRDGDAELAQIELDQQL-----------------------
A0A2G1WDS1      LMGKTFE---MPESNQISQNMRDGDAELAQIELDQQL-----------------------
Q7UVS9          LMGKTFE---MPESNEISQNMRDGDAQLAQIELDQQL-----------------------
A0A3C1QS25      HEKIKED--------------------KEKNSEETDI-----------------------
A0A2A2WFP6      LSDVFED-SRLMLNGKSTDSLATDDLEMQKIEVEKKL-----------------------
A0A255QXY0      LSDEAHD-LGDVPFGMRKLMDVKEDIGIQQIEIEKSL-----------------------
A0A1Z8MHR4      LGSLNHEGMTGIKRALNGENQRQDDLTLQRLEVQRKL-----------------------
A0A2A2WC24      LGSVVNE-FEPLRQIVGPGNAAPDDLTLKKLEVERAL-----------------------
A0A1G2YRE4      NINSDPMVQELTRNIVS-------------------------------------------
A0A255QXF5      KIDDSDVQDFIEKDESVKLANERYERHRREVVNLEVAEGWRRAQAYYADQQKLRDEWKTK
A0A1I3GSP0      SLSTGTAGAGGGNGGGGASIAGPPEKGALDSQL---------------------------
A0A2S8F9B8      QENSGTGQTPAEDKGNSANSSGEEDADGSSDASEEIDLESIEYSETEMNEAIASDPISVK
A0A368KP63      TVSGENAALPVGSDQALVADAATVEGEQSEEIEPQL-------SEVEMNEAISSDPISVK
A0A3L7P0L2      ISSSSSGGPGAEGGSSGGGLLSSPAGKMELDQQL--------------------------
A0A3M1VG27      FLYSEGHKNAAEAFAAPADAPDVVRTQL--------------------------------
A0A3L7UX05      FYADRDVADLADA-----------------------------------------------
A0A142XL75      AAAS--------------------------------------------------------
A0A3A0DR44      KMHPEVREQSRVISAMRLQLED--------------------------------------
A0A3E0PW54      WMSQGKSSSGDGESGGGGGSLLTEPPVRAELDKRF-------------------------
A0A2D5GZ77      FLMGQTRGQAANGNTSEGQIASPGTSQVDRARTALETH----------------------
A0A3D3R1Z6      FLMGQTRGQAANGNTSEGQIASPGTSQVDRARTALETH----------------------
A6BZU4          FLMGQTRGQAANGNTSEGQIASPGTSQVDRARTALETH----------------------
A0A1N6KY57      ISRDRSIELLKDKEA---------------------------------------------
L0DK20          INRDHSIEVLKEREA---------------------------------------------
A0A2D6ST10      EVPDDVLEAALSRDPQYAAASKKV------------------------------------
A0A1Z8MPL5      SIAE--------------------------------------------------------
A0A1Z8MBT6      LVTRPVLDQAISQXRKVVTQKGVVDRHQAALIAIKADRRF---GPGYVGIQETEDLLVTA
A0A2A2W6A9      EIDPKRLAAMVENSRDVFLAKERYEIYRKQVLELEISERWRFDKERYARLQKDRDEW---
A0A177Q3B7      SIQTLLAHKAR-------------------------------------------------
A0A142XAP8      LVAADVRVKAAKSAYT--------------------------------------------
A0A2Z3HEL7      AVARDKRVVAANELWQ--------------------------------------------
A0A3L7Q373      PTGKAELDQQL-------------------------------------------------
A0A353Z859      DRRNEVLSAAYTVEKEREALSRREGKGPA-------------------------------
A0A2E0AW64      TDLATMVDQSADMLQHNEDLARAQAAIKL-------------------------------
A0A351FZ59      TDLATMVDQSADMLQHNEDLARAQAAIKL-------------------------------
A0A2E0X6Y6      SVAAQMLQMTLGISEQDMTMLAEQ--------ESRLLK----------------------
A0A3M1TFJ0      IALDASLETIRRVLEQGRPLDMAPPVAQSPVVS-----ML-------------RRNLAEA
M5T666          IEGDVKVREASRVVGRYQAILLDLEVKDMVRVSRDYYNQM-------------KENLADA
M5U6N6          VEDDVKVREAKRVVDRYSAIVLDLEVKDMVRVSRDYYNQM-------------RKNMEEA
A0A1C3EBY9      FIANDGSGAELQQQQQEISAF-----------ENRLLP----------------------
D5SX64          FIANDGSGAELQQQQQEISAF-----------ENRLLP----------------------
A0A354GX32      ALNKEMKDDNLTKAQLEGLVKD----------QADLAE----------------------
M5RUI3          INQDAKVSEALSRVAHYKAILLELEDSDIVRIRREYYEEM-------------QGKRDEW
A0A2S8FCC0      DEESEEIDFELERIMAADEVMVAF--------KSQIMQ----------------------
A0A3B8ZJM2      DSSDLVKSTIFDQLFEDQDLAGKAMLESEKLEQSELLL----------------------
A0A1U7CLW1      LSTAEV-----------DPQVMEL--------RSRLAE----------------------
A0A142WPR7      NKESR---------ENGLPQEKSP--------VTELFP----------------------
A0A2Z3GZZ5      QYRAPVVPNA----ANGGELTGTA--------ALRALE----------------------
A0A2E6AG00      VVGREVMLAALGLNQHDVDAVAEL--------DQQLVA----------------------
A0A1G3A880      AVGREILLTGLGFNTRDAAVQANM--------ERSLLE----------------------
A0A2E8ATT1      VVGDRLISSALGLSPLSSQLVNDM--------ERKLIE----------------------
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ----------IPLLLEEQT---ALKRYGSGH-PDVINVRKRIDLVKSYYRQMGIDLPTMT
A0A1G2XSU7      ----------------------AEKEFKESDMLEIQEYKYK-------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ----------ADLQANKTM---LSEKYGEKH-PNIANIDLQLKEVENRIKLETLSLITK-
A0A0S8H0S8      ----------AAINQMQLQLVALKRQRTEGH-PAVQALQAQLARARQRQAKADKKFAENH
A0A1Z8MCI4      ----------LRAGLVAEKHRIIVEDSENVFKEGLVRIEAKIRDIDEQLSLRKAQASSEA
A0A177PV03      ----------WELYMQMAL---LQADYGEGH-PQIQSVKRQIEAVRALYYGAKAKEVEMP
A0A1G2YIM0      ----------SQISQLEQALIVANQTLTAEN-PEIKRRSELLENMKKKLRAREEELTKNF
A0A177QX42      ----------MPLLLERDT---LLERVGESH-PQVKMLDRKIESLRGLLREEAGAKGSKL
A0A1G2ZG92      ----------------------KSVEYTKEH-PDYKILEKEIETAKELIKNEKKVALNSV
A0A1G3A0W0      ----------LDYDVRAMKLQIANSGLTSKH-PDMIRMEKNLEFVEESLRLRQMQLNERW
A0A2E7D3V4      ----------LPLLIQEQR---LLRDLGADH-PDVQSVQSEIALVKAYYR-----QQGIP
A0A353BE27      ----------EQLNPLRIQLEVFSNQLGEEH-PSVATLRAQVQGLEKQLEKIREGERLYK
A0A2E0SHG0      ----------VSARLSLAE---RQSEFGANH-PKVREAEENLRDLEMLLDRSKEEIPDPS
A0A358MY60      ----------ILRSLEKNGLKNLRQEYYNEVSRKVTEAEKKLASAREAAE-----AQAVK
A0A355GJI7      ------------MLIQKNR---LERDFQKNH-PDLDAVNRSIETIINLY------RRQGL
M5U569          ----------VPLIIERNK---YAAEFGDSH-PTVKQLDVELKMMKSELKRLITEQAERI
L7CND7          ----------VPLMIERNK---FAAEFGEQH-PTVKALDAELTMMKSELKRLVKEQSDRI
A0A0J1B8S4      ----------VPLMIERNK---FAAEFGEQH-PTVKALDAELTMMKRELKRLITEQSERI
F2ARR3          ----------VPLMIERHK---FAAEFGEQH-PTVKALDAELTMMKSELKRLVKEQSERL
K5D8H6          ----------VPLMIERHK---FAAEFGEQH-PTVKALDAELTMMKSELKRLVKEQSERL
M2AKU0          ----------VPLMIERHK---FAAEFGEQH-PTVKALDAELTMMKSELKRLVKEQSERL
A0A3L7P7S7      ----------EIRILERKVKQLARTGLGKDH-PDVKNLNDEIKDIREYIDQMAK------
M5T8W8          ----------VPLIIERNK---FAAEFGEQH-PTVKQLDVELKMMKSELKRLVTEQAERI
M5SF00          ----------VPLMIERNK---FAAEFGEQH-PTVKALDAELSMMKRELKRLVKEQSERI
A0A2G1WDS1      ----------VPLMIERNK---FAAEFGEQH-PTVKALDAELSMMKRELKRLVKEQSERI
Q7UVS9          ----------VPLMIERNK---FAAEFGEQH-PTVKALDAELTMMKSELKRLVKEQSERI
A0A3C1QS25      ----------LELRLNLER---LLFKFGEDH-PEVKIV---------------------R
A0A2A2WFP6      ----------VPLVIRREQ---LEMAYGRSH-PEVKSVAMQIESSQSKLNGLIAQVDRRR
A0A255QXY0      ----------VPLKIKLEQ---MQMAFGASH-PEVVSLSTQIEASQRRLHELNLMGQQRR
A0A1Z8MHR4      ----------IPLQIKRDQ---MELQFGPSH-PEVKSIALQIESSQRKLNELNQLMSNRI
A0A2A2WC24      ----------IPLQIKRDQ---LELAYGASH-PEVKSIAMQIESSQNKLNELNQQMSERI
A0A1G2YRE4      ----------LERDLITAK---QMFAASN---PIIKQKQDLLEAFRSRI------EEQRQ
A0A255QXF5      LDEARAE---ASARAISVL---NADLEADYQ-QRLRERDDEIERQRKEFADLADIKQAEL
A0A1I3GSP0      ----------LTARLLEQR---LLHSLGDDH-TQVRNVRRQINTILDFYTRQGLTPPDLK
A0A2S8F9B8      LQAELERFEEAKYTLTPAA---YERYRQTNE-AAISTLESRLEKRREHLVLLIKERLAQQ
A0A368KP63      LQAELDRFEEPQYTLTPAA---YQRYRETNS-AAIKSLESRLKERREHLELLVKERIAQD
A0A3L7P0L2      ----------LMARLLERR---LLLVLGPNH-GDVRNVRRQIDTILDFYHRQGLTPPNLG
A0A3M1VG27      ----------VPLYLEEQR---LLSEFGEDH-PDVIAVRQRMEALRRLA------RRTAA
A0A3L7UX05      ----------LDDAKARLD---KLNKVSRGQDVSHREMNDRITDLKSKIKVLWERRRSAL
A0A142XL75      ----------AKERLNKVK---ERYQEGERP-PTVIKAEDDLKAAELRR------DKHRD
A0A3A0DR44      ----------IEKKSRQGK---QSSSYKDYA-ALIVRAEKELATLQDEVRAQLELRNSVV
A0A3E0PW54      ----------LDLQLMRDR---LTVQLGKDH-PNVIKLHQQLATLTDFYRQKGHTPPRSH
A0A2D5GZ77      ----------LMPLLIQKN---RLERDFQKNHPDLDAVNRSIETIINLY------RRQGL
A0A3D3R1Z6      ----------LMPLLIQKN---RLERDFQKNHPDLDAVNRSIETIINLY------RRQGL
A6BZU4          ----------LMPLLIQKN---RLERDFQKNHPDLDAVNRSIETIINLY------RRQGL
A0A1N6KY57      ----------LVQRAIDRV---SHLVRNRND-PAVKKHRDDLEAIHVALAAQ---RRKLY
L0DK20          ----------AAQKAIDRI---YHIARNKSD-PSLKKHRDELEAARTAMVAQ---RRKLY
A0A2D6ST10      ----------AELERRVQQ---NDVELSETH-PTLVKFKKQLADA----------QKHQQ
A0A1Z8MPL5      ----------LQAELDAYK-----QIYRDSSAEAIKSREAEITRLQEEQAGFA--QQLRN
A0A1Z8MBT6      QTELDRLMDSVKDEVRQEL---EQQFEAQYQ-QDLEDEGKELERLEDAW-----AKNRDL
A0A2A2W6A9      EAKLASAKQAASEAAVQIL---EDEIEEDYQ-QQLALAEKEKERLRAEFPAKVKAKQEEL
A0A177Q3B7      ----------VEKDIERIE---QVSVRGRRE-PAMKPLLDQSAALDAQLE-----KRRKL
A0A142XAP8      ----------ARKEYADKE---ATKATNPDLDDGIATLRAEVKKLEAEVKGA---EKLAA
A0A2Z3HEL7      ----------AANDLYTKE----LKNSNPE-NAYIQELKAAADKYKKALDDV---QNQVT
A0A3L7Q373      ----------LVNRMLERR---LLLVLGENH-ADVRNVRRQTETILDFYYRQGLTPPNLG
A0A353Z859      ------------------------SSVEEYA-RRLREAEAKLKEVREELRPKVIEELKER
A0A2E0AW64      ----------LRKELAEIE---QIAAGDPANLPRYQSAQRQIALQQEQIEKLDAARQPLR
A0A351FZ59      ----------LRKELAEIE---QIAAGDPANLPRYQSAQRQIALQQEQIEKLDAARQPLR
A0A2E0X6Y6      ----------TQEELQDAV-----NYYGPNH-PRISELKRQEQTLIAYL------RDYRS
A0A3M1TFJ0      ELELA------------GL---EQRYGENWP-QVR--AARARRDQLKLLLRQEIDTILGQ
M5T666          QSKLDQERQVARDRALKEL---QRLVEEDFR-QRKEVAERAFAWQQEQLKKQQQEMKRLQ
M5U6N6          ERKLAQERTLARDRATKEL---QRIVEEEYE-RQKEVVARTFAWQKEQLAKQQEELKKQQ
A0A1C3EBY9      ----------LILEEEKLL-----RDFGPDH-PEVKAVRKSIDTTLDFY------RKHGL
D5SX64          ----------LILEEEKLL-----RDFGPDH-PEVKAVRKSIDTTLDFY------RKHGL
A0A354GX32      ----------LQRRLI--------PADRENG-PGVGQLRDRISLIQNLVT-----QKKEV
M5RUI3          TANLETLKAGARERVVAML---NERADAEYE-RQKIAAKARIESLKEGF------EAQRK
A0A2S8FCC0      ----------LENEILAIE---QTAAPKIQN-QYVSRLRDKISELEEQV------SLRKD
A0A3B8ZJM2      ----------LQGELDHLL-----EKYGEKH-PNIRRIRSTIASVEKKIAHAKEAESRLE
A0A1U7CLW1      ----------LRRKHASVK---RISRQGNVD-PSILAIQREIKLVTGELEGR---RQELR
A0A142WPR7      ----------LLLDEQMLL-----ETLGPDH-PKVTAVQKRIEITRKYLTESLAEERKNA
A0A2Z3GZZ5      ----------FERRELTQA-----TGLGKDH-PRVLAVDARIAVLKEEL------ARPPA
A0A2E6AG00      ----------DRTKLANIR-----VHYGDRH-PKVQDXLKSIRDTQNYL------ENYQQ
A0A1G3A880      ----------YQSEMKSMQ-----QFLGPAH-PRLTEVAERVRATEQYL------TAYQT
A0A2E8ATT1      ----------DRSKLAMYR-----GHYGPNH-PQVRQLQHSLQLAQAHR------EEYHA
A0A350KD81      --------------------------FQKNH-PDLDAVNRSIETIINLY------RRQGL
A0A2E3Z6T8      ------------------------MHYGPNH-PRIIELQQDVRSLDQYI------NNYHS
A0A257WQ92      --------------------------FGPDH-PDVKLKRQTIQTALDFY------RRQGV
A0A356ETW1      ----------------------MRGRVGMSH-PSMIAQQEKVRLAREYL------QRNQE
A0A3L7NJY1      ----------------------ANLKYGVNH-PRIVAINDEILVKESYL------QQLPM
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      TKVNPVTGEPELVTGNDPIATYVVALEQQ-------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A0S8H0S8      LALCAQR-----------------------------------------------------
A0A1Z8MCI4      EAVLRDKAGKA-------------------------------------------------
A0A177PV03      KPGPDDPA----------------------------------------------------
A0A1G2YIM0      NDMLTKEIARNRVYKLKESRAE--------------------------------------
A0A177QX42      DLLSIHLES---------------------------------------------------
A0A1G2ZG92      SISIDPIYDELSKNL---------------------------------------------
A0A1G3A0W0      HHRPQDVPGTPSTIAQWRNQTINVLGAPV-------------------------------
A0A2E7D3V4      IPGADVVPGADKKTPKSADANLVTTYMAS-------------------------------
A0A353BE27      EELEKNGDALARKTGAEIRSIEERLEERL-------------------------------
A0A2E0SHG0      ATNPEPIE----------PIQLVSAYVTQ-------------------------------
