BYKdb

Dataset for cluster tadcd of phylum planctomycetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

114 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2G2JCA2      ------------------------------------MNMITNSTPNYRPAKPPAEKKPFI
A0A286U4B3      --------------------------------MNNDSFLNQTQDPSNYYSGKTSSLDEIH
A0A1G2XVR0      -----------------------------------------------MLTESEIQPKQLD
A0A1G3B0P0      -----------------------------------------------MLTESEIQPKQLD
A0A1E3X4X0      -----------------------------------------------MLNNKE----QTH
A0A1U9NNE1      -------------------------------MNQIDKYYESYLGSYAQEGTKQESENTLT
A0A1N6KFT7      -----------------------------------------MAIQQSITGPGSEGPPSRT
L0DFG4          -----------------------------------------MANQQSITGSVSEGYPSRT
M5SZR3          -----------------------------------------MNSNRKLVSRNANSQDEQL
M5TW92          -----------------------------------------MNSNRKLVSRNANSQDEQL
A0A0S8FY64      --------------------------------------------MEDTLAAEAYPDEVRE
A0A2E3GW02      ----------------------MKIRLSPEGEFSNVTTLEAKHTPRWSARATEPKPTQNG
A0A1I3DDV4      ---------------------------------MSDMPQKPDSQMPVKPMMDTRPMLDPN
A0A2E3GWC6      ----------------MPADASRSGFERNIAMRQNETMNQPTVESKNNPAPFPSHQMMQT
F0SLB0          ----------------MPADAGRSGFERHIAMRQNETMNQPTVESKNNPAPFPSHQIMQT
A0A255R1S0      ------------------------------------------------MSSHSDEAQSDG
A0A0J1B4A0      --------------------------------MLFADQSIEFLKIMIRSNPSADDVNGDE
A0A1Z8N7H5      -------------------------MHLIDLLILGLALRRESRVSNEEGSLMSVETDNET
A0A2E2CCW9      --------------------------------------MNTDFQPLDQQSDFAIDGMEEN
A0A3C0AGX3      --------------------------------------MNTDFQPLDQQSDFAIDGMEEN
A0A0S8KNX5      ---------------------------MSDLEKYHDQVVGQQVVNFQIPPEPGRVGTSN-
A0A3D3UVZ8      ---------------------------MNELEKYHSQATGQEIVNLQIPPEQESEATSD-
A0A354PDV6      --------------------------------------MNREITST----GTDRQFNLND
M5TIT3          ---------------------------------------------------------MEE
F2AXG2          --------------------------------------MAESAKPTNRLPSRSPSNSTSD
M2BB46          --------------------------------------MAESAKPTNRLPSRSPSSSTSD
L7CLQ6          --------------------------------------MAESAKPTNRLPSRSPSSSTSD
A0A0J1B719      --------------------------------------MAESAKPTNRLPARGPSSASSD
Q7UF18          --------------------------------------MAESAKPTNRLPSRSPSSSTSD
A0A2G1W1E0      --------------------------------------MAESAKPTNRLPARGPSSSTSD
K5E235          --------------------------------------MAESAKPTNRLPARGPSSSTSD
A0A1U7CZ81      ---------------------------------MDTTDSNDSLLPARLPSSSSSHLPAMS
A0A142YNY8      ---------------------------------MDTSDRHDSTLPAR-SHTPSSGVPARA
A0A1U7GLS6      ---------------------------------MDTSDRPDSMLPAR-PTPPAPPVPSRG
E8R3W3          -------------MNPTDPVSAPPRDSHPSSPRPGTAMTRVAVDARPAKPALPPREEALA
A0A3D2TNK4      ------------------------------------------MTDLNTSADIQSNFEASA
A0A142WSB9      ------------------------------------------MTQPNPASANGNELAFAP
A0A2S8FKY2      ---------------------------MSNGNLVISSEKDRRRQGTNVPGTVVANRPQEE
A0A432MJP4      ---------------------------------------------MRLPDPQGSEADSTM
M5UQ35          ------------------------------------------------MTNQEDDIDGDD
A0A3A0DET7      MSAVRTLSRLTECRGNGRVLCGALFRLFGDGKPDGLPLPRHLATPSAKDPPPPMSSLIES
A0A2A2W9R6      ------------------------------------------MKRYQDETLEADD----A
A0A353FIP5      -----------------------------------------------MPIPTSNAP---E
A0A2E1VVJ1      ------------------------------------------MSTVSGSPPTGPDANTGA