A0A358MY60      AISDDLRQAAERARTIASKKAVIKTKQDA-------------------------------
A0A355GJI7      DISADNLESGEFQVAETKDVDFVNVYLKS-------------------------------
M5U569          VELMEANKVEGVDPAARAREAVDVI-----------------------------------
L7CND7          VELMEQNKVEGVDPAKRAEEAVNVI-----------------------------------
A0A0J1B8S4      VELMEQNKVEGIDPAKRAEEAVNVV-----------------------------------
F2ARR3          VELMEQNKVEGVDPAKRAMEAVSVI-----------------------------------
K5D8H6          VELMEQNKVEGVDPAKRAMEAVSVI-----------------------------------
M2AKU0          VELMEQNKVEGVDPAKRAMEAVSVI-----------------------------------
A0A3L7P7S7      ----------GIVPKGPDGKASSLLGLGE-------------------------------
M5T8W8          VELMEQNRVEGVDPAARAQEAVDVI-----------------------------------
M5SF00          VELMEQNKVEGVDPRKRAEEAVNVI-----------------------------------
A0A2G1WDS1      VELMEQNKVEGVDPRKRAEEAVNVI-----------------------------------
Q7UVS9          VELMEQNKVEGVDPRKRAEEAVNVI-----------------------------------
A0A3C1QS25      NEIRAWEELMISRGISLPGTGDNRADFVA-------------------------------
A0A2A2WFP6      KELSEQSQQGADADGSTQAQVVRAGEAVD-------------------------------
A0A255QXY0      KEIAPED--LPTEDGSSPTNKSNASELVD-------------------------------
A0A1Z8MHR4      AELQAKNQNDPESQRPRDASKNAASVMVD-------------------------------
A0A2A2WC24      AELRAQSQRVDYDKEAREARDERARMAVD-------------------------------
A0A1G2YRE4      KASEDFNN--------VASEEIAKVNKEK-------------------------------
A0A255QXF5      ARRADYMS---------------EHEAEN-------------------------------
A0A1I3GSP0      QTGKGPIS----SRSAALGLDLVSVYRDT-------------------------------
A0A2S8F9B8      LLEGRSRQGSIANNGLVVPAEVDNSLPE--------------------------------
A0A368KP63      LAAQAKGEIARKGSSILAVPEVDNTLPD--------------------------------
A0A3L7P0L2      TSDASTRN-----AQGAAGADLAQTYLTI-------------------------------
A0A3M1VG27      DDSLDRLD--------TGDSSLVDVYLAG-------------------------------
A0A3L7UX05      EKQLAQEG-------AGQSTSTLDRELRD-------------------------------
A0A142XL75      ELGTTLAR--------EVQKKHAQQEILR-------------------------------
A0A3A0DR44      STADRGQEAVQ-------------------------------------------------
A0A3E0PW54      GPGADTTD-------DAGPIDLVAAYIRI-------------------------------
A0A2D5GZ77      DISADNLESGEFQVAKTKDVDFVNVYLKS-------------------------------
A0A3D3R1Z6      DISADNLESGEFQVAKTKDVDFVNVYLKS-------------------------------
A6BZU4          DISADNLESGEFQVAKTKDVDFVNVYLKS-------------------------------
A0A1N6KY57      PIVTKQLQ--------DMGRDSDESKEIL-------------------------------
L0DK20          PIVEQQLQ--------EIGRDDDDSNKAL-------------------------------
A0A2D6ST10      ELQEELKPQIAQQILGGMAASGEMSNLER-------------------------------
A0A1Z8MPL5      EILAAVRR--------GERKSDAQYNHER-------------------------------
A0A1Z8MBT6      QIKNASKS----------SAGQRELVVKR-------------------------------
A0A2A2W6A9      ERRAEIMS----------DQEKQQIADRR-------------------------------
A0A177Q3B7      LRPEVVKR--------FADRAVRDLQAEF-------------------------------
A0A142XAP8      TEALEVAR--------AIDTANKKKRAEE-------------------------------
A0A2Z3HEL7      TEAETALR--------FSDLAERQKKVSD-------------------------------
A0A3L7Q373      TPGQTAAPGTV-----AINEGLSQQYLKV-------------------------------
A0A353Z859      SQLEEVLS------------------TQA-------------------------------
A0A2E0AW64      ESLMEVARKDRQGAWKTYQQEVISRQKEE-------------------------------
A0A351FZ59      ESLMEVARKDRQGAWKTYQQEVISRQKEE-------------------------------
A0A2E0X6Y6      NLGNRFAG--------GDSGEAGEATLKM-------------------------------
A0A3M1TFJ0      LESQRQQR--------LSEEEGLSQRAQQ-------------------------------
M5T666          DKSAEERK--------VAQKAYAAAQAKE-------------------------------
M5U6N6          ANSAEEQK--------AAQQAYIAAQERE-------------------------------
A0A1C3EBY9      RMPDDMTPGPDGKPLIKERANLVQNYMET-------------------------------
D5SX64          RMPDDMTPGPDGKPLIKERANLVQNYMET-------------------------------
A0A354GX32      QRPGMERQ--------LRAKALDDLVNEA-------------------------------
M5RUI3          SKIEAARV--------EWQRELQKRYADE-------------------------------
A0A2S8FCC0      QLTKDKEQ--------WSVATHRAELNKA-------------------------------
A0A3B8ZJM2      QAAAELNQ--------KRNRSKNKMLNSEVASNDQPIDPPSDTTPGDASATAVTDSPNEV
A0A1U7CLW1      AAAAEFNR--------AEPAAIPDARLEE-------------------------------
A0A142WPR7      GENPMLKG--------GKRPDLVSLYLES-------------------------------
A0A2Z3GZZ5      AGGPVLDE--------LGAHIL--WVEQK-------------------------------
A0A2E6AG00      SVADRAER--------TQAEQLQSFLXGM-------------------------------
A0A1G3A880      RVSERLTQ--------LKDTRLGPMLIQM-------------------------------
A0A2E8ATT1      KVQKHMEK--------VQERELGPLLISM-------------------------------
A0A350KD81      DISADNLESGEFQVAKTKDVDFVNVYLKS-------------------------------
A0A2E3Z6T8      G-AGDRLEAMGKSIPKEVVVNL--------------------------------------
A0A257WQ92      R-LPEERRQQQADGSAPGEVDFVALYAES-------------------------------
A0A356ETW1      R-AAESISRLQNEQLGPLLVEM--------------------------------------
A0A3L7NJY1      L-QQQRMQDMARNELGPRLLQY--------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      -----------------------------------QAELKNRIGELQKLFDRSA------
A0A1G2XSU7      -----------------------------------LEQISLHQQQLRDMLVHED------
A0A2D6SRY7      -----------------------------------FELVGL-------------------
A0A1G3C300      -----------------------------VETD--YNVLLASEESYEKAYNEQS------
A0A0S8H0S8      -----------------------------------LSAAQQKQGEIRAALVDQQ------
A0A1Z8MCI4      -----------------------------AKQQ--IADLELRIKTLNDGINAEK------
A0A177PV03      -----------------------RWHLQSLKRE--LVAAQANLDEIEKQCNAAE------
A0A1G2YIM0      -----------------------------------LERINAYEEKLMAMLSKHN------
A0A177QX42      -----------------------------LDER--INAYENEVAQLNSAFDNIK------
A0A1G2ZG92      -----------------------------IDAHIDKNIAIAKKGLLQKYINAYQ------
A0A1G3A0W0      -------------TIANSGMPDLDEDSAGVERQ--LAQTKHEEQLLAAEIDKQQ------
A0A2E7D3V4      -----------------------------LRQQ--WKALANKNVRLDSLYDDEA------
A0A353BE27      ---------------------------LALEEQ--SEVFRLEEEELANQAERER------
A0A2E0SHG0      -----------------------------LEKD--LEDIKQREEMLKQYRDAAE------
A0A358MY60      -----------------------------VNAKEELAKLKARRALLEVEYDNER------
A0A355GJI7      -----------------------------MEQQ--LKELENRELELTKLFTQES------
M5U569          --------------------------LYASEAE--VELLRQQIKELDSQIATEK------
L7CND7          --------------------------LTASRAE--VQLLQQQISEIDSQIASER------
A0A0J1B8S4      --------------------------LIASRAE--VNLLEQQIGEIDLQIASER------
F2ARR3          --------------------------LTASNAE--VQLLRQQISEIDAQVNAEK------
K5D8H6          --------------------------LTASNAE--VQLLRQQISEIDAQVNAEK------
M2AKU0          --------------------------LTASNAE--VQLLRQQISEIDAQVNAEK------
A0A3L7P7S7      ------------------------DEIFSNKAQGLLKHYSERIEEHETELAKVK------
M5T8W8          --------------------------LFASNAE--VELLQQQIAELDQQIANEK------
M5SF00          --------------------------LTASRAE--VQLLKQQISEIDSQIASER------
A0A2G1WDS1      --------------------------LTASRAE--VQLLKQQISEIDSQIADER------
Q7UVS9          --------------------------LTASRAE--VQLLKQQISEIDSQIAGER------
A0A3C1QS25      ------------------------LYKISLTEQ--VRSIDYELVAFRAQFEEHR------
A0A2A2WFP6      ------------------------AYIRGLSER--LRVANEDLAEVDRKIEAEK------
A0A255QXY0      ------------------------AFICGLQER--LKVTQKEIDDLDLQIEAEK------
A0A1Z8MHR4      ------------------------AYVNGITER--INILDEDMQSIDVQIERER------
A0A2A2WC24      ------------------------AYIRGLEAQ--LTVLAQDMSDIDLQIEQQK------
A0A1G2YRE4      --------------------------TLNLKTE--LEQTKVHEKHLREVLAQED------
A0A255QXF5      -----------------------------LKQG--RERLERQLAVLQKQYDAEA------
A0A1I3GSP0      -----------------------------LQGQ--LKELELDNQNLALLHTDAQ------
A0A2S8F9B8      -----------------------------LRVH--LGVLRQQEKTLAKEVAELE------
A0A368KP63      -----------------------------LRVR--VGVLKQQEETLAAEVAVLE------
A0A3L7P0L2      -----------------------------LKSR--LEELEDEQVRLVEDYKEAE------
A0A3M1VG27      -----------------------------LREQ--DAELTHRRQQLEKLYEEKL------
A0A3L7UX05      -----------------------------AENQ--YQDLIVREQAIRKNMQESK------
A0A142XL75      --------------------------RAETRKQ--IRILEKRFALAKEKHDNIL------
A0A3A0DR44      -----------------------------WRQR--LTALDAEHALLKRRYDEYM------
A0A3E0PW54      -----------------------------QQQE--LMHRQDLEQRLTADLASAE------
A0A2D5GZ77      -----------------------------MEQQ--LKELENRELELTKIFDQET------
A0A3D3R1Z6      -----------------------------MEQQ--LKELENRELELTKIFDQET------
A6BZU4          -----------------------------MEQQ--LKELENRELELTKIFDQET------
A0A1N6KY57      -----------------------------VQHR--CVILEKIEAALQDDVKRLT------
L0DK20          -----------------------------IPHR--ISILSKLEAVLASDVKRLS------
A0A2D6ST10      ------------------------------KKL--IGDLLAWQAELEKKIDEHK------
A0A1Z8MPL5      -----------------------------LEAE--SIEANNYLASLQAEYSKLA------
A0A1Z8MBT6      -----------------------------LQFD--LGRRKRQLEMVKNEYQIEG------
A0A2A2W6A9      -----------------------------EQM-------VKRLAVLQEQYEAEA------
A0A177Q3B7      ---------------------------ASLEER--ASLLQDLETSLVETVERLR------
A0A142XAP8      -----------------------------LAYT--IEVKKGVREKHRLERDGLQ------
A0A2Z3HEL7      -----------------------------LADQ--IAIKEKVRNGLRTERDTAK------
A0A3L7Q373      -----------------------------LESR--VEELQADQIALKSAYDDAE------
A0A353Z859      -----------------------------LQRR--LQLLEITIDGLDKQLVYED------
A0A2E0AW64      --------------------------VARLQEQ--TEQMAIEERVVTEKYQAEI------
A0A351FZ59      --------------------------VARLQEQ--TEQMAIEERVVTEKYQAEI------
A0A2E0X6Y6      -----------------------------LRQA--LAEAQRREQRLTETFASAR------
A0A3M1TFJ0      -----------------------------LREQ--SRQLARRARLYESLKKE--------
M5T666          -----------------------------RDNQ--RKVLVAKLDILKAQHDEER------
M5U6N6          -----------------------------RERQ--RKALLAKLNILQAQHDEER------
A0A1C3EBY9      -----------------------------LRQQ--LKELDIREQQLNVLFELES------
D5SX64          -----------------------------LRQQ--LKELDIREQQLNVLFELES------
A0A354GX32      --------------------AKTKGHIEGDKNQ--LLTLGKKISELESQVANLR------
M5RUI3          ------------------------------KKE--YEALATQLDVLQKQYDDER------
A0A2S8FCC0      ------------------------------RSE--VAILEQMEKQLDESVQLFE------
A0A3B8ZJM2      EKAIASTDSDSSVSPEDEAPDVEEQVNLYLQIS--LNSLTQRYKSLKLEEEEIQRWIDED
A0A1U7CLW1      -----------------------------VKEY--LEILHEQEKSLIDEIASLE------
A0A142WPR7      -----------------------------LQHE--VDVIQTKQKEMNLLFDQEK------
A0A2Z3GZZ5      -----------------------------RRTA--GRQLVQLEAQLSKDEETMKRAGGLL
A0A2E6AG00      -----------------------------VKQE--VDQASAHESQLKIEYVEAR------
A0A1G3A880      -----------------------------LSQA--LANASQREMALRDSFETAR------
A0A2E8ATT1      -----------------------------LEEK--LFEAWTFEKGLLKEYQALE------
A0A350KD81      -----------------------------MEQQ--LKELENRELELTKIFDQET------
A0A2E3Z6T8      -----------------------------LRQS--TQQAIEKEKQIRQAYQQAR------
A0A257WQ92      -----------------------------VRQE--LAELDVRDQHLAQLVEDES------
A0A356ETW1      -----------------------------VRQQ--LREAVEQEQSLRVQFQAAQ------
A0A3L7NJY1      -----------------------------INQQ--LQKNEENELAIFARLESEQ------
A0A356ESF4      -----------------------------------MTELENK--------ERDL------
A0A354PCV3      ----------------------------RINQTLSRNQLETKLTVLRKQYEEEV------
A0A354PHB4      ----------------------------RINQTLSRNQLETKLTVLRKQYEEEV------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      --DQAKDFAQYEEREQTL----------SDELKRIKSLHDIVANRVEVLSLAS-DEGYQL
A0A1G2XSU7      --SKTIELGRKQLAMQDV----------KEQLDNSKDMYSTIQKRIGELEMER----KRL
A0A2D6SRY7      ----------------------------LRKSEVNQDLYTRLLQKYEEARIAEAAEVGTA
A0A1G3C300      --LVVFDLNRKITVYRRL----------QREADSERAFYDILLKRMKESNIAGDLQTSNV
A0A0S8H0S8      --KQAEQMDARLARCALL----------EAAFKRSLRMNELLDSRISEVALASDVGPMFI
A0A1Z8MCI4      --ARLAGEQSKWNAIQFE----------LDNVEVSKDVLISLRRREAALKTEGGYKDVVS
A0A177PV03      --YKARAREEWIKQEARF----------KESALSARQSYEEVGKRLNELQLSKNFGGVTA
A0A1G2YIM0      --VQTIELGRKQLAMQDQ----------KDQFALTEEMYNTIRRRIQELEMER-KRPARI
A0A177QX42      --GDALKMQGEQRTNERL----------NEEHANLKQTYEALVSKLVSLDLAKDAMAMQA
A0A1G2ZG92      --EELLNIPLKDSENSKL----------ELTLTINKDMYQNLLEYLMTVSIAESMTLSNI
A0A1G3A0W0      --VEFDTLFATAQSLEKA----------NNDLNHKRDLFEAVRQRMDQKTMER-DIPPSI
A0A2E7D3V4      --KKAKEFSKFEAEDQKF----------VEEIARIKSLQAVIVKRLAEMGLVAKNYGYKL
A0A353BE27      --RSSRELQGMLDGYRIL----------QTDRDAVSELLTAYTEKLQEIDLMPKMGQRTL
A0A2E0SHG0      --SQAKLVANFKLNQELL----------SDERELKKELRSVSIQRLNDIALLEDYDLLQV
A0A358MY60      --ARLQQKGGNAVELLFA----------KEDREIASQLLGMMQQRLAAIKIER-RRGSGL
A0A355GJI7      --ELAKKVGNFQVIDQSY----------NEEIAQLKSQRDNIFKQLLVERVSQGNSGYML
M5U569          --SEAVKLARYEQENNAI----------LREIERNRELINQLEEQMARVELTEEEGGVQV
L7CND7          --IEATKLAQDEQENASM----------LRQIDRNRELINQLDEQMARVELTEEEGGLQV
A0A0J1B8S4      --KEAIKLAQFEQENTAL----------LREIDRNRELINHLEEQMARVELVEEEGGIRV
F2ARR3          --SEAVKLAKFEQDNTAL----------LREIDRNRELINQLEEQMARVELTEEEGGLRL
K5D8H6          --SEAVKLAKFEQDNTAL----------LREIDRNRELINQLEEQMARVELTEEEGGLRL
M2AKU0          --SEAVKLAKFEQDNTAL----------LREIDRNRELINQLEEQMARVELTEEEGGLRL
A0A3L7P7S7      --DESQSLQEELDKHKALENRKLEMSRRLEQLTRDSETIEFNKQQYA---MTKDHGGYDA
M5T8W8          --SEAVQLAKYEQENNAI----------LREIDRNRELIDQLEEQMARVELTEEEGGVRV
M5SF00          --IEAMKLAQDEQENASM----------LRQIDRNRELINQLDEQMARVELTEEEGGIQV
A0A2G1WDS1      --IEAMKLAQDEQENASM----------LRQIDRNRELINQLDEQMARVELTEEEGGIQV
Q7UVS9          --IEAMKLAQDEQENASM----------LRQIDRNRELINQLDEQMARVELTEEEGGVQV
A0A3C1QS25      --ARAMELNQVDLSLKNL----------LDQKKYQESVITSVVDRLQQVDVTGDKEGFNY
A0A2A2WFP6      --LAADELKKFEDTDASF----------RRRIASLQGMLIQLEQQLAALELIDINGGILV
A0A255QXY0      --RAADELKHFEEDESSY----------KRRIASVQGMLIQLEEQLAGLKLIDMDGGIIV
A0A1Z8MHR4      --QLADELKKAEENDASF----------NRRLETIHALRFQLEQQLAALNLAHVNDGIMV
A0A2A2WC24      --DEADKLKIVEERDASF----------NRRIETMRGLETQLEQQLAALNLADVKGGILV
A0A1G2YRE4      --TQVIEIGRRQLNIEDL----------QFQQNLDQETYDTVRRRIRDLELER-KRPARV
A0A255QXF5      --DRLRKRDNNNVALEFA----------KTDLQQSRAMLQKVTERLDSIQLES-QRGSSV
A0A1I3GSP0      --KKAKQAEMFEVEDQRR----------KDEIAQKKQQLERMFDQIAEYDITRGQEGYRL
A0A2S8F9B8      --NEVRTFGRSSVEVEMM----------RSEIESLDEIVQQLNAEIERTKIEL-RQAPRI
A0A368KP63      --KEVRTYGRSSVEVEMM----------RSEIEGLDSIVQQLSAEIERTKIEL-RGTPRI
A0A3L7P0L2      --KTAKEASSYEVIDQRY----------KDDIARKKKELDAILTQITHFDLNKDQEGYTL
A0A3M1VG27      --RVAKQFAHILEQDQAY----------RDQIQSIKSTLDVVISRMQEIELIKDNRGYAL
A0A3L7UX05      --LTLENDESKELQLAFR----------RTDLARAESTLDSVQRALEQLQFES-QGQTQI
A0A142XL75      --RKISQTNDYKIELSTI----------QFSIGQTEKLNQSLGETIERLKVEL-GAPSRV
A0A3A0DR44      --KSLSESGGDAVRLQFK----------YADLERESSVFNLIAQRKLQVETET-HNPAKV
A0A3E0PW54      --SEAKAAGLFEVEDQKR----------KDEIARHKKQWQDVIVELESFGVRKEQEGYRV
A0A2D5GZ77      --ELAKKVGDFQVVDQSY----------NEEIAQLKSQRDNIFKQLLVEKVSQGNSGYTL
A0A3D3R1Z6      --ELAKKVGDFQVVDQSY----------NEEIAQLKSQRDNIFKQLLVEKVSQGNSGYTL
A6BZU4          --ELAKKVGDFQVVDQSY----------NEEIAQLKSQRDNIFKQLLVEKVSQGNSGYTL
A0A1N6KY57      --ERSRSIGQNSVDLFSI----------QEEIANADEIARLIGKEVEALTVEL-QAPPRI
L0DK20          --ERSLSITQNSVDLFSV----------QEEIANADEIARTIGKEVEALTVEL-QAPARI
A0A2D6ST10      --TTLTKNNIFNAELNRL----------DQDIAQDGALIDAIATQIEQIEVEIENSPKRI
A0A1Z8MPL5      --LQVQEIGEYSADLERR----------QDELVHLTQVTNELGYELEKLDLELRANQSRV
A0A1Z8MBT6      --DKRSKRVNDSWDVDKH----------VNHLAMLRERYAAAEQRLDAIKTES-ENMSRV
A0A2A2W6A9      --DLLRQRDGNSVALQFA----------QDDLARSRTMLHRIMDRLESIQMES-KRGSSV
A0A177Q3B7      --KQTQAATVGQSDIESF----------RTEIAQSEKIADRIGSEVERLKLEV-DAPQRV
A0A142XAP8      --RVIATTAAGGLSIDED----------RKNLQPQREMHDKIQSQLIQLQVAA-LQSGRV
A0A2Z3HEL7      --KTIESTAGGGASIDAL----------RKNLEPQRALLSRLDEQLLQLSTGE-GRT-RA
A0A3L7Q373      --KTARMASTYEVTDQQY----------KDDIARMKKDLDLALKQLSDLDQNKAQEGYKM
A0A353Z859      --ESRNNKLAWQMELDEL----------NKSIEQFRTIYNRLQEEGERARMTM-SNLMRV
A0A2E0AW64      --EEIQNAKGRTFDMVQL----------QTSLERAEEQALAFQDREDRLRLES-KNLDSI
A0A351FZ59      --EEIQNAKGRTFDMVQL----------QTSLERAEEQALAFQDREDRLRLES-KNLDSI
A0A2E0X6Y6      --QAAAEHSGHIVEIERL----------EGQVEWTKTQREAILAQLQQVESLAGQAPIKA
A0A3M1TFJ0      ----------VEANERFY----------EEFIQQQKDISAYSRVNVAEVRIVD-PALAAV
M5T666          --ERMEQFGGTTAELQFA----------NDELVVASDVLTKLRGRVAAIRTER-RQDGAV
M5U6N6          --ERLEQYGGTTAELQFA----------NDELTVASDVLTKLRGRVAAIRTER-RQDGAV
A0A1C3EBY9      --NKAKEYARFQAEDQAM----------TAELNRLRGLWGQLVDRMSQLTIDKESSGYTL
D5SX64          --NKAKEYARFQAEDQAM----------TAELNRLRSLWGQLVDRMSQLTIDKESSGYTL
A0A354GX32      --AGGQTAGKSNGDVDGL----------QAEVNALDAEVKKSGEELASLDSSL-PVTPRL
M5RUI3          --SRLEQFGGASADLQLA----------IDEKQIAMDVLGKLKIRAAAIRTEKQQGG-SV
A0A2S8FCC0      --KEAKQFGRSSIDVEMM----------RTEIDSLEGILSRLGHEIENTKIEL-KSDSRV
A0A3B8ZJM2      T-AKSQIVQGFLLTHESI----------KNQAEKLDKIQEVLSDKLKGVELFQNSSNRKI
A0A1U7CLW1      --SQMSSLNVKSMDFHWL----------EDEIAVASDTAKMVGAEVQSMTVEM-QAPPRI
A0A142WPR7      --EAAKSLVAYEVRDESL----------RNEIARTSKLFEGVVKRLDEISLVKGYGGYEM
A0A2Z3GZZ5      DLAEAMAVQSQHADAEIM----------RLEAERLAR------------QATLGAGGYSA
A0A2E6AG00      --DSAVQXHXQIEELAIA----------EREVERLRSLHHTLQDRIANIDXNQNQADVRV
A0A1G3A880      --AEAVRLNGDLAQLEIL----------EHDVEQLRSFHDVLVNQIANTDLRQEHGDIRA
A0A2E8ATT1      --ESALTLNDDMAELTIT----------ERDVERLSRLHDTLLERISNIDMTQHRANVRV
A0A350KD81      --ELAKKVGDFQVVDQSY----------NEEIAQLKSQRDNIFKQLLVEKVSQGNSGYTL
A0A2E3Z6T8      --AEAAAYSGSLVQFRAL----------ERAVARDEAKSDILTDKIANIDFRQNQAPIRA
A0A257WQ92      --VKARGVAKFQAKDEAM----------HAELARLRDLWGQLVTQVNQVSIERDGNGYVM
A0A356ETW1      --ADASRRTGQIARLTML----------QREVKRLYDLSDALVSQIASLDLRQDGHDVRA
A0A3L7NJY1      --VKAQNLTQILTRLADV----------DREIERLYTQQSDYQNHADGISLNKDTF-IRT
A0A356ESF4      --KRLQTWN--------------------------EQLLNKLTD-----LNIRRDGQEVR
A0A354PCV3      --ARLEQFGGMTAELQFA----------QAELEVANDVLKKLRDRVAAIRTERRQDGAVR
A0A354PHB4      --ARLEQFGGMTAELQFA----------QEELEVANDVLKKLRDRVAAIRTERRQDGAVR
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      -----------------------------------------------------------M
A0A3M1SE88      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      TQISP---SRAEPDIKHVIKIVGGCLV---MTLMSTYAFLFLR-------EMRDTSLKS-
A0A1G2XSU7      ARISVAYLANTAPYQDRRMQYSLAITM---GSLVFGLGLALIT-------NKLDLRLKT-
A0A2D6SRY7      QLVDPAL-PPGGPFRPNTSVNVFLGAL---LGLVLGIAQAFLL-------EHIDNSVHS-
A0A1G3C300      SILDPAM-EPRTPIGASRNSQIMKGVM---IGLALGIGLAFFL-------DYLDNTVKS-
A0A0S8H0S8      RVLEEAS-SGDEPTRPNRPHAAAMALG---LGLILGVMLALLA-------ARLDHRIHS-
A0A1Z8MCI4      SLASAS--LPETPLENSNTKRQLLAYP---LVFAALFGLGLTV-------EVFSQRFXR-
A0A177PV03      DVIEPA--TPALKVAPVPAKIFIVAMM---LGLLLGAGLAFVA-------EAMDQNFHT-
A0A1G2YIM0      SIAFN---ADSMLAKDKRPKYVVANIF---GSGFLAILIALVF-------DKLDRRVHT-
A0A177QX42      EITSEP--SPGVQIGPSMVQSLGFGGI---GGLLAAIAIALLL-------ETADKSFRN-
A0A1G2ZG92      RLIEAAI-EPYKPHFPRRYLNFAIALF---LSVFWGLVLSLFV-------EYIDNTIKT-
A0A1G3A0W0      EVLSKAF-VPSQPHSDRRMVFMAMALI---LGVGAGGGMGLLR-------ANRRQTVYV-
A0A2E7D3V4      KQISP---VRDQLVFKRKLKFWFMGLA---MAMSAVGAVIYWR-------EWRDTTLKT-
A0A353BE27      KRLDMP--NTGLFYGPKVIKYLVGGAA---VGFILLSGLAVLM-------DLADRSYKN-
A0A2E0SHG0      HSMGNL--NEVRSAKTSLLLGILPGAF---FGFIFGGLMAAVI-------DLADSTFRS-
A0A358MY60      HTVDAAK-PPTRPVVPLPFKNMILAGL---LGLAAPFSLGLLL-------ELRAKRVSD-
A0A355GJI7      TQLAP---VKDELVIKRQLKFLMAGAA---GGLGLILAFSYFR-------EMRDTTMKS-
M5U569          TEL-SAP-SNAYRVGPNMAKMLSFGTF---IGLAAGCGLALLL-------EKNANTFRD-
L7CND7          SEL-RAP-SRAYRTGPNLVKMLGIGTF---LGLALGCGLALLL-------EKNANTFRD-
A0A0J1B8S4      TEL-VAP-STAYVIGPSIIKTLGIGTI---AGLIIGCGLALLL-------EKNANTFRD-
F2ARR3          TEL-RAP-TRAYRVGPNMLLMLGIGLG---VGLLLGCGLALLL-------EKNANTFRD-
K5D8H6          TEL-RAP-TRAYRVGPNMLLMLGIGLG---AGLLLGCGLALLL-------EKNANTFRD-
M2AKU0          TEL-RAP-TRAYRVGPNMLLMLGIGLG---AGLLLGCGLALLL-------EKNANTFRD-
A0A3L7P7S7      QELGRIP-ELGGEVPSRKSLIVVAGGI---FGVAIGGGLAWLM-------ERADRTFRS-
M5T8W8          SEL-SAP-SSAYRVGPSMAKMLGIGTF---LGIALGCGLALLL-------EKNANTFRD-
M5SF00          SEL-RAP-SRAYRTGPNLVKMLGIGTF---LGLALGCGLALLL-------EKNANTFRD-
A0A2G1WDS1      SEL-RAP-SRAYRTGPNLVKMLGIGTF---LGLALGCGLAVLL-------EKNANTFRD-
Q7UVS9          SEL-RAP-SRAYRIGPNLMKMLGIGTF---LGLALGCGLAVLL-------EKNANTFRD-
A0A3C1QS25      EIL-EPP-TFAEQTEPSLLKVFAVAGF---LGLLGGVGIAYLV-------DLADKTFRS-
A0A2A2WFP6      EPL-LAT-GKAHRTGPDLKKDLAVFTM---LGLGLSGLLALLF-------EAGAKTFRS-
A0A255QXY0      DQL-WGS-GGAARIGPDQKKDLLAGGM---IGFILGGILSILI-------EFWSMTFRS-
A0A1Z8MHR4      KQI-QET-SPAIRVGPELTRYLLIYGL---FGLGISGLLAMTF-------EASAKMFRS-
A0A2A2WC24      EPL-LDT-GQAYETGPDLKKDLVLFGM---LGLGLSGLLAMIF-------ESTAKMFRS-
A0A1G2YRE4      SVAYN---ADISGIQDKRAKYSAALLF---GALFCGMGLAFLK-------DKTDQRLRT-
A0A255QXF5      ISVAKAT-PPTRPVEDMPFKKMLAAGG---AGFFVPFLLGLLW-------EFRVKRITD-
A0A1I3GSP0      QQISQ---VRIERSMKRVIKLVGTCGV---MGIAIIFCLAYFR-------EWYDTSLKT-
A0A2S8F9B8      TLLSEAK-LGVVSDKKRPLMITAAAAF---AGFMLPAGLLLLR-------DFSKKHLSD-
A0A368KP63      TLLSKAE-PGTVTDKKRPIMITAAAAL---AGLVLPGGLLVLR-------DFQKKRLSD-
A0A3L7P0L2      SRTND---VRVDRSMKRVMKIVGACGI---LGLLSVFCLAYFR-------EWYDTTLKT-
A0A3M1VG27      RTVAE---PKAEVSIKRPLKFLGAGLF---GSLVAVTAMIYLR-------EVRSRSLRS-
A0A3L7UX05      SLIQTAR-PIGLPSNDKRWRFMAMAPL---GMFLAVASLCVLV-------EVRSGRVSN-
A0A142XL75      TCSEEPF-IVTGIEGNRRLKYTVLAAL---AVFGIGFAGTIGL-------ETRARRVTD-
A0A3A0DR44      IVRSDAQ-IPPAPIEAWPYKPLILFCG---AAFVLPFFVVVGW-------EKLSRRIAD-
A0A3E0PW54      NQIAQ---VRVEKSIKRIIKIVGAMGC---LGVAVVFGLSYLK-------EWTDMTLRT-
A0A2D5GZ77      TQLAP---VKDELVIKRQLKFLMAGAG---AGLGLILAFSYFR-------EMRDTTMKS-
A0A3D3R1Z6      TQLAP---VKDELVIKRQLKFLMAGAG---AGLGLILAFSYFR-------EMRDTTMKS-
A6BZU4          TQLAP---VKDELVIKRQLKFLMAGAG---AGLGLILAFSYFR-------EMRDTTMKS-
A0A1N6KY57      RLLEKAE-LPRTKDETRKFKLAGVAGC---GAFALALLGISFW-------ESSARRVDS-
L0DK20          RLLEKAE-LPRTKDEARQLKMAGVAGC---GAFALALIGVSFW-------EFQSRRIDS-
A0A2D6ST10      MEFRKAD-APQRRDQKKKITGAAAAGF---GVFGLFVAAIVFL-------EYRSHRISR-