A0A3M2AEL0      ------------------------------------------MDTFAAPPPEHDDQ---A
A0A351FYP6      ---------------------------------------------MEPTSRKENSSDKLH
A0A0S8J591      -------------------------------------------------MAVKRPERKMH
M5RT57          ---------------------------------------------------MGPRYLIHS
A0A1U9NL64      --------------------------------MNESFKTPQVNSSHEEANGDFEGREEGF
A0A1G2YPI3      -----------------METNNEFGQTEIVGHNMIDQQENNGHAGLANSHVGMPLPTQMM
A0A2E7ESJ6      ----------------------------MRHQTELHQPNQSSTDSPAHWGATSMDTVSSQ
A0A2E9VK20      ----------------------------------MKPSSDKNSRNVDTVHGHPLVKADEP
A0A3D4PJK1      ----------------------------------MKPSSDKNSRNVDTVHGHPLVKADEP
A0A142YJ13      -MGTPGPNALHAEELPTVLPRREEAVAHGEMMIPVDRIAQRSVAVPSNLEPAPGTTDAPD
A0A0S8GZ23      ------------------------------MDKLEKYQPQEITPNIDYLEADSAPKDSSI
A0A2D5AWU0      ---------------------------------------MSEIRIPQIEQSSSGGGESVD
L0DC26          ------------------MMLNSNPGPGADSVNLPAVVPPHRAEVLSVTPAHFESSASLD
A0A3L7P4E4      -------------------------------------------MSEFVPPSNPNVEPEEA
A0A3L7PEB5      -------------------------------------------MSEFV-TNSPNAEAEEA
A0A356KTN1      -------------------------------MQAPQTGLESDFGRSPTISDPLDAEDLRE
A0A2E2N5A9      -----------------------------------MTSKPPSIEHHLTAVPHGPAEAELD
A0A225EH48      --------------------------------MQRSSASEAQMPIPLTPAQPSGQQYASG
A0A1G2YQB7      -------------------------------MNSLTKFTENQIIMQKSNMIEPDNESETA
A0A353P687      -------------------------------MNTLTKYSDNHNLAQSGGMVYPTNEDGDP
A0A3L7SI46      MSSDFVEIQDSRLGGLSDLADDKVSAKLHFISHWLFRMNTNERLTSDLDSTANGPNLLGE
D5SZ21          ---------------------------------------------------------MQT
A0A432MFP3      ------------------MDTSETTRPQYELARLSDLPPALRAPLPPASRPASDGGGLPI
A0A257WS34      ------------------------------------------------MQQAHHSTVLSE
A0A2E8FLY0      --------------------------------------MSRPTDTPIDTSGEPRTATLTA
A0A3D2U1E1      -----------------------------------MSTDQSHPNRPLDETA-PQAATLTR
A0A1P8WP26      -----------------------------------MTTSQRQVNTVGAGGQDALAMTLHA
A0A3L7V1F3      -----------------------------------MSGPENQILGMQEQGQNTAASTLHL
A0A2E8B0L9      ---------------------------MSQTPELRAVSPPHSFDELHDPQ-DGAAEAVQA
A0A3M1VCL4      -----------------------------MTQDVPSLVLQQEASRAADLAAVPAINPLAS
A0A2E3GWX1      ------------------------------------MVSPEQYDLAAMPLPQETVNPLTT
F0SG60          ------------------------------------MVSPEQYDLAAMPLPQETVNPLTT
A0A2E9VST2      ------------------------------------MPAPENYDPQMNMHLQENHNPLQT
A0A356A6X2      ------------------------------------MPAPENYDPQMNIQLQDNHNALQT
A0A2E0SMM6      ---------------------------------MNPYLDQSSTNEKSGGHDNSTSAMMAR
A0A356EME5      -----------MSRRPDLSHSSLTERSAERAGPPAVSTSGMRPLNAPGVRKRTAGSSQEM
A0A355AI52      ------------------------------------------MLDHEKQELDSTAQSMRQ
A0A354PCQ3      -------------------------------------------------MPSSSAAQFDP
A0A2E7EGG1      ---------------------------------------MSASTKRRRIENLTQFEHDFS
A0A2E7K7A9      -------------------------------MNTEFQPLEPHSDLDFDGMEDSTTNASAP
A0A1N6DAJ8      -----------------------------------MMSNSNSGPRSDSANLPAVVPPYRT
A0A2S8G191      -------------------------------MSLNNANLPQESSKRDIRVDAPVELVTGH
A0A3L7NDH9      -----------------------------------MQENMSYSGSADGPHVDAMAQIVQN
A0A2E0X9P6      ----------------------------------MSHSAKEDHDYQLPAPRPPTEWTRQA
A0A2N1UCJ3      --------------------------------------MTDKKTNIENEAGSVEQMMSGT
M5UE94          -----------------------------------------MNDTAAPQPRSYPEQQETD