A0A1Z8MPL5      RRVDGGVRKPKTGDTSKRDQLTLVASF---GALLLGIGAPTLL-------DVIRRKVSS-
A0A1Z8MBT6      QPIAAAT-PPTKPNEEVPTKKLAMVAL---AGFCVPFGLGLLW-------ELHTKRITD-
A0A2A2W6A9      LSISEAV-PPSRPVEAVPVKKMLMAGG---GAFAIPFLIGLFW-------EFMTKRITD-
A0A177Q3B7      HLIEEPV-VMESASTRFRAKALLGAAF---GALLLAIGLMTWR-------EYSFRRVEL-
A0A142XAP8      SARGGAE-KIPNNNQNKKIVLSSAGGA---VSFFGVILLVSFL-------EWRSRRVDG-
A0A2Z3HEL7      SARGEAE-KIPNNNQNKKLAMSSVGGL---GAFLTVVLLISFL-------EWRTRRVDG-
A0A3L7Q373      SRTND---VRVDRSLKQTIKIVGAFGV---MGLLAVFGMAYFR-------EWYDTTLKS-
A0A353Z859      EKFRDAV-TPTQPDMAKKIMATTAVGG---GLFGLIFLGILFL-------DLRTRRINS-
A0A2E0AW64      TLLKSAS-PPVKPAVIAPWKNMLMGGG---IALLIPFGLAVLW-------ELRVGRITD-
A0A351FZ59      TLLKSAS-PPVKPAVIAPWKNMLMGGG---IALLIPFGLAVLW-------ELRVGRITD-
A0A2E0X6Y6      SVVREPL-PDPRPVSPRLKMVVVGALA---GGLFLGSLIIYVQ-------DVLDDRFGS-
A0A3M1TFJ0      RVGPNHV-R---------------NVL---VGALLGLFAGVLA-------ALGLDRFSDR
M5T666          RTLASAT-PPKSPVEAMPYKKLGMASA---VAFMVPFLFGLLW-------ELKVQRLTD-
M5U6N6          RTLASAT-PPKSPVEKMPYKKLLMASA---IAFAVPFFLGLLW-------EYKIQRLTD-
A0A1C3EBY9      RQTGP---IKDEWVLKRLLKIVGAGMV---AGMGLIISLIVLK-------EFLSNQVRT-
D5SX64          RQTGP---IKDEWVLKRLLKIVGAGMV---AGMGLIISLIALK-------EFLSNQVRT-
A0A354GX32      TVTEAAA-PPMSPASDKRIKAAGGAFL---GLFGLVFLGVVAT-------EFRTRRVYK-
M5RUI3          QTLAAAT-PPRIPLESVPTKKLIAVSG---GAFCIPFLLGLLW-------ELRVQRVTD-
A0A2S8FCC0      SVLQEA--QPPKSKNPRSYAMVGVAGV---FGFMLPVAGFVFW-------DLRSQRINV-
A0A3B8ZJM2      LQELIPS-MPGAYYGPFSSTYTAAGAL---AGILLMSFVALLM-------DMADRSYRS-
A0A1U7CLW1      RLIEKAS-VPTMNDPLRRCKLSTIVGA---GVFLAFVGCVSLW-------EFQSRKIDV-
A0A142WPR7      SVLSPP--TEGFLTGPVMARYLALGAV---AGIAVGYLLAYLL-------ELNDRSFRD-
A0A2Z3GZZ5      EQITRP--GSGHKVAPVLLRSLLLGLG---IGALLGCGLMVLA-------ETRDKSFRS-
A0A2E6AG00      EVVSDPK-GRQTPVSPRLANVFVXSLL---GGTLIGIGLVYVI-------DALDDHVRS-
A0A1G3A880      TVVKEPM-ASQQPVSPRLMTVALLVLV---IGLLGGGISVYVL-------DILDDRFRS-
A0A2E8ATT1      SVVSEPA-ASRMPVSPRLAFVGVLCLT---FGLGGGTGLIYVL-------DLLDDRFRS-
A0A350KD81      TQLA--------PVKDELVIKRQLKFLMAGAGAGLGLILAFSY-----FREMRDTTMKS-
A0A2E3Z6T8      TVVREPI-ANNNPVTPQIRLIAAVCLL---GGTCVGVVMAYAQ-------DVLADRFNS-
A0A257WQ92      KQIA--------PVKEELSMKRILKFV---GG--GGVAGMFLIAGICLLRELRDLRIMS-
A0A356ETW1      KVTAPPV-ANHRPVSPRLAFVALVAIV---SGLGIGFAAVYVL-------DVLDDRFRD-
A0A3L7NJY1      KIASKPT-VPTRPVSPRLAIVGILSLM---VGTAGGLLIIWVL-------DILDDRFRT-
A0A356ESF4      IEVVQEPQVASAPAIPDRRRVALLALA---AGLALGLLAVHVL-------DTLDDRFRG-
A0A354PCV3      LLASATPPRTPVAEFPLKK----MAMA---GGAAMAVPFFFAL--------LWELRVRR-
A0A354PHB4      LLTSATPPKTPVAELPLKK----MGLV---GGAAMAVPFFLGL--------LWELRVRR-
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ANVWDAIKKHQAEQEQQRAAADQVSAE---TEAAPREAWRVTP-------AADAAPAPA-
A0A3M1SE88      -------------------------------------------------------RFRS-
A0A3M1R9K7      VEIVQEAQQPRVADQDRQIQLTVLAGL---GGFACPVALILWW-------DTRGKRINT-
A0A3L7PH51      --------------------------------MALGLGLIYVL-------DALDDRFRS-
A0A3N5UQY5      -----------------------MALL---CGLVLGGGIAAAR-------DWIDQTIRS-
                                                                            

A0A356AE44      -LADLRAIVDT-PILGTLPSIANPAKNLQ-----AARETGLAPMLYYYHDPGSPEAEACR
A0A1G2XSU7      -PDDITKRIGV-RIIGTTTSRD----------------------KIKKAMWPRQLADDYH
A0A2D6SRY7      -VRELEKAMGL-PTFGLIPQIPEKPGSGPSLAERGRRKRVRPDRLISSMELGSIAMEAYR
A0A1G3C300      -TEDVENYLGV-TLLGLVERAK-----------QSKENKDANLELLTSEAPKSVFSETIR
A0A0S8H0S8      -AADVPAVLGL-PLLGAVPTIR-------------RRRSLQSGAQTVLMDPASPAAEAYR
A0A1Z8MCI4      -ARNVTEITQL-SLLGELAKFP-----------------RWGSKSGRQFYERSVMALALR
A0A177PV03      -LEEIRERLGL-AVVGHIPIVE----PVGH--VPGTPATAMESILCTYYQPKSVQAEAFR
A0A1G2YIM0      -TEDITRRLGL-RIIGTTVSSE----------------------NIDKALLPAKLADDYQ
A0A177QX42      -PDEISRQLRL-PVIGHIPELA----ADRD--WKMVKDAQVDSSISVHHRPKSRLAESYR
A0A1G2ZG92      -PEDIKHIKSL-NFLGIIPNTK----------------LLKDMSIISKLNPTLPVVEAYR
A0A1G3A0W0      -PDDMPYAMQV-PFLGYVPVLP----------VRRFPQKPFGKSLCEQKYAQDRMAESIR
A0A2E7D3V4      -FDDVRQSMQF-PVLGGVPEFA--AISLMD--QMLYEQSPLQPSLCYFHRPGSSEAEAYR
A0A353BE27      -PSEISTDLGV-SVLGHIPVMN------LS--KVKKSVEAVDPAVCAIHHSKGRVAEAYR
A0A2E0SHG0      -PEQIRETLRS-PVLAHIPRLNVRRITKL-----ADRGSRLSPVLVTHHIPQSPEAEIFR
A0A358MY60      -AETLTAGNL--APFGEVAKLPSKVGQGK---------------------RQRVFEESID
A0A355GJI7      -VDEIRNQLHL-PILGEVPCFA------DS--DAAVDESEFAPALWYYYRPASREAEAFR
M5U569          -PDEIAEAVGA-PILTHVPFFKGRVRKAKP--DNPNPFEKLDPYLAVVHQPASVPAESIR
L7CND7          -PEEIIAAVGA-PILTHVPFFKGRVKRKKG--EASNPFELLDPHLAVVHAPSSVASESIR
A0A0J1B8S4      -PEEIVAAVGA-PILTHVPFFKGRVRRAKG--ETSNPFEQLDAHLAVVHAPSSVASEAIR
F2ARR3          -PEEIVTAVGA-PILTHVPFFKGRVRHKKG--DKSNPFEHLDPHLAVVHAPSSVASESIR
K5D8H6          -PEEIVTAVGA-PILTHVPFFKGRVRHKKG--DKSNPFEHLDPHLAVVHAPSSVASESIR
M2AKU0          -PEEIVTAVGA-PILTHVPFFKGRVRHKKG--DKSNPFEHLDPHLAVVHAPSSVASESIR
A0A3L7P7S7      -PDDIRKRLGI-PVLGHLPLFP-----PMD--EEEKALCKVDPTLICFHNPKSQEAEFFR
M5T8W8          -PDEIAEAIGV-PILTHIPFFKGRVRKSKP--DHPNPFEKLDPYLAVVHQPASVPAEAIR
M5SF00          -PEEIIAAVGA-PILTHVPFFKGRVKRKKG--EASNPFELLDPHLAVVHAPSSVASESIR
A0A2G1WDS1      -PEEIIAAVGA-PILTHVPFFKGRVKRKKG--EASNPFELLDPHLAVVHAPSSVASESIR
Q7UVS9          -PEEIIAAVGA-PILTHVPFFKGRVKRKKG--EASNPFELLDPHLAVVHAPSSVASESIR
A0A3C1QS25      -PDDIAQSLAL-PILGHIPFIPKSKQKQT-------EGITFDGTAISVHQPKSKISEAYR
A0A2A2WFP6      -AEAIQQELQA-PVLTHIPFDGGRRQNRKQ--MPTNSIARLDPKLAVIHRPHSPAAEAVR
A0A255QXY0      -ADEVQRALRA-PVLTHIPVDSSRVKAHDS--MDGENGSSLCDKISVVHRPHSPAAEAVR
A0A1Z8MHR4      -AEEVHSDLRL-PVLSHIPLDDSMVQSAK---VGDPHVDQLDPKLAVVHRPYSAAAEAVR
A0A2A2WC24      -AEEVQRELRL-PVLTHIPLDEGRIQQGKG--LVDSEIAKLDPKLSVVHRPYSPAAEAVR
A0A1G2YRE4      -PDDITKRIHI-PVIGTTTSLH----------------------NIKPALIPDQIAGEYQ
A0A255QXF5      -SHELERSQMLAPVIGELARAP-------------------SATGSRNSKGRRVFEESVD
A0A1I3GSP0      -LDDVTTFTHE-PLMGSVPTFSSSTDLDR-----IAQQRGLSPALCYYHRPGSREAEAYR
A0A2S8F9B8      -LPTTRDELGL-EILGTIPKLP------------RGIVRKPKSLSVDLGSFEDQVRDSSD
A0A368KP63      -LPTTRDELGL-EILGTIPRLP------------RGITRKPKALAVNLGPFEDRVRDSSD
A0A3L7P0L2      -VEETRTVIGA-AVMGAIPHFRGGAVSDR-----LAVQNGLSPALVYFHRPGSREAEAYR
A0A3M1VG27      -LEELRNALAV-PVLGGIPEFT----ATE-----HGPPTARKCAQWYRLYPRSGEAEAFR
A0A3L7UX05      -PDDLTNRSRL-EVLGVVPPLP----NPR-----SARKLMGGIDETRLRRQLVEYIQSID
A0A142XL75      -TDDVTKALGV-RLLGTVPAAG--------------------QESGKPGAPPPSLVEAID
A0A3A0DR44      -ADQLSSESTL-SIIGEIAQLP------T-----RPVLSGGAASRRKIRRDLGLFQESVD
A0A3E0PW54      -ADELKALVPV-SVLGEVPEYS--PSAAA-----ARSASALDPRLCYYHRPGSREAEAYR
A0A2D5GZ77      -VDEIRNQLHL-PILGEVPSFA---ESDA-----VVDDSEFAPALWYYYRPASREAESFR
A0A3D3R1Z6      -VDEIRNQLHL-PILGEVPSFA---ESDA-----VVDDSEFAPALWYYYRPASREAESFR
A6BZU4          -VDEIRNQLHL-PILGEVPSFA---ESDA-----VVDDSEFAPALWYYYRPASREAESFR
A0A1N6KY57      -ASDVVQCLGM-DLFGTLPILP-------------RRRLMLGSGAAQHRRWGSMLIESVD
L0DK20          -AADVIKSLGM-NLFGTLPAIP-------------KRSRGMKLREAESVRWRSMLVESVD
A0A2D6ST10      -LEEVVDGLGM-RIVGNIPTMP------R-----ASSRRPTGDNRGKTAFWNSVLSESID
A0A1Z8MPL5      -VNQMSEGLGI-RVLGNLPLLD-----KP-----KRRLGFRAPTPEAIEDLQVTMEESID
A0A1Z8MBT6      -SHHIE-ALAVPPVIGELARAP-------------------RASGARQSRGRRVFXESVD
A0A2A2W6A9      -SKDLERSLALAPVIGELARAP-------------------RGSTGRNSKSRRIFEESVD
A0A177Q3B7      -AEEITQHL---PVVACLPRLE--------------ASATLAAGANGTHARDLVFVEHVD
A0A142XAP8      -VDQVVNELGM-RVIGTVPAFP-------------NRASLQAATEAGGANWRFVLNESIN
A0A2Z3HEL7      -VDQVVTELGM-RVIGTVPVFP-------------NRASLQAAVEAGGANWRFVLNESIN
A0A3L7Q373      -IEEVRSIVKA-PLMGAIPRFRLSGALKR-----GTTSNGLSPSLVYYHRPGSREAEAFR
A0A353Z859      -LDDIVTGLRL-PVIGSVPLIP-SSRGGK-----NSEG-------GGGQRWQGALIESID
A0A2E0AW64      -SKQIEKQSQL-PVLAEIARFP-SHADGQ-----RHS--------RRVTRQLRLFEESVH
A0A351FZ59      -SKQIEKQSQL-PVLAEIARFP-SHADGQ-----RHS--------RRVTRQLRLFEESVH
A0A2E0X6Y6      -PEEMAAQLGV-GVLTVVGNLK-TLVGEG-----FDL-------VHAYVSPNKPETEAFR
A0A3M1TFJ0      VRSLAEAQRLGPPVLGAVPELS-DVSGRE-----LDRY--------ALSNPSSAYAEAFR
M5T666          -AETHDKTGQLAPVLGEVARLP-AGAGAV-----KGR---------------RVFEESID
M5U6N6          -AETHDKNHDLAPVLGEIARLP-AGHGAA-----KGR---------------RVFEESID
A0A1C3EBY9      -VREVRQLLPE-AYLGAVTSFD-PE-QSR-----LDPVQNVHPSLRYLRSPASIEAENYR
D5SX64          -VREVRQLLPE-AYLGAVTSFD-PE-QSR-----LDPVQNVHPSLRYLRSPASIEAENYR
A0A354GX32      -SEDVSQGLGL-PLMGTVPALS-AKVRAT-----A---------PVAGDQSMGPMIESMD
M5RUI3          -SAAVDRSQSLAPVVGEIAQLP-SG--------------------ARNGRGRRIFEESVD
A0A2S8FCC0      -PSDVSDNLRM-NVLGAIPLVP-QRVLAQ-----SRKN------SKKQQYWKSLIAESIG
A0A3B8ZJM2      -PDEIVSDLGK-PVLGHIPAMD-LP--NI-----KKVVDTVDPSLITIHHSRGRIAEAFR
A0A1U7CLW1      -PDEVAFRLGL-RIIGDLPKLN-GPRRGD-----QKQI------------ERDRLVQSID
A0A142WPR7      -PEEVQTSLGL-PVVGHIPVIE-LA-RAD-----RRSNDAVHPSLVTFHRPKSRLAEAYR
A0A2Z3GZZ5      -PAEIRRRLGL-AVVGHIPRIR-TV-PAL-----SLEPATYDPLLVAALRPKSSEAEAYR
A0A2E6AG00      -PDELKDQLGL-PILAMIRXLP-STLATT-----GVNA------LHVATTPDSVESEAFR
A0A1G3A880      -ADELRLRLGV-PVLAMVRQLP-NA-GVP-----GWAG------VQANAAPDAVESEAFR
A0A2E8ATT1      -PEELQEQLEL-PVLAMIGNLE-VG-NEL-----GLGA------LQVHASPDAVESEAFR
A0A350KD81      -VDEIRNQLHL-PILGEVPSF--------AESDAVVDDSEFAPALWYYYRPASREAESFR
A0A2E3Z6T8      -PEELTLQLGV-PVLAMVKKL-------------DALNGENLETIHTHACPNAPETEAFR
A0A257WQ92      -VGELRRATNY-SLLGTISRFT-------SVIDPHVIRGGMHSALRYLLAPRSMEAESYR
A0A356ETW1      -IDDMQQQLGV-PVLSLIRRL-------------DVPETSGLEAIQLHVAPASTESEAFR
A0A3L7NJY1      -PEELKLQLST-QILSMIPRL-------------EQLPGAGFEAVLSHLKPHSKDVEAFR
A0A356ESF4      -IDDLQNQLRT-TVLAVLPKLRVANGAGI---------------------DSLQVHVAPD
A0A354PCV3      -VTDSSMSGGL-SLVGEVARMPAGTRGTK---------------------DRRIFQESVD
A0A354PHB4      -VTDSSMCGGL-SLVGEVARMPAGTRSTK---------------------ERRIFQESVD
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      -------MSEP-ETNPALTDG------VL-----VIVERTVNPYLVCFHEPNGFRSEQIR
A0A2G6JGH3      -------MSEE-PQEERANDEERGDATPF-----VLVDRVVDPYLVCFHEPRGFRAEQFR
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------STHQL-TYDLGIHVVGSLPLVHK-----RRLLPNPVYNGSVPDDIRAVLHESVD
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------MADAAGNAVEL------------DSGLATVHSAMSPEAEAYR
A0A1V6CUG1      -PAPASQDAKA-PALQAPPIIQSVGAAKV-----IGHNGSFSEVLVTHHDRGGRITEEYR
A0A3M1SE88      -IEEMQLQLRT-PVMAVIRRMKPREFLGP------------KSL-QVVAEPDSPESEGFR
A0A3M1R9K7      -PAEVVRTTGL-DLLGTVPLVPAKAAKQL------------HSEGKRYHHWRAIFTESVR
A0A3L7PH51      -PDELQWQLGL-PMLAMIRKMEPMEGTGM------------ELI-VTHMQPNSVESESFR
A0A3N5UQY5      -TEEISTIFRL-PVLGGGPAMSRRKSVPV------------RGR-KVLLEPSSREAEAFR
                                                                            

A0A356AE44      SVRATFF------VR--AADVDAHIIQFTSSEPGDGKTTTISNLGISIAQAGKRV-LLID
A0A1G2XSU7      SICINLG------LM--NNCTIPNKLVISSASPREGKSTLAVNLATNLAKIGKKV-LLID
A0A2D6SRY7      CLRTNIQ------FA--APDTKTPCYLVTSAGPGEGKSLTTSNLAIAIAQLGRRV-VLVD
A0A1G3C300      NIRTGIM------LS--TTDTPHKSLLITSTKQGEGKSFIAANLAIAFAQTGKKT-LLVD
A0A0S8H0S8      DIRTAVC------FG--VREGQVKTLLVTSAQAGDGKTTLVSNLGIAMAQAAQRT-LILD
A0A1Z8MCI4      LGCLKVL------SA-------GKVVGVVSGVSGEGKSTVTFGLACMLGHSKHLKVLVID
A0A177PV03      GIRTALY------FS--LRSGDYKVIQITSPEARDGKTTLSANLAVSIAQSGKKV-VLLD
A0A1G2YIM0      AIRANLG------LF--NEEKIPHILAITSARPQEGKTTFAINLASSMAKAGARV-LLVD