A0A2E0X4J3      --------------------------------MSPNSLVETDPFAPPVESRPGPPSAAGS
A0A1P8WN28      -----------------------------------------MDPYTLEQLDSTEPQGFHA
A0A3B9CTT0      -----------------------------------------MELEQPEQSASSQGNSLQG
A0A2D5NDU9      ----------------------------------------------------------MS
A0A286RGB6      ---------------------MTPEREAGMSEHQHLPAPVGQDRTGAARPSAPAPLYLDA
A0A1V5N3W2      ------------------------------MDSVVKYKPQPHPQEFVYTDVPPEAAPAAP
A0A3E0MY27      ---------------------MSNPIDPKKPSERPLDVVSERPGEGALPVPTSGKDAVFD
A0A286RLF2      ---------------------------------------MNESSWIQWAVPDSASHILHA
A0A286RD13      ----------------------MSDLVRVLGTSPPSTLASGNSVAPTPLQRETLHGPPKP
A0A3M1QRP3      -----------------------------MSDKPSRAQDESHALAAGEPLTPAAPFAATD
A0A2E3RCU8      ----------------------------------MSVETDDGAYELPLT---NAAGAIHD
A0A3E0MY88      ---------------------------------MSHAPDKLDLEAIGTLDDPSVSHIVHH
A0A1C3E6N1      --------------------------------------------------MMPEANTMQT
A0A3B8PNV4      ----------------------------------MSQSPDDRPIAAPNE---PQTATLAA
A0A3D1DR40      ----------------------------------MSQSPDDRPIAAPNE---PQTATLAA
A0A2E7RYU8      ----------------------------------MSPSPDDRPIAAPNE---PQTATLAA
A0A3B8LXG8      ----------------------------------MSPSPDDRPIAAPNE---PQTATLAA
F0SI78          ----------------------MTTLEAKHTPRWSARATEPKPTQNGSDWQFDSPTSSES
A0A350CI62      ------------------------------------MTDQDRILAGSQDGTNAAATTLHL
A0A3C1X4W5      ------------------------------------MTEQDRILTGSQDGQNAAATTLHL
A0A3D3W3A7      ------------------------------------MTEQDRILTGSQDGQNAAATTLHL
A0A2E7ENQ5      --------------------------------------MNERRALPPTAG--SQTHLVHT
A0A1G3AQE9      --------------------------------------MQEPAVVRDELESESTAHMVHR
A0A3L7UQT9      --------------------------------------MNSDVQQPAPAPILNTANVVAG
                                                                            

A0A2G2JCA2      SPQ-----------------------LV------------------LHALRRWW------
A0A286U4B3      LRD-----------------------YF------------------RVVMHRKW----V-
A0A1G2XVR0      IRK-----------------------YL------------------TTVLRRKW----I-
A0A1G3B0P0      IRK-----------------------YL------------------TTVLRRKW----I-
A0A1E3X4X0      LTD-----------------------YI------------------KIIQKRQW----V-
A0A1U9NNE1      LFK-----------------------II------------------KALLRRWY--I-V-
A0A1N6KFT7      LQNDLVA-------------------LW------------------D-VLKRGW--KFV-
L0DFG4          LQNDLIA-------------------LW------------------E-VMKRGW--KLV-
M5SZR3          L--DLKK-----------------------------------------VALRHK--SLI-
M5TW92          L--DLKK-----------------------------------------VALRHK--ALI-
A0A0S8FY64      F--DIRH-------------------HF------------------GVIRSRFW--TIV-
A0A2E3GW02      SDWQFDSPPSSESGFD----------IR------------------SIVWERKW--L-L-
A0A1I3DDV4      ATGSFD--------------------VV------------------EIFRRQLP--L-I-
A0A2E3GWC6      PEPTVD--------------------LV------------------QLALRNII--W-L-
F0SLB0          PEPTVD--------------------LV------------------QLALRNII--W-L-
A0A255R1S0      MEFDID--------------------VV------------------GILRRRYH--L-I-
A0A0J1B4A0      LDIDLD--------------------LL------------------GIVRRRYH--L-I-
A0A1Z8N7H5      YDAPLTNAAGAIHDGFQ---------FL------------------KVVWYRKN--SMI-
A0A2E2CCW9      AEINSSGPGVD---------------IV------------------RLLLRNKY--L-L-
A0A3C0AGX3      AEINSSGPGVD---------------IV------------------RLLLRNKY--L-L-
A0A0S8KNX5      --------------------------LL------------------AGIFRRWY--I-V-
A0A3D3UVZ8      --------------------------LV------------------AGILRRWY--I-V-
A0A354PDV6      QELSID--------------------IL------------------QVLSRQRW--L-I-
M5TIT3          LSDSID--------------------VL------------------EILSRQRW--A-I-
F2AXG2          GEETLD--------------------VL------------------QILSRQRW--L-I-
M2BB46          GEETLD--------------------VL------------------QILSRQRW--L-I-
L7CLQ6          GEETLD--------------------VL------------------QILSRQRW--L-I-
A0A0J1B719      GEETLD--------------------VL------------------QILSRQRW--L-I-
Q7UF18          GEETLD--------------------VL------------------QILSRQRW--L-I-
A0A2G1W1E0      GEETLD--------------------VL------------------QILSRQRW--L-I-
K5E235          GEETLD--------------------VL------------------QILSRQRW--L-I-
A0A1U7CZ81      AAN--RHAYDL--TTVSSSVQISPQGVL------------------RGLARNWW--RIL-
A0A142YNY8      ATNFGGGSREL--AVGASTMQVNPTSIL------------------RGLLRNWW--KIL-
A0A1U7GLS6      PASFGGGPRDLVPTSAAPALQVDPVSIL------------------RGLLRNWW--KIL-
E8R3W3          TTLELGD-------------------LL------------------RALRRRWL--MAA-
A0A3D2TNK4      ESELVPTIMR----------------LL------------------RMLMIRKK--T-I-
A0A142WSB9      PGLQASS------------LPGRSIDLV------------------RFVLSIWK--W-L-
A0A2S8FKY2      DGMQFGQ-------------------VL------------------HSLRRQWL--ASI-
A0A432MJP4      SDRPLASDTNPSAHLGAAELKH----LI------------------RVVRREWR--W-S-
M5UQ35          FELDLD--------------------VL------------------GILRRRYH--L-I-
A0A3A0DET7      DSFSVGEPTSYGAPHGRAARTGREVSPL------------------ALAWRNRW--L-L-
A0A2A2W9R6      AELSI-D-------------------LL------------------GIVRRRFH--L-I-
A0A353FIP5      PKVDFNE-------------------AI------------------GILWRRKV--Q-I-
A0A2E1VVJ1      KQIDVLE-------------------LL------------------SAILRHKA--L-I-
A0A3M2AEL0      VTLSLPR-------------------LL------------------GIFWHQRL--L-V-
A0A351FYP6      ILD-----------------------YW------------------RIIRVRIV--T-I-
A0A0S8J591      LTD-----------------------YL------------------WVLKRRVLLIL-F-
M5RT57          LTT-----------------------YW--------------------------------
A0A1U9NL64      QRS-----------------------LF------------------EVAWANRW--L-I-
A0A1G2YPI3      SES-----------------------LV------------------LILWRSRW--I-V-
A0A2E7ESJ6      GVD-----------------------VG------------------GILSRRKW--L-V-
A0A2E9VK20      AID-----------------------LV------------------KLALKN--------
A0A3D4PJK1      AID-----------------------LV------------------KLALKN--------
A0A142YJ13      LIG-----------------------LL------------------RALRRRWR--L-A-
A0A0S8GZ23      LHL-----------------------FQ------------------PVLRRWYW--V-L-
A0A2D5AWU0      AGR-----------------------LF------------------QALWRGKWYFL-L-
L0DC26          PIT-----------------------LL------------------RALRRRWA--L-A-
A0A3L7P4E4      GFD-----------------------LW------------------GFLCRRAW--L-G-
A0A3L7PEB5      GFD-----------------------FW------------------GFLWRRAW--L-G-
A0A356KTN1      ----------------------------------------------TLLGFKRRLPL-V-
A0A2E2N5A9      LRK-----------------------LW------------------MSVWLRKW--L-I-
A0A225EH48      FQP-----------------------SVPGQTLAPTAAARAWPTLPELVNALKR--R-L-
A0A1G2YQB7      --N-----------------------LI------------------AIMRKRWK--I-L-
A0A353P687      ALN-----------------------IL------------------TAVRKRWK--I-L-
A0A3L7SI46      AVR-----------------------FL------------------QVIRRKLP--T-L-
D5SZ21          LMR-----------------------FW------------------RSVQYRKG--L-I-