A0A177QX42      AVRAAIF------FG--TRGQTHRVLQITSANSGDGKTTLCSNLASAIAMSGKKV-LLVD
A0A1G2ZG92      TIRNSIQ------YA--SLDKPMKTIVVTSSMESEGKSSMSSNISITYSMEKKKV-ILVD
A0A1G3A0W0      LVRTALL------SR--LGGPRNTALLITSAVAGTGKSYFTMTLGESLARAGKKV-LMID
A0A2E7D3V4      SVRTALF------VS---GSGRSQAIQVSSPEPGDGKTTFISNLAIAIAQSGRKV-LLID
A0A353BE27      SVRTGLY------FS--NKGKALKVIQVTSPVPGDGKSTLSSNISVTMAQSGRRV-LLID
A0A2E0SHG0      ALRTNLY------YG--THGSTPKVVQFTSPNPKDGKSVTTANLAISLAQTGKSV-LLID
A0A358MY60      TLRANLM------LS--KQTKDARTVTVASSMSGEGKSSVSSQLAISLAKACGETVLLVD
A0A355GJI7      SLRTSLL------LK--TDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKV-LIVD
M5U569          SCRTSIF------FE-LSGIPGGKILQVTSPLPGDGKSTIAGNLACSIAQSGKKT-LLID
L7CND7          SCRTSVL------FE-MAGIPGGKIIQVTSPLPGDGKSTIAGNLACSIAQSGKRT-LIID
A0A0J1B8S4      SCRTSVL------FE-MAGIHGGKIIQVTSPLPGDGKSTIAGNLACSIAQSGKRT-LIID
F2ARR3          SCRTSVL------FE-MAGISGGKIIQVTSPLPGDGKSTIAGNLACSIAQSGKRT-LIID
K5D8H6          SCRTSVL------FE-MAGIPGGKIIQVTSPLPGDGKSTIAGNLACSIAQSGKRT-LIID
M2AKU0          SCRTSVL------FE-MAGIPGGKIIQVTSPLPGDGKSTIAGNLACSIAQSGKRT-LIID
A0A3L7P7S7      GLRTALY------FS-TQG-HGHQVLQATSPVAGDGKSTTAANLAISIAQSGKKI-VLLD
M5T8W8          SCRTSIF------FD-LSNVPGGKIIQVTSPLPGDGKSTIAGNLACSIAQSGKKT-LLID
M5SF00          SCRTSVL------FE-LAGVEGGKVLQVTSPLPGDGKSTIAGNLACSIAQSGKRT-LIID
A0A2G1WDS1      SCRTSVL------FE-LAGVEGGKVLQVTSPLPGDGKSTIAGNLACSIAQSGKRT-LIID
Q7UVS9          SCRTSVL------FE-LAGVEGGKVLQVTSPLPGDGKSTIAGNLACSIAQSGKRT-LIID
A0A3C1QS25      AVRTALF------FS-NRQ-RDIKVIQVTSPSPGDGKSTLALNLAVSIAQSGQKV-LLVD
A0A2A2WFP6      AVRTAML------LD-RRQ-TDSKVFQITSPLPGDGKSTLAANVGCSIAQSGKRT-LLID
A0A255QXY0      AVRTAIM------LE-RKK-NGSQVFQITSPLPGDGKSTLAANVGCSIAQTGKTT-LLID
A0A1Z8MHR4      GVRTAML------FE-QRQ-FNSKVFQVTSPLPGDGKSTLVGNIGCLVAQSGKRT-LLID
A0A2A2WC24      GVRTAML------FD-RRQ-YNSKVFQITSPLPGDGKSTLAANVGCSVAQSGKRT-LLID
A0A1G2YRE4      TIRANMG------LL--SKNEMPKILVITSPWMREGKTTLSINLATSLAKSGKKV-LLID
A0A255QXF5      SLRANLA------LS--KDTRDARTFAIVSSMSGEGKSTAVSQLAISLAKASGKTVLIID
A0A1I3GSP0      SVRTTLF------VS---MREDHKVVQVSSAAPGEGKSTTAANLAIAIAQSGKKV-LLVD
A0A2S8F9B8      SVAATIL------RR--AADQQCQVLLISSAMPREGKSSLACHLAISLAHAGRKV-VVVD
A0A368KP63      SVAATIL------RR--AATQKCQVLLISSAMPQEGKSSLTCHLAISLANAGRRV-VIVD
A0A3L7P0L2      SSRTTLY------HS--TKDSQDKIIQITSAEPGDGKSTTAANLAIAIAQSGKKV-LLID
A0A3M1VG27      VVRTRLL------VS--LHDEHHRVLQITSPEPNDGKTTVACNLALAVAQSGKRV-LLLD
A0A3L7UX05      HLRVAIS------AS-LGSTHEHQSILITSAFGGEGKTTLSAQLAGRCANAGLST-VVVD
A0A142XL75      ATRTMLV------HG--TDEPDLRVLVVTSAVSGEGKTSLTGHLAISLARAGFRT-LLVD
A0A3A0DR44      GLRTCLL------LS--EATSSHRVFAVTSAVSGEGKTSLVSQLAISLARATGKRVLIVD
A0A3E0PW54      SVRMAVL------RN--QPESGGQAVQMTSAEPGDGKSVSAANLSLAIAKSGKRV-LLID
A0A2D5GZ77      SLRTSLL------LK--TDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKV-LIVD
A0A3D3R1Z6      SLRTSLL------LK--TDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKV-LIVD
A6BZU4          SLRTSLL------LK--TDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKV-LIID
A0A1N6KY57      AARTALL------HV--SRTESVRVVMIASALGGEGKTSLASHLATSLARAGRRT-LLVD
L0DK20          AARTTLL------HF--SRTESVRVVMVASALSGEGKTSLSSHLATSLARAGRRT-LLID
A0A2D6ST10      SARTVLL------RD--AKVDSLKAVMICSAVGGEGKSTLSCHLATSLARAGRKV-LLID
A0A1Z8MPL5      GLRAMLL------HL--PAAKDVRTLMVTSALANEGKTTVASALATSMGRSGRRT-LLID
A0A1Z8MBT6      SLRANLA------LS--QDTRTARSFCIASSMSGEGKSTAASQLAISLAKSSGKTVLIID
A0A2A2W6A9      TLRANLA------LS--KDTRHARSFAVVSSMSGEGKSTAVSQLAISLAKSSGKTVLIID
A0A177Q3B7      AARTSLL------HL--AKHGEVQAILVTSAVGGEGKTSLACQLAASLARAGFQT-LLID
A0A142XAP8      STRTMLL------HT--AKAQAMQVVMVTSATQGEGKTSLASQLATSMATAGMRT-LIVD
A0A2Z3HEL7      STRTMLL------HT--AKSQSMQVVMVTSATQGEGKTSISSQLATSMATAGMRT-LIVD
A0A3L7Q373      SIRTTLF------HS--TKESQDKLIQITSAEPGDGKSTTAANLAIAIAQSGKRV-LLID
A0A353Z859      SARVMLL------RR--ASLENAKVVMVSSAVTSEGKTTMACHMGTSLARAGYRT-VVVD
A0A2E0AW64      HLRTSLV------LS--RPLEDIQVLAVTSSVSGEGKTTLAAQLAMSIARASGQPTLLID
A0A351FZ59      HLRTSLV------LS--RPLEDIQVLAVTSSVSGEGKTTLAAQLAMSIARASGQPTLLID
A0A2E0X6Y6      TLRTALT------LS----PQAHSRLLVSSSEPSDGKTTVALNLAVTFAQAGRRT-LIID
A0A3M1TFJ0      RARVQLN------ATGAFPSEGCGVLVCVSGVPREGKTLCSVNLAVAEAQA-GRRTLLVD
M5T666          TLRANLF------LS--VDTRETRSIAIVSSMSGEGKSSVASQLALSIAKATGETVLLVD
M5U6N6          TLRANLF------LS--MDTRNTRSIAVVSSMSGEGKSSVASQLALSIAKATGETVLLVD
A0A1C3EBY9      TIRTSLL------VT--AEALNTQVIQVGSPEPGDGKTTLVSNLALALASSGKRV-LLID
D5SX64          TIRTSLL------VT--AEALNAQVIQVGSPEPGDGKTTLVSNLALALASSGKRV-LLID
A0A354GX32      GIRTRLL------HA--GRSETLRVVMVASAVSGEGKTTLASHLAASLARGGRRT-LLVD
M5RUI3          ALRANLF------LS--LDTKHTRSIAVVSSMSGEGKSSVASQLALSIAKATDQTVLLVD
A0A2S8FCC0      GIVARLF------RQ--SGANKNRVVMISSALAGEGKTTLAGQIAYALAESGART-VLVD
A0A3B8ZJM2      SVRTGLF------FS--SRGSELKVVQITSPVPGDGKSTLSSNLAVAMAQSGRRV-LLID
A0A1U7CLW1      AVRTMLL------NA--GRHQPFRVVLVTSALKGEGKTSLSCHLATSLARGGRKT-LLMD
A0A142WPR7      AVRTSLY------FR--TRGEPLKVIQVTSPNPGDGKSTLSGNLAISIAQTGKRV-LLMD
A0A2Z3GZZ5      GLRTQLY------FS--TQGRGHQVIQVTSPTPGDGKSTLAANLALSVAQSGKRT-ILVD
A0A2E6AG00      TLRTTIA------FA----GDDLKCVAVSSSEPGDGKTTVVANLGATFAQANXTT-LMID
A0A1G3A880      TLRTALA------FS----PHATERIAVSSSEPGDGKTTVLVNLAVSFAQAGKRT-LLID
A0A2E8ATT1      TLRTTLA------FS----ESDTECIAVTSSEPGDGKTTVLANLGLVWAQVGKKT-LLID
A0A350KD81      SLRTSLL------LK--TDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKV-LIID
A0A2E3Z6T8      TLRTVLS------LS--EQNCER--ILISSSEPGDGKTTISANLSVALAQAGHRT-LVID
A0A257WQ92      SLRTALN------VT--SDNAHANVILVTSPETGDGKTTTISNLAIAMAQSGKRV-LLVD
A0A356ETW1      TLRTALA------LA--DRELNR--IVVTSAEPGDGKTTIIANLATCYAQSNKKT-LLID
A0A3L7NJY1      ALRTSIE------FS--PEETRR--LVCTSTEPGDGKTTVSSNLAVAFAQSGRRT-LLID
A0A356ESF4      TRESEGFRTLRTALA--LRDREARRLVVCSAEPGDGKTTVLANLGVSFAQAQRKT-LLID
A0A354PCV3      TLRSNLF------LS--TRWKGTRSIAVVSSISSEGKSSIASQLSVSIAKATGKTVLLVD
A0A354PHB4      ALRSNLF------LS--SSWKDTRSIAVVSSISSEGKSSVASQLALSIAKATGETVLLVD
M5S2L2          --------------M--ADIQGGKVIQVTSPLPGDGKTTLAGNLACSIA-QSGKRVLVID
A0A2D6A9B6      ALRNRLT------VM--NPDGSARSLVITSAIQGEGKTATALNLAMSMTELQDHRILVLD
A0A2G6JGH3      ALRSKLL------VM--NPERAPRSVVITSAIQGEGKSSSAINLALAFAELEDQRAVLLD
A0A3L7SU85      --------------------------------AGDGKSTTSANLAISIAQ-SGKKIVLLD
A0A3M1RAJ8      NIRTTLI------HR--AKKDGLKVVMVTSGVAREGKSTVASQLAASLAR-AGRKTVLID
A0A3D4PLL5      --------------------ENHQRISITSTQPSDGKTTVISNTAVAFAQ-AGKKTLVID
M5RD30          --------------------------MMTSPHPGDGKSTTISNLAISLAQ-TGKRVLLID
A0A2Z3GYP4      GVRTALF------FS--THGERHKVIQVTSPHMGDGKTTLIINLAVSIA-QAGRKVLLLD
A0A1V6CUG1      SLRTHLL------AQ--YPD-ERFCLLITSAMAGEGKTVTAANLAMVMAERIDRKTILVD
A0A3M1SE88      TLRTALA------LS--ESDADTIVVSSTEPG--DGKSTVAANLAAAFA-QAGKKTLLID
A0A3M1R9K7      GIAARLI------RQ--AKEDETRVVLVTSAFGGEGKTTVASQLAISLA-EMGQKTILID
A0A3L7PH51      SLRNFIT------FS--NEATQRLVVTSTEPG--DGKTTTLANLAVAFA-QAGKKTLLID
A0A3N5UQY5      IVRTAVF------FG--APNGKAKTTLITSPGMEDGKSTLVSNLAIAMA-RAGQKTLILD
                                                   **:      .           :::*

A0A356AE44      ADLRKPMVHQLFGMR------------------E-E--IGLSECLSGEIEMAN----AIQ
A0A1G2XSU7      GDLRKPDIAKYLKLD------------------NKG--KGMHQLL-ADFKLRD----LLL
A0A2D6SRY7      ADMRRPVLHGLFGVE------------------R-G--PGLSEILVGNATWQE----NLR
A0A1G3C300      TDFRKPRQHKIFGID------------------L-K--PGLSNHFIGEIDYES----IIK
A0A0S8H0S8      ADLRNPMQHEVFDVA------------------C-E--PGLTGLLAGTAGLQD----AIR
A0A1Z8MCI4      ADVRKPSLHSLFDVS------------------N-E--VGLVDVLMQRSELDD------A
A0A177PV03      ADFRKPRMHEIFGVS------------------A-D--VGVASVIAGTAKLKD----AVK
A0A1G2YIM0      GDLRKPDIAKILNIE------------------TGH--NALRKVLLGYNTLDE----SVW
A0A177QX42      GDLRRPRIHKLFGLD------------------L-E--RGLSSVIRDGMDLPD----AVQ
A0A1G2ZG92      LDLRRPTAHKFFKIS------------------N-N--NGITNILSGGFSLDE----TIV
A0A1G3A0W0      ADLRKMGLTRRFNLA------------------G-K--AGFIESLRSRSADKR----HIF
A0A2E7D3V4      ADLRRPTVNQLFGLP------------------Q-D--IGTCDVLLGDIELPN----AVK
A0A353BE27      ADLRRPRVAKIFGID------------------S-E--IGVAAVVGGKVEVDD----AIC
A0A2E0SHG0      CDMRLPMVDKLFGLD------------------T-S--VGLSSVLRGEAEIPD----AIQ
A0A358MY60      ADLRSPDQHDIFGLE------------------M-G--PGLAGVMAGDANLAD----AVD
A0A355GJI7      ADLRRPTIHKLFGLA------------------N-S--VGLGDVLTGEIDAQT----AIR
M5U569          CDLRRPQITDNFASA------------------E-Q--LGLIDVLNGHCEHIE----AIH
L7CND7          CDLRRPQVTDNFAMA------------------D-Q--LGLVDVLNGKCEHVD----AAH
A0A0J1B8S4      CDLRRPQVTDNFAKA------------------D-Q--LGLVDVLSGKCEHVD----AAH
F2ARR3          CDLRRPQVTDNFAMA------------------D-Q--LGLVDVLNGKCEHID----AAH
K5D8H6          CDLRRPQVTDNFAMA------------------D-Q--LGLVDVLNGKCEHVD----AAH
M2AKU0          CDLRRPQVTDNFAMA------------------D-Q--LGLVDVLNGKCEHVD----AAH
A0A3L7P7S7      ADFRKPRVHKIFKLD------------------QPE--VGLASVVSGDATLQE----AIH
M5T8W8          CDLRRPQITDNFDSA------------------E-Q--LGLIDVLNGHCEHIE----AIH
M5SF00          CDLRRPQVTDNFAMA------------------D-Q--LGLVDVLNGKCEHVD----AAH
A0A2G1WDS1      CDLRRPQVTDNFAMA------------------D-Q--LGLVDVLNGKCEHVD----AAH
Q7UVS9          CDLRRPQVTDNFAMA------------------D-Q--LGLVDVLNGKCEHVD----AAH
A0A3C1QS25      ADLRRPRQHKVIGEN------------------A-E--HGFAAVLRGDLAVAE----AAI
A0A2A2WFP6      LDLRSPRLSLRFNLE------------------T-K--IGLANVLNGELSAAQ----AVH
A0A255QXY0      LDLRSPRLSLRFNLQ------------------S-D--KGLANVLNGEIGISE----AIH
A0A1Z8MHR4      LDLRSPRLSLRFNLS------------------T-N--VGLTNVLNGELAPEE----AVC
A0A2A2WC24      LDLRSPRLSLRFNLE------------------A-K--TGLTNVLNGELGPAE----AIH
A0A1G2YRE4      GDLRKPDIAYLLNLP------------------K-ST-KGLKDVLLG-TEFEQ----AVS
A0A255QXF5      ADMRCPDQHDVFGLP------------------L-E--PGLNEVLREVVPFEQ----AIN
A0A1I3GSP0      CDLRRPTQHTLFQVP------------------Q-E--VGLTDVLLREIDWQN----AVR
A0A2S8F9B8      FDLRRPSMHAIFDCP------------------I-S--PGVGELLVNHVKLDE----AIQ
A0A368KP63      FDLRRPSMHRILGLP------------------I-G--PGVSDLLAGQAELAD----VVK
A0A3L7P0L2      ADLRRPTMHTLFALP------------------Q-D--IGLTDVLLSEVDWFN----AVR
A0A3M1VG27      ADLRRPSIHKALGLR------------------Q-D--IGVTDILRGEIDWQT----AVQ
A0A3L7UX05      GDLRNPTLTRTLEAT------------------D-M--PGLTNLLKGQSNIDK---CLVR
A0A142XL75      GDLRSPTAHRVFDAP------------------L-A--PGLCEILRGSTSVLE----AVR
A0A3A0DR44      ADLRSPNLHEIFEIH------------------L-E--PGLAGVLRKECEITD----AIV
A0A3E0PW54      ADMRRPTVHELFRIK------------------Q-D--IGLSEVLLGEIEWMN----ALR
A0A2D5GZ77      ADLRRPTIHKLFGLA------------------N-S--IGLGDVLNGEIDAQT----AIR
A0A3D3R1Z6      ADLRRPTIHKLFGLA------------------N-S--IGLGDVLNGEIDAQT----AIR
A6BZU4          ADLRRPTIHKLFGLA------------------N-S--IGLGDVLNGEIDAQT----AIR
A0A1N6KY57      GDLRRPSVHELFDQP------------------C-V--PGFSEVLRDEIELID----AVQ
L0DK20          GDLRRPSAHELFDQP------------------C-V--PGFSEVLRNEVNIAD----AIQ
A0A2D6ST10      CDLRRPSICRVFDLP------------------Q-I--PGVCELLRGESSLDD----CTR
A0A1Z8MPL5      GDLRCPSAHRFLEMP------------------L-D--EGLAEVLRGDVAIEN----AIR
A0A1Z8MBT6      ADLRCPDQHDIFGLA------------------L-E--PGLSDVVEEKSTLDD----AIN
A0A2A2W6A9      CDMRCPDQHDVFGLA------------------L-E--PGLNEVLRKAAPLKE----AIN