A0A432MFP3      NPR-----------------------LV------------------LRGLARHWWQA-L-
A0A257WS34      LMR-----------------------FL------------------HIVRLQMW--T-L-
A0A2E8FLY0      IAR-----------------------FL------------------QVVRIRKG--I-L-
A0A3D2U1E1      IVR-----------------------FL------------------HVVRVRKG--L-L-
A0A1P8WP26      IAR-----------------------FL------------------RTVRHRSG--I-L-
A0A3L7V1F3      MFR-----------------------FL------------------RTVRLRSG--I-L-
A0A2E8B0L9      VAK-----------------------FL------------------RVVYYRRS--Y-V-
A0A3M1VCL4      LLR-----------------------FA------------------HAVRMRKA--I-L-
A0A2E3GWX1      VIR-----------------------FL------------------QSMLRRKW--I-V-
F0SG60          VIR-----------------------FL------------------QSMLRRKW--I-V-
A0A2E9VST2      ILR-----------------------FV------------------QSLIRRKW--T-V-
A0A356A6X2      ILR-----------------------FL------------------QSLLRRKW--T-V-
A0A2E0SMM6      VMR-----------------------FL------------------RVIMLRKK--I-I-
A0A356EME5      SPR-----------------------FLLN----------------ALLHWWKV--A-M-
A0A355AI52      AVR-----------------------FL------------------RVLWHRRI--I-I-
A0A354PCQ3      WIL-----------------------WV------------------TFRRCWAW--A-L-
A0A2E7EGG1      LRM-----------------------FT------------------SVLIQWWR--I-L-
A0A2E7K7A9      GVD-----------------------IV------------------RLLFRNKY--L-I-
A0A1N6DAJ8      AEV-----------------------FSIAPAPVGTAAGLDPIALLKALRRRWP--L-A-
A0A2S8G191      AND-----------------------FLSNNDVESEELGGGGIGVSQILHALRR--R-W-
A0A3L7NDH9      SMR-----------------------FL------------------QVLWRRKH--L-L-
A0A2E0X9P6      VTA-----------------------SRPSRRADDSEGMPPDFVRRVLRNSWKW--A-I-
A0A2N1UCJ3      HRT-----------------------FA------------------VTLQRRRL--S-I-
M5UE94          LLD-----------------------LL------------------GILRRRKG--L-I-
A0A2E0X4J3      EVN-----------------------LL------------------AIAWRSRW--L-I-
A0A1P8WN28      LLR-----------------------FL------------------RVVNRHRM--I-L-
A0A3B9CTT0      LLR-----------------------FL------------------RVVNRHKL--I-I-
A0A2D5NDU9      FGQ-----------------------VL------------------AMLWRGRW--T-I-
A0A286RGB6      EWQ-----------------------PIPAAEAGQGFGAYL-----HAFRRRW-------
A0A1V5N3W2      LGL-----------------------F-------------------RALRRRWY--I-V-
A0A3E0MY27      AIQ-----------------------TS------------------TPARVRPE--I-LT
A0A286RLF2      IAQ-----------------------FL------------------VAVRRRWQ--I-M-
A0A286RD13      SDV-----------------------LH------------------AVRRRWWL--I-L-
A0A3M1QRP3      AID-----------------------VFAADSGEEREPQKLSLSPARILRFKWT--I-L-
A0A2E3RCU8      VFQ-----------------------FL------------------KIVWYRRN--S-M-
A0A3E0MY88      VVQ-----------------------FL------------------RVVRSRIN--I-L-
A0A1C3E6N1      LMR-----------------------FW------------------RSVQYRKG--L-I-
A0A3B8PNV4      IVR-----------------------FL------------------QVVRIRRG--I-L-
A0A3D1DR40      IVR-----------------------FL------------------QVVRIRRG--I-L-
A0A2E7RYU8      IVR-----------------------FL------------------QVVRIRRG--I-L-
A0A3B8LXG8      IVR-----------------------FL------------------QVVRIRRG--I-L-
F0SI78          GFD-----------------------IR------------------SIVWERKW--L-L-
A0A350CI62      LFR-----------------------FL------------------RTVRFRKG--I-L-
A0A3C1X4W5      IFR-----------------------FL------------------RTVRLRKG--I-L-
A0A3D3W3A7      IFR-----------------------FL------------------RTVRLRKG--I-L-
A0A2E7ENQ5      AMR-----------------------LF------------------RIIRHRRI--Q-V-