A0A177Q3B7      GDMRRPACHRVFGAP------------------A-S--PGFSELLRNENSLEE----VLQ
A0A142XAP8      CDLRNPSIMKLFELP------------------L-A--PGVSEVLRQEVDVSD----AVQ
A0A2Z3HEL7      CDLRNPCVMKLFEVP------------------L-T--PGVSEVLREEVDVSD----AVQ
A0A3L7Q373      ADLRRPTMHTLFGLS------------------Q-D--IGLADVLQNEIQWVN----AVR
A0A353Z859      VDLRRPTVHRVFDVA------------------G-D--PGVCEVLSGAAKPAD----VIQ
A0A2E0AW64      GDMRAPDLYDVFEIP------------------N-Q--PGFADLLEDHNSLGG-----YV
A0A351FZ59      GDMRAPDLYDVFEIP------------------N-Q--PGFADLLEDHNSLGG-----YV
A0A2E0X6Y6      ADLRKPGLTTRLSLK------------------R-D--AGVAELLLADGEIADNAPRFVQ
A0A3M1TFJ0      GDMRNPRVHKVFAAD------------------P-A--PGLRNALEEGEGLEF----LQS
M5T666          ADLRCPDQHEIFGLE------------------M-G--PGFTSVLSKESQLVD----AVD
M5U6N6          ADLRCPDQHEIFGLD------------------M-G--RGLTSLLAKQTELKD----VVD
A0A1C3EBY9      ADLRRPMATRLFGLR------------------P-D--PGLVDVLQGEIALEN----AIV
D5SX64          ADLRRPMATRLFGLR------------------P-D--PGLVDVLQGEIALEN----AIV
A0A354GX32      GDLRNPAAHKLFGMA------------------A-G--PGFSELLRGEVEPGQ----VVQ
M5RUI3          ADLRYPDQHEIFGLE------------------M-G--PGLSGVLSQTATLEE----AVD
A0A2S8FCC0      FDLRRPALDISFDIE------------------L-T--PGVTELLSGEVEFDD----AIQ
A0A3B8ZJM2      ADFRRPRLQKLFGFD------------------A-D--VGVAQLVAGQCELDD----ATY
A0A1U7CLW1      CDLRKPSLHDVFDFP------------------S-G--PGLGDILRGEIGWTD----AVR
A0A142WPR7      ADFRRPRIHKLIGQN------------------T-S--LGVSSVIAGTAELVD----AIQ
A0A2Z3GZZ5      CDLRKPRVHKLFAGA------------------D-ATGTGLAEVIAGVRPLAD----GIV
A0A2E6AG00      ADLRKPGMTRLFELR------------------G-Q--EGLSDLLRSDVDVRDRAASLIC
A0A1G3A880      ADLRRPGLTTLLGMK------------------G-A--AGVSDVLRGDGEVARLAAQCVC
A0A2E8ATT1      ADMRRPGLSRLLDMR------------------G-T--SGLSDVLRGEGAVGEICERLVQ
A0A350KD81      ADLRRPTIHKLFGLA------------------N-S--IGLGDVLNG----EIDAQTAIR
A0A2E3Z6T8      ADLRRPGFTTLMQLK------------------G-Q--PGVADLLTSPETPAQSAPPLIH
A0A257WQ92      ADLRRPSVHTLFNLP------------------T-D--IGLADVLAG----EIQGLNALR
A0A356ETW1      ADLRRPGLTNLMQMR------------------Q-Q--EGLSTVLRSNAHVADLCVALIQ
A0A3L7NJY1      ADMRRPGLSTLLGLR------------------D-D--FGLSRLLRSTDNLETSISQNLR
A0A356ESF4      ADLRRPGLTSMLDLR------------------G-A--EGLSNLLGGNGKVGAAAAAVIR
A0A354PCV3      ADLRRPDQHRLFGVE------------------M-G--PGLSGVLAGTTPLLDAVNTSLG
A0A354PHB4      ADLRRPDQHRLFGVQ------------------M-G--PGLVAVLAGKTPLLDAVNTSLG
M5S2L2          CDLRRPQITDNFAMQ------------------S-K--MGLSNVLNGDCDPS----EACQ
A0A2D6A9B6      CDLRKPSVETFLGLN------------------R-G--PGLADLLQGSTSLD----EAIR
A0A2G6JGH3      FDFRKPSVETLLGLN------------------Q-E--PGLTELLMGRLALH----QAIR
A0A3L7SU85      ADFRKPRVHKIFRLE------------------QPE--VGLASVVNGDATLQ----EAIH
A0A3M1RAJ8      GDLRRPRMHRVLKQD------------------L-A--PGLSEYLRGEAALE----EIVR
A0A3D4PLL5      GDMRRPGLTAVFALK------------------G-Q--AGLSTILRDTASIEESALKHIT
M5RD30          ADMRRPVIAGLFGLE------------------G-E--PGLTNVLFDSTQFD----KCIQ
A0A2Z3GYP4      ADLRRPRVHRAFGLT------------------S-R--IGLAEVLTGTAELA----DAIQ
A0A1V6CUG1      CDLRKKKLTAMLGCK------------------Q-Q--AGMAELLQGKATLR----DVVV
A0A3M1SE88      GDLRRPGLTAMLGYRGESGLSRALQSNE---DIE-E--AAVKTIRS--------------
A0A3M1R9K7      FDLRRP-----------------SLDGVFGIE-N-D--RGVSEILRGEAKWQ----QVCR
A0A3L7PH51      ADLRRPGMTQLLDLKGPRGLAQVLNDKKLDIDIA-E--RCLENVFH--------------
A0A3N5UQY5      ADLRKP-----------------IQHRIFDINHQ-E--QCLCSVLEGKVKLS----QAIQ
                 *.*                                                        

A0A356AE44      DSRIENLHIL-SAGAIPAKPAELLSSSK-LHYLLGQAKREYDFVLVDSPPVLAVSDPCIT
A0A1G2XSU7      YSDVPGLSVL-TAEPCDISIINRLIHHKNMVEFINEISRIFDHVIIDTPPVLAAVDALLW
A0A2D6SRY7      STSVEGLHVL-PAGQSPPNPAELLASER-TRTLIRELSDNFDLVLVDSPPALPLTDASVL
A0A1G3C300      HVNIPHLNII-TCGLIPPNPSELLGSHS-MEKFCDNVRNRFDIIIFDTPPTMTVTDAVVL
A0A0S8H0S8      FSGVERLDVL-PCGAAPDRPAEMLHSPA-FRQMLAELSGRYDRIVIDSPPVVSVTDSRIL
A0A1Z8MCI4      IVAVGKLDFL-PAGRLSAPPFGIFSEGN-VSGFIDSLREHYDLILVDTSPLNLTPETMLV
A0A177PV03      PTAVEGLSIL-PCGPRPANPAELLTSPA-FEQLLADLRKEYDFVLVDTPPLLAVSDPSAV
A0A1G2YIM0      PMPSVGLDVLISDGNDSYDAFELLTRSQ-TPSRLKAIAAHYEHVIIDTPPVLAVPDAIIW
A0A177QX42      TTLVPNLDVM-TVGPRVDNPAELLLSPQ-FTELVQQLREKYDFVLIDTPPILIVTDPAAV
A0A1G2ZG92      HTDVSGLDLL-TSGPIPPDPSSLIESQK-LRDIVNKLKEMYDMVIIDTPPVMAVNDATVV
A0A1G3A0W0      PTDTFGLNIM-PAGKHNDGAVIEETANGAFKACMSQLRQWYDFILLDSTPILPVADAMIL
A0A2E7D3V4      ESGIEGLQIL-TAGTPVGSPAELLSSAR-MASTIEAAKAEYDFVLVDTPPLLAVSDPCIV
A0A353BE27      AGPVANLSIL-PGGKRPANPAEILSSER-FRNMIDMLRDKFDVIVVDTPPLLAVSDPGAV
A0A2E0SHG0      ETEVENLTAL-PCGPVPENPAELLNQES-FSRLLAVVREQYDFVVIDSPPLLVVSDATAV
A0A358MY60      DTLGELVHVL-PAGRMTLSPHRLLSSEG-MRTLLDEALQNYKYVIVDTAPVLSAGETLAV
A0A355GJI7      ETRVSHLSIL-TAGMLPENPSEMLMSRA-FSELVNQLRKEYDYVLIDTPPLVVVSDPSVI
M5U569          DTPLATLKLM-PSGPIPANPAEALTLSE-MGELLELLRDEFDYIIVDTPPLLVVTDPSIL
L7CND7          DTPLSTLKMM-PSGPIPANPAEALTLPE-MSELLDVLREEYDYIILDTPPLLVVTDPSIT
A0A0J1B8S4      DTPLSTLKMM-PSGPIPANPAEALTLPE-MSELLDVLREEYDYIILDTPPLLVVTDPSIT
F2ARR3          DTPLSTLKMM-PSGPIPANPAEALTLPE-MSELLDVLREEYDYIILDTPPLLVVTDPSIT
K5D8H6          DTPLSTLKMM-PSGPIPANPAEALTLPE-MSELLDVLREEYDYIILDTPPLLVVTDPSIT
M2AKU0          DTPLSTLKMM-PSGPIPANPAEALTLPE-MSELLDVLREEYDYIILDTPPLLVVTDPSIT
A0A3L7P7S7      TCAVPGLHLM-PCGPRPANPSELLTSPK-FVEVIDELRKMYDIVLIDTPPILAVSDPSIV
M5T8W8          QTPLATLKIM-PSGPIPANPAEALTLTE-MGELLELLRDEFDYIIVDTPPLLVVTDPSIM
M5SF00          DTPLSTLKMM-PSGPIPANPAEALTLPE-MSELLDVLREEYDYIILDTPPLLVVTDPSIT
A0A2G1WDS1      DTPLSTLKMM-PSGPIPANPAEALTLPE-MSELLDVLREEYDYIILDTPPLLVVTDPSIT
Q7UVS9          DTPLSTLKMM-PSGPIPANPAEALTLPE-MSELLDVLREEYDYIILDTPPLLVVTDPSIT
A0A3C1QS25      ETQVPGLYFI-PCGERPSNPAELLTSPK-LPEFIEIARQQYDYVIIDSPPLLAVTDPSVI
A0A2A2WFP6      QTPIENLDIL-PCGPLPANPAEALTLAE-LADVFQWARANYDFIIVDTPPLLMVSDPTVV
A0A255QXY0      ETSIDYLDVL-PCGPLPANPAEALTMPD-LVEIIAWARDRYDCIIVDTPPLLMVSDPSIV
A0A1Z8MHR4      HSPIDNLDIL-PCGPLPANPAEALALAE-VAEVFRWARENYDYVIVDTPPLLMVSDPAVV
A0A2A2WC24      QSPIENLDIL-PCGPLPANPAEALTLAE-LAEVFQWARENYDFVIVDTPPLLMVSDPAVV
A0A1G2YRE4      SIRSTGLNVL-AMHSCHRVDAYELVASPETANIINKLSPKYDYIIIDSPPVLLFPDALMW
A0A255QXF5      KELGDLVHVL-PAGRLKASPHRLLSTSS-MRDLLDQALEKYEYVIVDTAPVLSAGESLAV
A0A1I3GSP0      PTQIENLSLM-TAGLCPENPAELLSTGT-LQVMLRRAREEYDVVLLDSPPILAVSDPCII
A0A2S8F9B8      PTNIPNVDLI-PAGSSEQSIPRSATSGR-LAELYRELRSLYDFVIVDAGPVLGAPSTRLL
A0A368KP63      ATDIPNVSFL-PAGVEEQSISRGATSGV-LDAILGDLRKRYDFVIVDAGPVLGSPSTRLL
A0A3L7P0L2      TTRLENLSVL-TAGLCPPNPAELLSSSR-LPDMLNAAKKSYDVIIIDTPPILAVSDPAIV
A0A3M1VG27      HTVENNLDVL-PAGLPVDNPAELLSSHA-FRHLLQTLRVEYDLVVVDSAPVLAVTDPCVV
A0A3L7UX05      IGEGGGFHLL-PAGTIHGDPSRILESAK-LGKIMAHLRENFQVVIVDSAPVLPVPDALLF
A0A142XL75      PTGIPGLSAL-TAGQWTLATRHALVGDR-WRETKDQLKAEFDFVVVDTSPLLLVSDTLLL
A0A3A0DR44      EEVAEGVHLL-PAGRVATSPHNYLGNGA-IPKLVAQLREVYDFVVIDTPPILCASESLVI
A0A3E0PW54      ETPVEGLSVM-TAGACPENPAELLTASD-LDGLLRAAREEYDVVIVDTPPVLAVSDPSIV
A0A2D5GZ77      ETRVTHLSIL-TAGMLPENPSEMLMSRG-FSELVKQLRNEYDYILIDTPPLVVVSDPSVI
A0A3D3R1Z6      ETRVTHLSIL-TAGMLPENPSEMLMSRG-FSELVKQLRNEYDYILIDTPPLVVVSDPSVI
A6BZU4          ETRVTHLSIL-TAGMLPENPSEMLMSRG-FSELVKQLRNEYDYILIDTPPLVVVSDPSVI
A0A1N6KY57      PTLISGLSLL-TAGFSDSDSIQTLASRD-LRAMFDQLKEQFDFLVIDSSPVLPVADALLI
L0DK20          PTAASGLSLL-TAGLSDNETIQALACRD-LRVMFDQLKEHYDFIVVDSSPVLPVADALLI
A0A2D6ST10      EVAPEGLSVI-PAGKIDHTVLRLLAEDA-VGELFENVKKQYDFVIIDSAPVLFVTDSLLI
A0A1Z8MPL5      PSRMPGLRFL-SAGHCDPTSLQALTKKN-LSEIFEKLVDEFEYIVVDSAPVLSVVDSLLI
A0A1Z8MBT6      RELGDLIHIL-PAGRLKASPHRILTTEA-VQGLIARCMEEYEYVIFDSAPILAAGETLAI
A0A2A2W6A9      RELGDLVHVL-PAGRLKASPHRLISPDS-MKELMDEALESYQYVILDTAPVLSAGETLAV
A0A177Q3B7      ATPLDHLTLM-AAGRWNYQTSQFLARER-MPDILAALRQQYEYIVIDSAPVLPLVDSLLL
A0A142XAP8      ATAVPNLWVI-PAGHCSNATIAALAQGNPLKTLFNRLRGQFDFVIVDSCPVLPVADALLI
A0A2Z3HEL7      ATAVPNLWVI-PAGQCSNATIAALAQGHPLETLFNRLRGQFDFVIVDSCPVLPVADALLI
A0A3L7Q373      STRLENLSVL-TAGRCPSNPAELLSSLR-LGETLRAIRGDYDIVIIDTPPILAVSDPAII
A0A353Z859      ESTQPNLFVI-PAGILASESLRNLAQDG-LGALMEHLRAEFDFVIVDSSPLLQVTDPLLA
A0A2E0AW64      TKWDEHCHVL-PAGQLTSSPHRLLANGA-FSGMLKEARATYKHIVIDTPPILAAGESMVM
A0A351FZ59      TKWDEHCHVL-PAGQLTSSPHRLLANGA-FSGMLKEARATYKHIVIDTPPILAAGESMVM
A0A2E0X6Y6      KTVVERLDVI-PTGLRRQNPAELLGSVR-FAELLAWAEANYDQVLVDCPPVLAVSDAQVV
A0A3M1TFJ0      TDVENL-YLL-PAGQGEENAANLLGSGEAFARLIGGLRQRFDRIVIDTPPVAAFSDGVLM
M5T666          SSLGNLIHLL-PAGRLNASPHRLISPAN-VTAFVDAALESYEYVVFDTAPVLAAGETLAI
M5U6N6          TSLGNLIHLL-PAGRLSASPHRLINPAN-IDNFVSSALEQYQYVVFDTAPVLAAGETLAI
A0A1C3EBY9      ETVVEGLTIL-PSGRPPHNPAELLEGGP-LRQLMAKARTLADIVLIDAPPVLAVSDACII
D5SX64          ETVVEGLTIL-PSGRPPHNPAELLEGGP-LRQLIAKARTLADIVLIDAPPVLAVSDACII
A0A354GX32      NTPLENLSLL-AAGACDHQALQALAQEGILRNVFDELKEQYDFLIVDVSPILPVADALLI
M5RUI3          TSLGSLLHVL-PAGRLDRSPHRLISESS-MRDFVDRALEKYSFVVIDTAPVLSASESLAV
A0A2S8FCC0      QTGIGTLDIV-AAGDWGHNSLRELTSDR-MDSFFKSLRSQYDYVIVDGSPILPVVDARLI
A0A3B8ZJM2      TTCVANLSIM-PGGKRPNNPAELLSSSR-FAELIEIVREKYDIVIIDTPPLLAVSDPSVV
A0A1U7CLW1      QTPVPGLSLI-FAGRCDPATIDLLPRED-FPNLLQELRDQFDFIIVDSSPLLLVTDALIV
A0A142WPR7      DTPVENLAVL-GCGPRPDNPAELLTGKR-FDELLGVLREQYDFVIIDTPPLLAVTDPSAV
A0A2Z3GZZ5      ASGAPGLDLL-PCGPRPANPAELLGSPQ-FQRVLAELRERYEFVIVDSPPLMAVADPAIV
A0A2E6AG00      KTSCECLHVL-PSGSRPLDPTGLLASNQ-FGELLAWAEARYDQILIDCPPTLVASDAAIA
A0A1G3A880      RSAVAGLDVL-GSGPRRPNPSELLAGPR-FADLLAWAESQYEQILVDSPPVLAASDAQIL
A0A2E8ATT1      SADVPHLDIL-PCGPRPADPVELLSGTR-IVDLLGWAQSRYDQILIDCPPIMAASDAAIV
A0A350KD81      ETRVTHLSIL-TAGMLPENPSEMLMSRG-FSELVKQLRNEYDYILIDTPPLVVVSDPSVI
A0A2E3Z6T8      STIVKDLDVL-PAGLRRPNPAELLSSKA-FIELLAWAESKYDRVIVDCPPVLAVSDAQIV
A0A257WQ92      PTFVENLQVL-PAGQPPANPAELISTPR-LTQFLKSVRDEFDMVLIDSPPLLAVSDPCAI
A0A356ETW1      PTGIERLDVL-PSGPRPANPAELLAGPR-FLELIDWASTVYDQILIDSPPTLATSDSAVI
A0A3L7NJY1      VTVVEGLDVI-SCGPRPVNPAELLAGDR-FANLLAWAETRYEQIIVDAPPVLAVSDPAIV
A0A356ESF4      PSGIAGLDML-PSGPRFANPAELLAQPR-LAELLAWADKVYDQVLIDSPPVLAASDAAVI
A0A354PCV3      HL----IHLL-PAGELTASPHRLMSPQR-LQAFMKDALNSYTYVVVDTAPVLSAGETLAI
A0A354PHB4      HL----IHLL-PAGELTASPHRLMSPQR-LQAFMKNALNTYTYVVVDTAPVLAAGETLAI
M5S2L2          QTPLSTLQVM-PSGPIPANPAEALTLPE-MGELIELLRDEFDYLILDTPPLLVVTDPSIT
A0A2D6A9B6      PSGIPGLDII-GAGSRPKNPSELAASRR-VDELLGQLKEQYNYVLLDTPPIVPISDAGIL
A0A2G6JGH3      NSGVESFDLI-GPGGMPTNPSELLSSRR-IDELIARLKEEYSLIILDTPPAIPLTDAGVL
A0A3L7SU85      TCEVPGLHLI-PCGPRPANPSELLTSPR-FSEVIEELRKLYDIVMVDTPPILAVSDPSIV
A0A3M1RAJ8      ETDRDNLWLI-PAGRCDTEALQALARSD-PERLFEVLRREFDFVVVDTSPLLTAADSLAV
A0A3D4PLL5      KTRLENLDVI-SAGPRPSNPVELLTSER-FEELIGWAEGVYDQILIDAPPSLAVTDPAII
M5RD30          STPIETLSVM-AHGSRTSEPAELLESFR-LSGLLRSCEQRFDIVLVDAPPLLAVADPAII
A0A2Z3GYP4      MTAIPNLSVL-PCGRRPSNPAELLTTPA-FEDVLDDLRAAYDYVLVDSPPLLAVSDPCVV
A0A1V6CUG1      PTVYPNLFFL-PPGNAAGNVGELMGRPE-LMEIVGELRRKYDYVLFDTPPINVVSDAGIL
A0A3M1SE88      -TGIENLDLL-PAGPRALHPAELLSGSR-LAELLAWVENVYDQVVIDSPPVLAAGDTAIL
A0A3M1R9K7      DSGIENLDII-PAGQWSYRGMAVLANGV-VGGLFRSLREQYDFVIVDGSPVLPVADTRFV
A0A3L7PH51      -LGVEGLDFM-PSGPRPANPSELLSSER-FSDIIAWAEQIYDQILIDAPPVLAVTDPSII
A0A3N5UQY5      PTQVPGLSLL-TCGYGIGNPAEVLNSPQ-FAKLLAYLGRAYDRIIVDAPPVTAVTDAQIL
                         :                                 ::.*  *     .    

A0A356AE44      A--QSVDTVMLIVRLHKNRRPSVKRALEIFEAHEIPLLG---VIANGLQDG---------
A0A1G2XSU7      A--SMVDGVILTSLAGHTETPDLKDTIERLKQINVNLLG---IVLSNVKYN---------
A0A2D6SRY7      S--TEVNGVFLVVRAGMASLEAARRAKASLQNVGARLLG---VIFNGACVQ---------
A0A1G3C300      S--RNVDGVVFVIKSGQTPKELTRRALLQYKNSKSDLLG---IILNLVDVS---------
A0A0S8H0S8      G--AICEVTVLVLRAEKSTHPVAQQAIEDLLDVGARLLG---AVINAVPRG---------
A0A1Z8MCI4      A--ESFDHAIVSFMRDKSRAAYAAKMLDKLELLDSNVVG---AVFSGTPIR---------
A0A177PV03      A--PRVDGVLLVVRFSKNARPSARRAKEILESMRADVVG---VVVNGYGRNGSGYGYDAY
A0A1G2YIM0      A--KMADAVVLASYAGHTQGPDVQRSLERLRAAGVKIIG---TVLNSVRIN---------
A0A177QX42      A--AHVDGVILVVRNTKRSRPQTRRVRETLDLIGARVLG---VVVNGISER---------
A0A1G2ZG92      G--RIADGILLVIESGRATFSIVDHIKELFTKAGLNTIG---IVLNKFKAY---------
A0A1G3A0W0      S--SQVDGTIMVERELVSQRGTQIDALMRLTSGGGQLLG---TVFVGSSDS---------
A0A2E7D3V4      A--PYTDGLLMVVCVGKNKRTTTRRAADLLDTHNVEVLG---VIANSIEQT---------
A0A353BE27      A--GIVDGVLMTMRLRRNVKPLALRAKSILEGVGANLLG---VVINGVSSE---AGYGYN
A0A2E0SHG0      A--PRADVVILNLRFKKNGRPEALRAIEILNGVAANILG---VTMTGYDSQ---------
A0A358MY60      A--AQTDATLVCVMRDVSRSDAVLRSSKRLEAAGANVVG---TVFSGVPSR---------
A0A355GJI7      A--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVAG---ILANSVKSG---------
M5U569          A--SMVDVVVMTLKIRRKSKPNLKEAANILRNVGARLVG---VVVNNSDESSSSDGYKGY
L7CND7          A--SMTDGVVMALKVRRKSKPNAKEAASILANVGAKLLG---VVINASDEGANNDGYKGY
A0A0J1B8S4      A--SMTDGVVMALKVRRKSKPNAKEAASILANVGAKLLG---VVINASDEAGNNDGYKGY
F2ARR3          A--SMTDGVVMALKVRRKSRPNAKEAASILANVGAKLLG---VVINASDEGSNNDGYKGY
K5D8H6          A--SMTDGVVMALKVRRKSRPNAKEAASILANVGAKLLG---VVINASDEGSNNDGYKGY
M2AKU0          A--SMTDGVVMALKVRRKSRPNAKEAASILSNVGAKLLG---VVINASDEGSNNDGYKGY
A0A3L7P7S7      A--PRVDGVLLVMRITRNGRPAAEQAAEVLGTLGAKVLG---VIVNGYDPRESDKYGYGY
M5T8W8          A--SLVDAVVMTLKIRRKSKPNLKEAATILRTVGARLIG---VVVNNSDESGSSDGYKGY
M5SF00          A--SMTDGVVMALKVRRKSKPNAKEAASILANVGAKLLG---VVINASDEGANNDGYKGY
A0A2G1WDS1      A--SMTDGVVMALKVRRKSKPNAKEAASILANVGAKLLG---VVINASDEGANNDGYKGY
Q7UVS9          A--SMTDGVVMALKVRRKSKPNAKEAASILANVGAKLLG---VVINSSDEGSNNDGYKGY
A0A3C1QS25      A--PRVDAVVLTFRLRKNIKLTSDRARDILASVGAEILG---VVVNGIGGQAGYGDYKYS
A0A2A2WFP6      T--TYVDAAILVMRIQRRCKPNAKEAVAMLRWTGSRVMG---VVINKFTAPRSMASYQSS
A0A255QXY0      A--SYVDAAIMVMRIAHRCKPNAKEALSMLRWSGTRVIG---VVINKLS--PRNQAYKAS
A0A1Z8MHR4      T--TYVDSTILVMRIRRRCRPNAREAVAMLRSAGASILG---VVINKMDEFTGKSYYRSS
A0A2A2WC24      T--TYVDAAMLVMRIRRRCKPNAKEAISMLRAAGARVMG---VVVNEIDDVSGGASYKSS
A0A1G2YRE4      A--KIAGSVMLTSFAGQTTTQDLREANQRLTQINVKVLG---TVLGNVQAQ---------
A0A255QXF5      A--SAVDSTLVCVMRDLTRMDSVVRTTHRLEASGANVVG---TIFSGVSHR---------
A0A1I3GSP0      S--PHADGLLLVVRMKKTKRATVQRVHETLQSHGVQVYG---VIANDFQPT---------
A0A2S8F9B8      AQPQYADGVILSIFKDVSQVTLVEDAKRILTSFGAPIIG---TVLSGYTSG---------
A0A368KP63      AQPQYVDGVILSVFKDVSQVTQVEDAKRVLTSFGAPILG---TVLSGYSTG---------
A0A3L7P0L2      S--PHIDGLIMVVRMGKNKRAAAERAREMIDAHGIRLYG---VIVNDIDYS---------
A0A3M1VG27      A--SLTDVVLFVVRLNKSRHSSTRRALELMHAHGARILG---VVGNCLPDD---------
A0A3L7UX05      G--RWVQGIVIAVRYDTSRFPMIERAYKRLSTLKVPVLG---AVVNGVRNA---------
A0A142XL75      A--READGVVVSVLMGVSQVALVDEAVTRLQAVRAKVTG---VIANGVRHA---------
A0A3A0DR44      A--KAADGTLLCALRDVSRSRQVRLASDRLNMAGVNLMG---AVLSGTSAR---------
A0A3E0PW54      A--PHADGVVLIVRMEKNKRAAIRRTLETLGGLDVELLG---VVANGVSPA---------
A0A2D5GZ77      A--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVTG---LLANGVQSG---------
A0A3D3R1Z6      A--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVTG---LLANGVQSG---------
A6BZU4          A--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVTG---LLANGVQSG---------
A0A1N6KY57      G--QHVDAVIFSIMRDVSRIPTVQAAYDRLARLGIRMLG---AIVTGEQTD---------
L0DK20          G--QHVDAVLFSIMRDVSRIPKVHEAYERLAKLGIRMLG---AIVTGEQSD---------
A0A2D6ST10      A--QHVDGVLFAVRRDISRAMKVASAQQRLSMLGVPMLG---AVVIGLDRD---------
A0A1Z8MPL5      G--QQCDAAILSILRDKSRIVPVYETNERLRTTQIPVLG---CVFNGQQNN---------
A0A1Z8MBT6      A--AVVDSTLMCVMRDVTRTDSVLRSTRRLEAAGANIVG---TIFSGVTPS---------
A0A2A2W6A9      A--STVDSTLVCVMRDLTRLDSVVRTTHRLEASGANVVG---TIFSGVTPR---------
A0A177Q3B7      A--QHVDGVVLSVLRRVSQLPLFESAVERLQSVGVNLLG---AVMNGMSPK---------
A0A142XAP8      A--QHVDGVVFSIMQDVSQLPKVVTASEKLTQLNIQLVG---AVVNGIKQD---------
A0A2Z3HEL7      A--QHVDGVVFSIMQDISQLPKVMTASEKLTQLNIPLVG---AVVNGIKQD---------
A0A3L7Q373      A--PLVDGLLLVVRMGKNKRATAQRSRELIDSHGIPLYG---VVANDIDYT---------
A0A353Z859      A--QSVDGVIVSIRRDVSQMPKVSSAIEKLQMMGIPVWG---AVAIGVDQS---------
A0A2E0AW64      A--KAADATILCAKRDVTRMEQLKKSRERLKGAGAEIVG---CVFNDVPPN---------
A0A351FZ59      A--KAADATILCAKRDVTRMEQLKKSRERLKGAGAEIVG---CVFNDVPPN---------
A0A2E0X6Y6      G--RLVDGAVIVVRPDKNHRRMVIRAVENFAATGCHIFG---VVANGVTAD---------
A0A3M1TFJ0      A--VAADAVVLVVSARTSRRSASQLAVVELSRVGREPVG---VILNQRPGS---------
M5T666          A--SAVDSTLICVMRDVSRKESVLRTTRRLEASGASVAG---TVFSGVSAR---------
M5U6N6          T--AVVDSTLICVMRDVSRKESVVRTTRRLEASGASVAG---TVFSGVSAR---------
A0A1C3EBY9      G--QHVDGYLLTVRLGKNRRPMLKRSRDLLLAHHIPILG---VVANGVEPS---------
D5SX64          G--QHVDGYLLTVRLGKNRRPMLRRSRDLLLAHHIPILG---VVANGVEPS---------
A0A354GX32      G--EHADAVLLSVLRNVSRLPAVHAAQQRLASLGIRVLG---AVVIGEGME---------
M5RUI3          A--SSVDSTLLCVMRDVSRMDNVNRSMRRLDASGATIAG---TVFSGVTAG---------
A0A2S8FCC0      G--QYVDGVVMAVLRDVSRGAKVQAARDLLSVFGVPFLG---VVVVGTTRE---------
A0A3B8ZJM2      A--SVVDGVVICMRLRRNVKPLATRAFRVLESVDAQVLG---VVVNGVSTEAAYGGYGYN
A0A1U7CLW1      S--QHVDAVLLSVLRAVSQLPQIYAASERLASMGVRILG---AVVSGVPLK---------
A0A142WPR7      A--PRVDAVIVTLRIAKRTRSEARRAMEVLGSVGANVLG---VVVNGISSR---------
A0A2Z3GZZ5      A--PQADGVLVVFRMTKTARPAAERAREVLAGVGAHTIG---VVVNASGDE---------
A0A2E6AG00      G--RIAGGLMLVVQPAKNHRRSVFRCVEETRSVGVXVVG---LIVNRLTXX---------
A0A1G3A880      G--RLVDGVLLVVQPDSNRRRVVERAVESFAALGVELLG---VVANRIRPE---------
A0A2E8ATT1      G--HLADGIMLVVQPEKNHRRVVFRAVASLLGMRNKVIG---IIANRIQPQ---------
A0A350KD81      A--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVTG---LLANGVQSG---------
A0A2E3Z6T8      G--RLVDGAILVVRPEKNHRRSVMRAVESFHATGCHVFG---VVANGLSSD---------
A0A257WQ92      A--RHADGLLLVVRLGKTSLVTARRAQELVKTHGLSVLG---MVANDTPAH---------
A0A356ETW1      G--RLVDGTILVVQPEKNHRRAVIRAVEGLLSLRIPLLG---LVVNHAKGE---------
A0A3L7NJY1      G--RLVDAVVLVVRPDKDRRRMVIRAAETLQSLGCSLLG---IVVNHLTAT---------
A0A356ESF4      G--RLVDGVVLVVRPEKNCRRNVLRAAETFATLNVPLLG---IAVNQVKAE---------
A0A354PCV3      A--ATVESTLLCLMRDVSRLDSIRQTTRRLEAAGAKIVG---TVFSGVTSR---------
A0A354PHB4      A--ATAESTLLCLMRDVSRLESIRQTTRRLEAAGAKIVG---TVFSGVTSR---------
M5S2L2          A--SMVDGVLLALRVRRKSKPNAKESVNILRSVGANIFG---IVINNSDES---------
A0A2D6A9B6      S--AKSDGTLVVVALERAARRMVKEALEQLESVGAQLLGTFVVGIRGADPA---------
A0A2G6JGH3      S--AKCDGTILVVGLERAPRKLSKEARKQLVESGAHLLGSFVVGVRGADPS---------
A0A3L7SU85      A--PRVDGVLMVMRVTRNGRPAAEQAAEILGTLGAKVLG---VVINGYDPR---------
A0A3M1RAJ8      G--RFMDGVLLSVIRDNSRLPLLLEAYQRLEEVELPLLG---VVVNG-GPA---------
A0A3D4PLL5      G--RLVDGIILTVRPDRNKRRMIIRAAESVTSLGGNLLG---VVVNG-LSD---------
M5RD30          A--PQVDGVLMTVRVLKNNRRSVERAGNVLEEIGVTPTA---IIVNG-SDA---------
A0A2Z3GYP4      A--PRVDGLVLTIRVTKNGRPAAERARDLLVRLKVNCLG---VVVNGVGKQ---------
A0A1V6CUG1      S--KAANEALLVVRMHRTHRESVDKALRLLHATNAKLVG---LVLTHRR-F---------
A0A3M1SE88      G--RLADGVLLVVQPEKNRRRVILRAAEYLTVLKIRLVG---LVVNRTAKE---------
A0A3M1R9K7      S--MHVDGVVMSVLRDVSRMPKVHAAYRTLAAFDAKILG---AIVTG---N---------
A0A3L7PH51      G--RIVDGAIVIVRPDKNRRKMVTRAIDSFRASGVKVIG---LVANHVEVS---------
A0A3N5UQY5      G--ALCDFTILVLRADRSTREITQRAIEALRGVGGRLLG---IVVNQVH-R---------
                         ..                           .                     