A0A1G3AQE9      LVQ-----------------------FA------------------VTVRHRKN--V-V-
A0A3L7UQT9      MIR-----------------------FL------------------HAVRVRRG--T-L-
                                                                            

A0A2G2JCA2      ----------------MIVIPIGMVLGSAGAAGLW-SRYEPVYKASAWLQIEE-------
A0A286U4B3      ----------------IVAIFTITVLL----VTLYTFKQKPIFQAVTTIRIF--------
A0A1G2XVR0      ----------------IIAFLVISGTY----STYKELTKIPYYTASTQVIIT--------
A0A1G3B0P0      ----------------IIAFLVISGTY----STYKELTKIPYYTASTQVIIT--------
A0A1E3X4X0      ----------------VILVFVVLVAT----VTISTIRMTPVYQAKARVLIEK-EERVNV
A0A1U9NNE1      ----------------LLTVVVLCAIG----IPAIFYMFKPSYETVGAIRVSP-------
A0A1N6KFT7      ----------------SLGLLVGLTLA----SIYL-AKTKRIYQASTSLLVIQ-------
L0DFG4          ----------------IFGLLVCLTLA----SIYL-AKTKRAYQASTSLLVIQ-------
M5SZR3          ----------------ALGIAIGLVIG----ALYY-AQSTPVFRSSAQVLIVR-------
M5TW92          ----------------ALGIAIGLVIG----ALYY-AQSTPVFRSSAQVLIVR-------
A0A0S8FY64      ----------------ACAVVL-FTVA----VLYT-FQATPIYEASARLLIER-------
A0A2E3GW02      ----------------IFFAALGAAIG----YLEF-TKQPPVYRSSASILVDR-------
A0A1I3DDV4      ----------------ACCTVLGLLMA----VIYW-ANAEKWYESSAKMLVTL-------
A0A2E3GWC6      ----------------IIAGAVGLGLG----IAAY-KALGPSYVAKSQILVKL-------
F0SLB0          ----------------IIAGAVGLGLG----IAAY-KALGPSYVAKSQILVKL-------
A0A255R1S0      ----------------ALGLLVGATLA----TIFY-VKQKPVYQSSLAVLVGQ-------
A0A0J1B4A0      ----------------ALGIFVGVTLA----TIYF-VNQVPIYESKLAVLVGQ-------
A0A1Z8N7H5      ----------------MVGFILAIIAG----WYAA--TATRYYQSSASILIVR-------
A0A2E2CCW9      ----------------VLGLAAGLLLG----QAAY-MKLGPIFSADTKIQVSQ-------
A0A3C0AGX3      ----------------VLGLAAGLLLG----QAAY-MKLGPIFSADTKIQVSQ-------
A0A0S8KNX5      ----------------LLILFVMCAAG----LPAIWFLIDPVYEVTGAVTIAP-------
A0A3D3UVZ8      ----------------LLILILICGSG----LPAVWFMVKPIYDVTGAVRVAP-------
A0A354PDV6      ----------------VFCSLMGMAAG----VLYS-IQSTVWYRSTAAILVNS-------
M5TIT3          ----------------VFLTLCGFTAG----VAYA-MYSQEWFESHAKILINQ-------
F2AXG2          ----------------AFLSIAGLAAG----VAYA-LNAQVWYESNAKVLINQ-------
M2BB46          ----------------AFLSIAGLAAG----VAYA-LNAQVWYESNAKVLINQ-------
L7CLQ6          ----------------AFLSIAGLAAG----VAYA-LNAQVWYESNAKVLINQ-------
A0A0J1B719      ----------------AFLSIAGLAAG----VAYA-LNAQVWYESNAKVLINQ-------
Q7UF18          ----------------AFLSIAGLAAG----VAYA-LNAQVWYESNAKVLINQ-------
A0A2G1W1E0      ----------------AFLSIAGLAAG----VAYA-LNAQVWYESNAKVLINQ-------
K5E235          ----------------AFLSIAGLAAG----VAYA-LNAQVWYESNAKVLINQ-------
A0A1U7CZ81      ----------------LLWAVVSAPLD----YLIY-SQIQPTYEAVSTIRAEP-------
A0A142YNY8      ----------------GLWLIASLPLV----YGIY-TQVKPTYIAYSVIRIEP-------
A0A1U7GLS6      ----------------GLWLILSAPLA----YLVY-SQVKPKYMAYSRIMVQL-------
E8R3W3          ----------------IVAPLTAVLAM----VVAYPLVIKERYSSEATLQLAL-------
A0A3D2TNK4      ----------------IISLYLFAVCG----VIYY-YFAVRLYESSAKILIDE-------
A0A142WSB9      ----------------ALGLFAGLTLG----VVSY-LIMGPVYRASTRVQVSK-------
A0A2S8FKY2      ----------------VLGLLVAVPVA----IAAW-VLQSPTYTSSAYLRISS----NDQ
A0A432MJP4      ----------------AVGLAVCLTAA----AIYL-VRTPRMYQATARVLVLE--TGRQP
M5UQ35          ----------------ALGVFVGALLA----CLFY-VKQVPVYQSNLAVLVGHRSADLNR
A0A3A0DET7      ----------------LLTTLVGGGAA----WATV-QRVTPRYTSVSRLYVER-------
A0A2A2W9R6      ----------------MLGVLVSVTGA----TVYF-VQQKPVYESKLAVLVGQLSSEMAS
A0A353FIP5      ----------------ALITVIAACVA----FLVA-VTRTPSFEAEGRVLLEE-------
A0A2E1VVJ1      ----------------VLCTLLSSAAV----MFYS-ATKEPVFNAEGRVALDS-------
A0A3M2AEL0      ----------------TSLLILGAVLG----FFLS-MLVPPRFAAEATVLLRP-------
A0A351FYP6      ----------------LLVFLLTAITT----TVVT-FLIPKTYMSLSRIAVEK-------
A0A0S8J591      ----------------FWGLVFASV------VVAT-FMQQPLYRAYARIEIER-------
M5RT57          ----------------YLTIPLAIVLAGLSATAVL-MTFTPVYRATAVMKIAS-------
A0A1U9NL64      ----------------LATTILSLTAA----FIYL-AKATPIFTSSSRVYVEQ-------
A0A1G2YPI3      ----------------LLTTVAVLAAA----LIYV-TKVTPVYTSTSRIYVEQ-------
A0A2E7ESJ6      ----------------ILGFMLGLGLG----YVYM-LQATPRYESVAQILIED-------
A0A2E9VK20      ----------------VVTLGIAAAAGIGLGIFAY-KILGPKYTASSQILVKL-------
A0A3D4PJK1      ----------------VVTLGIAAAAGIGLGIFAY-KILGPKYTASSQILVKL-------
A0A142YJ13      ----------------FLGGLSCASLAAA--AAFY-YLPSPKYTTSSLVHVAE-------
A0A0S8GZ23      ----------------VIFILVSAVGA----PIIW-HVKRPIYTTSGTIHIRP-------
A0A2D5AWU0      ----------------FPAIAGGGM------YYFL-HGQKNLYRSTAQVQVAP-------
L0DC26          ----------------FGTGLLGAAVIAT--LTFY-LVPPAKYMARAMLHVNS-------
A0A3L7P4E4      ----------------FFFGTIGATAA----YYYY-LRQPVVFKATSQILITK-------
A0A3L7PEB5      ----------------FLFGTIGATAA----YYYY-LRQPVVYKATSQVLVIK-------
A0A356KTN1      ----------------IGVTLFFGVAA----GVRS-SNLPTVYASTARLQLAK-------
A0A2E2N5A9      ----------------LGVMLFAALAA----AWAT-SWMTPLYRAGATLLVES-------
A0A225EH48      ----------------VLATFLGMLVGMAAAAAVW-LALPSGKHTAMALIQLK-------
A0A1G2YQB7      ----------------TVTAIIICGIGL---PLIW-LLVKPYYLATAAIRVAP-------
A0A353P687      ----------------LFTMIIICSIGL---PAVW-MFIKPFYLATAAIRVAP-------
A0A3L7SI46      ----------------LVCTILGGVIG----TAWY-VTATRKYESVSEIMVLK-------
D5SZ21          ----------------ILAVLAASALG----AAYY-IVSTRYYESKAELLILQ-------
A0A432MFP3      ----------------ALWVVGSAALA----ALVY-LKFQPTYRSFSLLQIER-------
A0A257WS34      ----------------ILTVAVTGILG----GIYY-MTADRVYDSSADVLVLQ-------
A0A2E8FLY0      ----------------FSTLFISTILG----GLYF-ATATRLYESKARLYVLQ-------
A0A3D2U1E1      ----------------FASVFVAVLLA----GLYY-ATAPRLYESSSRLYVLQ-------
A0A1P8WP26      ----------------LLCLVVSGALG----TLYY-VTAPRIYQSKASLFVVQ-------
A0A3L7V1F3      ----------------VATLVISSIAG----ATYF-ITAQRIYQSNASLYIVR-------
A0A2E8B0L9      ----------------ITCVVVSALLG----GLYY-YRASRVYAATASLLITQ-------
A0A3M1VCL4      ----------------LGTLLIAAVFG----ALYY-LTATRYYASNARLLVLQ-------
A0A2E3GWX1      ----------------MGWLTITVGLG----ITYF-VLAPRLYESSAELLILH-------
F0SG60          ----------------MGWLTITVGLG----ITYF-VLAPRLYESSAELLILH-------
A0A2E9VST2      ----------------MAWLTLTISLG----MTYF-ALATRKYESSAELLVLH-------
A0A356A6X2      ----------------MAWLTFTVSLG----MTYF-ALAPRKYESSAELLVLH-------
A0A2E0SMM6      ----------------VVCVILTSIAG----AYWY-STQTPMYQSTAQLLVLS-------
A0A356EME5      ----------------PVGLILAAVAV----AGVW-WFFEPVFLSRALIQIRE-------
A0A355AI52      ----------------MSTLALCGMLG----GLYY-ATAARIYEAKAQLLIVD-------
A0A354PCQ3      ----------------PIGALLAGLAA----FFVL-RNFVPIYRASSLLEANQ---DYVV
A0A2E7EGG1      ----------------IPVTLFALLIST---VFVF-WSFRPQYRASAWLQING-------
A0A2E7K7A9      ----------------VGGLLAGLLLG----QAAY-MKLGPVFSANTKIQVSQ-------
A0A1N6DAJ8      ----------------VGAGLLGGVVL--AVVTYF-VVPPAKYTARSMLHVNS-------
A0A2S8G191      ----------------LPAFSIGIVLATAGVALAW-VLDVPEYTTRAMLRISS-------
A0A3L7NDH9      ----------------VASCAAAGLLG----GLYY-TTSKRTFEAEASILIVG-------
A0A2E0X9P6      ----------------PLGLLLAAAAG----CAVM-YLHVPKYQASALIQIES-------
A0A2N1UCJ3      ----------------LITAVLFVAAA----ILYL-IKAEPLYTSTARLYVEQ-------