A0A356AE44      --------------------SGDYQYRGGYGGGYDKTPYQQNNDIPEFLAPTKTIIPS--
A0A1G2XSU7      ------------------QIYYPYGYGYYGKTNVIKDVKQEPADNIVIPEVK--------
A0A2D6SRY7      -------------EGLGLPGHYRYSYSHYSHYYHETDDDGEESTEFGWRRWLLKCRRALS
A0A1G3C300      -------KGGYYSYYYSHYYKYGYGYGAEPPKEKRKREKREKKEINV-------------
A0A0S8H0S8      ----------------------NRRYGRYSQYGYRRSHRRKASAPSE-------------
A0A1Z8MCI4      --------------------EYKYQYGSYYYYGGKKAIEMPVSKDACSGIGSVPX-----
A0A177PV03      RYGY----------------DQAYGYGSNESGYYHEHEGSSRKPANGNGHGGGIVARLFR
A0A1G2YIM0      ----------------KSYNEYGYGYYGAAKSGYAKRVHNRRAIIVPVQEEKTEVTNAAS
A0A177QX42      --------------------AAGYGYGDSYSYNYTTSYRSRSGKYYSDERVGHSYYDDSR
A0A1G2ZG92      -------------------EAGYYYYNRAYYK----------------------------
A0A1G3A0W0      ---------------------KDYRYSSAY------------------------------
A0A2E7D3V4      -------------------QGNSYTYSGGYADYLAPSEQSLELQREAQQPTAQPVA----
A0A353BE27      YDYNDYRYAYKYGSNYRSGYGYRYGYGNYRYGYSEYSDTQDLSVKQPGNPQ---------
A0A2E0SHG0      --------------------SGGYYSGGKYASYSAKESRSYYTNYTKTAARKSKA-----
A0A358MY60      --------------------QYAYRYGDYRYLTPKIDT----------------------
A0A355GJI7      -----------------KPGDYDYGSGPGYSDYYIVPPQAQAKQADVPAKTKITH-----
M5U569          GY---------------------YRYGRHTSRYYRKTKDNGPKGG---------QPRTPI
L7CND7          GY---------------------YRYGRHTNRYYRKTADNGAKAG---------QRRSPV
A0A0J1B8S4      GY---------------------YRYGRHTSRYYRKTANNGSKAG---------TRRTPV
F2ARR3          GY---------------------YRYGRHTNRYYRKTADNGAKAG---------QRRSPV
K5D8H6          GY---------------------YRYGRHTNRYYRKTADNGAKAG---------QRRSPV
M2AKU0          GY---------------------YRYGRHTNRYYRKTADNGAKAG---------QRRSPV
A0A3L7P7S7      GYGYKYSYGYK--------YSYGYKYGYNYSDYSSYTDEEGDGEGDDGKGGYDDRPRAPS
M5T8W8          GY---------------------YRYGRHTSRYYRKTKDNGTKGG---------QPRTPI
M5SF00          GY---------------------YRYGRHTNRYYRKTADNGAKAG---------QRRSPV
A0A2G1WDS1      GY---------------------YRYGRHTNRYYRKTADNGAKAG---------QRRSPV
Q7UVS9          GY---------------------YRYGRHTNRYYRKTADNGAKAG---------QRRSPV
A0A3C1QS25      KYGRNYAYNYRYGSYGNYGQPYGYGYGYGYGYDYEEAD----------------KYYDEP
A0A2A2WFP6      ASGSY--------------QSIGYGYGDRYRRRYQREV----------------NAQDTY
A0A255QXY0      ASGGY--------------QSIGYGYGDKYRRRYQREV----------------NSKDTY
A0A1Z8MHR4      ASGSY--------------QSIGYGYGDSYRRRYQHDA----------------IAHDAY
A0A2A2WC24      ASGSY--------------QSIGYGYGDKYRRRYQQEA----------------KTQDTY
A0A1G2YRE4      --------------------YSFHRYDRYYQNPSSRKTAEQAKIQLLLPDTAVNETDKN-
A0A255QXF5      --------------------QYAYRYGDYRYSDYTDLLPAGSNAE---------------
A0A1I3GSP0      -----------------TSGESGYDYDSYGTYYRENQTPAASKAKSAYVPQTAGK-----
A0A2S8F9B8      ---------------------MYYSYTNRPTSTVEVEQ----------------------
A0A368KP63      ---------------------MYYSYTARTKSTVEVAK----------------------
A0A3L7P0L2      -------------------VEDGQTYNEYEKYYDAAAPSLSAQPQTELVGGRK-------
A0A3M1VG27      -------------------GEDSELYTAFYAPYCAAGADADTAGEAADPSALAEASEAGR
A0A3L7UX05      ---------------SATYGGYGYGYGYGYGGSFGDGADEDVVTDAVDIDVEIVD-----
A0A142XL75      ------------------AHAYTHGYGTVDPVEHTPAPAISASPVTTERE----------
A0A3A0DR44      --------------------RYASTYGNYAYLEDSLS-----------------------
A0A3E0PW54      -----------------ADDYRANQYNSYYNPNQRPDHAAESRQPVAADA----------
A0A2D5GZ77      -----------------KFGDYDYGSGPGYSDYYIVPPQVQTKQADAPAKTKLTH-----
A0A3D3R1Z6      -----------------KFGDYDYGSGPGYSDYYIVPPQVQTKQADAPAKTKLTH-----
A6BZU4          -----------------KFGDYDYGSGPGYSDYYIVPPQVQTKQADAPAKTKLTH-----
A0A1N6KY57      --------------------HYGSNYLPSGRA----------------------------
L0DK20          --------------------HYGSKYGYSARAQESV------------------------
A0A2D6ST10      ----------------------SYGYNSRYGRNYQSYQQYRQYPR---------------
A0A1Z8MPL5      ---------------IFSPGYYTYGYGSPQPLGSDTESPS--------------------
A0A1Z8MBT6      --------------------KYVYRYGDYKYSNLVS------------------------
A0A2A2W6A9      --------------------QYSYRYGDYKYSDFGQMLAETAHRS---------------
A0A177Q3B7      ------------------VHASRYHYEPASSTLAPESLLDIDLSGVPSESSES-------
A0A142XAP8      --------------------VYSYGYNYVKQLPA--------------------------
A0A2Z3HEL7      --------------------VYSYGYNYVKQLPA--------------------------
A0A3L7Q373      ------------------------ADGGQEFSMYDRYYNEQTPELPSPLSRELLVGSQK-
A0A353Z859      SY--------GYGYGYGYGYGYGYGYGYGYGNSYGYGYGNRPRSSAPAVPSESPSDQSSQ
A0A2E0AW64      --------------------RYSYRYGYYGYEDHGGI-----------------------
A0A351FZ59      --------------------RYSYRYGYYGYEDHGGV-----------------------
A0A2E0X6Y6      ----------------SNGYGYGYGYGYGYGHDEDETDGFEEDSPVGHDDLTLAINGRRT
A0A3M1TFJ0      --------------------DYGYYYGDLYYGYGYGYGPSQPPARAGGSGA---------
M5T666          --------------------QYGYRYGDYQYALG-----GEPQAT---------------
M5U6N6          --------------------QYAYRYGDYHYAIG-----GEPVAT---------------
A0A1C3EBY9      -------------------------------DREEMGYYADYNRNEAFFPQDQSLPEKSS
D5SX64          -------------------------------DREEMGYYADYNRNEAFFPQDQSSPEKSS
A0A354GX32      ------------------------AYGQVRYPTKAPQAPAQ-------------------
M5RUI3          --------------------QYAYRYGSYHYAIAGETDA---------------------
A0A2S8FCC0      -----------DVYDY--------------------------------------------
A0A3B8ZJM2      YS--------YNDYRYSYRSSYGYGYGKYGKYGYGKYGKYTSYSTGYIEDRQAEAAEVST
A0A1U7CLW1      -----------PNRYY------------------------GSYTSPQWNPVEEEPS----
A0A142WPR7      -----------KGYGYSGSGNRGYAYGEG---------KAGVYYSEEEHPASSLTSQS--
A0A2Z3GZZ5      -----------GRG-------YGYGYGYGYEYKYTSYKYSDSYNTDADEDGARLVPAPTR
A0A2E6AG00      -----------EGRSY-----YGDSYGYGYGDNEGD--------------XEPAADSSSS
A0A1G3A880      -----------SNDRYDDGCAYAYGYGAAYRDEADQDGLIGADRDHEPQGADEAIERPRP
A0A2E8ATT1      -----------DQRGY-----YGYGYAYDYSSPEDENEQISTSKPAAGTPQEQVSPDPAS
A0A350KD81      --------------KFG---DYDYGSGPGYSDYYIVPPQVQTKQADAPAKTKLTH-----
A0A2E3Z6T8      --------------SSG--YGYGYGYGYSYDGGYSHEEEQDMVDTADTMMTPMPEIVQLP
A0A257WQ92      --------------DLNSYSADAY---------YRDVTPRQPVTREALVTQA--------
A0A356ETW1      --------------ERGGYYGYGYGYGYEYNGGYGNDEDDYADDVESEVTTATPRDAHFH
A0A3L7NJY1      --------------DSGG-YGYGYGYGYGY--GYGHDDPADRDGVQTLPLHSSETDVRHV
A0A356ESF4      -------------SRAG-----YYGYAPGHAYDYADSRGSNDDPGEQKDHFEAARRSAA-
A0A354PCV3      -------------Q---------------YAYRYGDYHYTVND----EDFGDVGIRASQD
A0A354PHB4      -------------Q---------------YSYRYGDYHYTVND----EDFIDVGVRDSHD
M5S2L2          -------------GASDGYKGYGYYRYSRYTNRYY-------------------------
A0A2D6A9B6      -------------TDER------YRYTWDGEAKE--------------------------
A0A2G6JGH3      -------------KDPR------YGYSRGE------------------------------
A0A3L7SU85      -------------EAGK------YGYGYGYGYKYSYGYKYGYKYNYGYNYTDYESYTDDE
A0A3M1RAJ8      -------------GR------------------------------YRSYYRAYTIDVESR
A0A3D4PLL5      -------------SRGE------YGYGYGYG--------------YGEGYGEGHDDPTHD
M5RD30          -------------ESKA------YGYSNHYRSE-----EYSYTPYYHDTYAASDPQPNSI
A0A2Z3GYP4      -------------GAMAGYGYDYYRHADDYSAPYTTADHDEPGMGEGQPLTPPARLSSEP
A0A1V6CUG1      -------------IIPS------YLYRYS-------------------------------
A0A3M1SE88      -------------RVPG------YDAYDTAYDYHGRDESDDPVSADGVP---------FD
A0A3M1R9K7      -------------PGEA------YYHDPRYTHYIDAADEPEPVSADETG-----------
A0A3L7PH51      -------------SNSD------YGYGYGYGYGYGYGHDTPPETGTDHE-----------
A0A3N5UQY5      -------------DGGR------YGY-YGGHYRLGRSNHKHGPDAKAHDTCIGMTLQPLE
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A2D6SRY7      SQRGETWAASAKGQTTDPQTTNAQIADPQAAALVTTTDPQTTDDETDEETDDETTERSRI
A0A1G3C300      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A1Z8MCI4      ------------------------------------------------------------
A0A177PV03      WLR---------------------------------------------------------
A0A1G2YIM0      ------------------------------------------------------------
A0A177QX42      KRR---------------------------------------------------------
A0A1G2ZG92      ------------------------------------------------------------
A0A1G3A0W0      ------------------------------------------------------------
A0A2E7D3V4      ------------------------------------------------------------
A0A353BE27      ------------------------------------------------------------
A0A2E0SHG0      ------------------------------------------------------------
A0A358MY60      ------------------------------------------------------------
A0A355GJI7      ------------------------------------------------------------
M5U569          ----VVSGRAVGLRASAAAAKPTSVAATTPINGKPEDDV---------------------
L7CND7          ----VVSGRGSAARSARPIAVPP--AVTSPTEQER-SDV---------------------
A0A0J1B8S4      ----VVSGRGPAPRSARPIAVPP--TAMPPVEQERSSDV---------------------
F2ARR3          ----VVSGRGPAARSARPIAVPP--ATAPSIEREG-SDV---------------------
K5D8H6          ----VVSGRGSAARSARPIAVPP---TTPSVEQER-SDV---------------------
M2AKU0          ----VVSGRGSAARSARPIAVPP---TTASVEQER-SDV---------------------
A0A3L7P7S7      LGSRVLPNVQPRVRTKRLTGGSPPQNVPGDGEPE--------------------------
M5T8W8          ----VVSGRAVGLRASAAAAKPTSVATSSTKNGTATDDV---------------------
M5SF00          ----VVSGRGSAARSARPIAVPPT-TPSVEQERS---DV---------------------
A0A2G1WDS1      ----VVSGRGGGARSARPIAVPPTVTSSTDQERS---DV---------------------
Q7UVS9          ----VVSGRGQAARSARPIAVPPATAPSIEQERS---DV---------------------
A0A3C1QS25      ----VAPGGKRRKRSAA--------------IGNDGPKS---------------------
A0A2A2WFP6      ----IVTGTKNLER-----------------VDLVAPSNSSQPGKPHLRQVVPQDSASGP
A0A255QXY0      ----MIKAKGSTHRVDGPELDLEADAVVDP-VDMAETGAVKTPTFK--------------
A0A1Z8MHR4      ----VVRGYRPAGSDAQYDARYDSYAQSGPGMGGPSSGGVVPPGHYPNGAEAPGLPPQPP
A0A2A2WC24      ----VVKGRHASDPVSVPAAPVESGDPPGTYEGEIADPEFTDPEFTDRKITAPDAAPFAP
A0A1G2YRE4      ------------------------------------------------------------
A0A255QXF5      ------------------------------------------------------------
A0A1I3GSP0      ------------------------------------------------------------
A0A2S8F9B8      ------------------------------------------------------------
A0A368KP63      ------------------------------------------------------------
A0A3L7P0L2      ------------------------------------------------------------
A0A3M1VG27      ----PSEEEAADRSSTPIASGA--------------------------------------
A0A3L7UX05      ------------------------------------------------------------
A0A142XL75      ------------------------------------------------------------
A0A3A0DR44      ------------------------------------------------------------
A0A3E0PW54      ------------------------------------------------------------
A0A2D5GZ77      ------------------------------------------------------------
A0A3D3R1Z6      ------------------------------------------------------------
A6BZU4          ------------------------------------------------------------
A0A1N6KY57      ------------------------------------------------------------
L0DK20          ------------------------------------------------------------
A0A2D6ST10      ------------------------------------------------------------
A0A1Z8MPL5      ------------------------------------------------------------
A0A1Z8MBT6      ------------------------------------------------------------
A0A2A2W6A9      ------------------------------------------------------------
A0A177Q3B7      ------------------------------------------------------------
A0A142XAP8      ------------------------------------------------------------
A0A2Z3HEL7      ------------------------------------------------------------
A0A3L7Q373      ------------------------------------------------------------
A0A353Z859      ----PPLN----------------------------------------------------
A0A2E0AW64      ------------------------------------------------------------
A0A351FZ59      ------------------------------------------------------------
A0A2E0X6Y6      ----ADEDHDGHDAPIRPRRAA--------------------------------------
A0A3M1TFJ0      ------------------------------------------------------------
M5T666          ------------------------------------------------------------
M5U6N6          ------------------------------------------------------------
A0A1C3EBY9      ----THRDLTISASPVRQP-----------------------------------------
D5SX64          ----THRDLTISASPVRQP-----------------------------------------
A0A354GX32      ------------------------------------------------------------
M5RUI3          ------------------------------------------------------------
A0A2S8FCC0      -----TSRRDRKKRLVHVG-----------------------------------------
A0A3B8ZJM2      ----KNDADTQS------------------------------------------------
A0A1U7CLW1      ------------------------------------------------------------
A0A142WPR7      ------------------------------------------------------------
A0A2Z3GZZ5      ------------------------------------------------------------
A0A2E6AG00      ----FSVXATPSQQIRRAA-----------------------------------------
A0A1G3A880      ----ANEAADQIGPVKRVA-----------------------------------------
A0A2E8ATT1      ----KPSGAKKRVVPRRAA-----------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      SIASEEHLPSASPQEHQSHETPFQTKSANSTTPLKPRRVA--------------------
A0A257WQ92      ------------------------------------------------------------
A0A356ETW1      DTDPDE---------------------GGRPGRIVPRRAA--------------------
A0A3L7NJY1      SDDKT-------------------------------KNAA--------------------
A0A356ESF4      ------------------------------------------------------------
A0A354PCV3      L-----------------------------------------------------------
A0A354PHB4      L-----------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      DEENEAANAEGKVQRGPSMASRVLPNLVPRIQTKRLPSKPASETKPPETPEST-------
A0A3M1RAJ8      EPKTA-------------------------------PRQPVGK-----------------
A0A3D4PLL5      DEEEAIPMTQSNSHR---------------------PRKRFSRDESSDRYAA--------
M5RD30          RLQNAV---GSQPVQ---------------------PTKLMSRS----------------
A0A2Z3GYP4      AGHVEPVANGPAHAPE--------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      DDDEDIVPRRVA------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ---DEQPYRRAA------------------------------------------------
A0A3N5UQY5      AGLSRSPVLRPS------------------------------------------------
                                                                            

A0A356AE44      -------------
A0A1G2XSU7      -------------
A0A2D6SRY7      VRSSS--------
A0A1G3C300      -------------
A0A0S8H0S8      -------------
A0A1Z8MCI4      -------------
A0A177PV03      -------------
A0A1G2YIM0      -------------
A0A177QX42      -------------
A0A1G2ZG92      -------------
A0A1G3A0W0      -------------
A0A2E7D3V4      -------------
A0A353BE27      -------------
A0A2E0SHG0      -------------
A0A358MY60      -------------
A0A355GJI7      -------------
M5U569          -------------
L7CND7          -------------
A0A0J1B8S4      -------------
F2ARR3          -------------
K5D8H6          -------------
M2AKU0          -------------
A0A3L7P7S7      -------------
M5T8W8          -------------
M5SF00          -------------
A0A2G1WDS1      -------------
Q7UVS9          -------------
A0A3C1QS25      -------------
A0A2A2WFP6      RPL----------
A0A255QXY0      -------------
A0A1Z8MHR4      QSSGGSYDSSIGS
A0A2A2WC24      KVAPDRRRTNVRS
A0A1G2YRE4      -------------
A0A255QXF5      -------------
A0A1I3GSP0      -------------
A0A2S8F9B8      -------------
A0A368KP63      -------------
A0A3L7P0L2      -------------
A0A3M1VG27      -------------
A0A3L7UX05      -------------
A0A142XL75      -------------
A0A3A0DR44      -------------
A0A3E0PW54      -------------
A0A2D5GZ77      -------------
A0A3D3R1Z6      -------------
A6BZU4          -------------
A0A1N6KY57      -------------
L0DK20          -------------
A0A2D6ST10      -------------
A0A1Z8MPL5      -------------
A0A1Z8MBT6      -------------
A0A2A2W6A9      -------------
A0A177Q3B7      -------------
A0A142XAP8      -------------
A0A2Z3HEL7      -------------
A0A3L7Q373      -------------
A0A353Z859      -------------
A0A2E0AW64      -------------
A0A351FZ59      -------------
A0A2E0X6Y6      -------------
A0A3M1TFJ0      -------------
M5T666          -------------
M5U6N6          -------------
A0A1C3EBY9      -------------
D5SX64          -------------
A0A354GX32      -------------
M5RUI3          -------------
A0A2S8FCC0      -------------
A0A3B8ZJM2      -------------
A0A1U7CLW1      -------------
A0A142WPR7      -------------
A0A2Z3GZZ5      -------------
A0A2E6AG00      -------------
A0A1G3A880      -------------
A0A2E8ATT1      -------------
A0A350KD81      -------------
A0A2E3Z6T8      -------------
A0A257WQ92      -------------
A0A356ETW1      -------------
A0A3L7NJY1      -------------
A0A356ESF4      -------------
A0A354PCV3      -------------
A0A354PHB4      -------------
M5S2L2          -------------
A0A2D6A9B6      -------------
A0A2G6JGH3      -------------
A0A3L7SU85      -------------
A0A3M1RAJ8      -------------
A0A3D4PLL5      -------------
M5RD30          -------------
A0A2Z3GYP4      -------------
A0A1V6CUG1      -------------
A0A3M1SE88      -------------
A0A3M1R9K7      -------------
A0A3L7PH51      -------------
A0A3N5UQY5      -------------
                             

© 1998-2019