M5UE94          ----------------ALGLFIGVAAA----VLYY-VLTPPTFRAEMEILVGQ---KSGD
A0A2E0X4J3      ----------------LLFMILGGAVS----WVLL-QRATPRYTSFSKLYVER-------
A0A1P8WN28      ----------------VGLVAAAAFLA----VVRH-KQIPKQYESTARLMVRQ-------
A0A3B9CTT0      ----------------VGFVAAACFLA----VVKH-NRQPQIYEAGTKMLVRQ-------
A0A2D5NDU9      ----------------LATTLVVTLAA----FIYG-EVTGSRWRAESRLFINA---GVNA
A0A286RGB6      ----------------LAVAFLGMLCGAAAAAAAW-FLFIPQYTATALIRVSS-------
A0A1V5N3W2      ----------------FLVFVLLAGAGL---PAVW-FLVKPKYQAAAAIRVAP-------
A0A3E0MY27      APPKPMDLLRALQRRWLLAFVLGCMLGIPAAVITW-FVVPIEYTAEAFLQFND-------
A0A286RLF2      ----------------LGAFLAVALLG----ALYY-ATAPRIYSAKAELLILQ-------
A0A286RD13      ----------------IMGVLASAGVM----VFAW-RTIPVEYTATAWLQVSL-------
A0A3M1QRP3      ----------------VVFAAVCASAL----AGVW-IFVEPQYRSIAQIEVRP------Q
A0A2E3RCU8      ----------------LVVGIVCAIVA----AWYA-ATATRYYQSSTSVLIVQ-------
A0A3E0MY88      ----------------IIAIVVSSLLG----GLYY-ATATRYFQANASVLIIR-------
A0A1C3E6N1      ----------------ILAVLAASALG----AAYY-IVSTRYYESKAELLILQ-------
A0A3B8PNV4      ----------------FCTLFISIVLG----GLYF-ATATRLYESKARLYVLQ-------
A0A3D1DR40      ----------------FCTLFISIVLG----GLYF-ATATRLYESKARLYVLQ-------
A0A2E7RYU8      ----------------FCTLFISTVLG----GLYF-ATATRLYESKARLYVLQ-------
A0A3B8LXG8      ----------------FCTLFISTVLG----GLYF-ATATRLYESKARLYVLQ-------
F0SI78          ----------------IFFAALGAAIG----YLEF-TKQPPVYRSSASILVDR---YQPR
A0A350CI62      ----------------VASLVMSTILG----MTYY-ITAERIYESTASLYVVR-------
A0A3C1X4W5      ----------------VAALVMSTILG----MTYY-ITAERIYESTASLYVVR-------
A0A3D3W3A7      ----------------VAALVMSTILG----MTYY-ITAERIYESTASLYVVR-------
A0A2E7ENQ5      ----------------VSCLVATALLG----ALYY-CTAAPLYSARVSLMMMY-------
A0A1G3AQE9      ----------------ILALAVAAFLG----ALSY-MTATRYYSASAGVWVLE-------
A0A3L7UQT9      ----------------LAALLISASLG----AAYY-LTATRMYDAHAQVRIVQ---SERN
                                                                :           

A0A2G2JCA2      --------VSPYLAFQDRSDSRKFVANQVALMRSHIVLGSV---V---------------
A0A286U4B3      --KEAPKVLSFEEVMSTEGGRTDFYKTECEVLKSLTLAKRV---V---------------
A0A1G2XVR0      --QNTPKGLTFQA-FSFEGNNSSSFTTNERILRSRSLAQKV---L---------------
A0A1G3B0P0      --QNTPKGLTFQA-FSFEGNNSSSFTTNERILRSRSLAQKV---L---------------
A0A1E3X4X0      TGKDIQEVVTYDP-YATRGE---FYKNQHEILKSRSLAKRV---I---------------
A0A1U9NNE1      --ILPNVLFDDAETQDVMPNYQGFMNTQAELMSSNEILNRVAEDM---------------
A0A1N6KFT7      HGGRPLNVSAYTDPNRISEGSEDPVPTHMVLIRSPLVIQAA---V---------------
L0DFG4          HGGRPLNVTAYTDPNRINEGSEDPVPTHMVLIRSPLVIQTA---V---------------
M5SZR3          ---KTPNT----EIKGQNAFYNDYMSTHQALIKSSVIISRA---S---------------
M5TW92          ---KTPNT----EIKGQNAFYNDYMSTHQALIKSSVIISRA---S---------------
A0A0S8FY64      ---RAPQVSPFEDMQERRD--KEYFATQVSLITSRAVLDKA---L---------------
A0A2E3GW02      -----YQPRMPIEGIDPLSGQTDPLSTHIALFNTPVILKKA---V---------------
A0A1I3DDV4      KDMRASDKGESSWAADGVQD--EILANHMEIVSSRRIIGNA---L---------------
A0A2E3GWC6      ---KTSVPLGDDDNRPTAGE----RSAHVEIIRSPRVIERA---V---------------
F0SLB0          ---KTSVPLGDDDNRPTAGE----RSAHVEIIRSPRVIERA---V---------------
A0A255R1S0      RSSQLATTGVREASDNAVTIQDKILSTHIALMTSPKVLGQA---A---------------
A0A0J1B4A0      RSGEVANTGVNNGAKDMASMQEDVLSTHMELFASPKILENA---I---------------
A0A1Z8N7H5      -----NGMSQEDSALGINRNSQHLMPTHQQLIVSQPVLENA---IQYISPE---------
A0A2E2CCW9      ----KNPVPIKEGEIQTFGE----LTAHIDVIKSPRIVGEA---V---------------
A0A3C0AGX3      ----KNPVPIKEGEIQTFGE----LTAHIDVIKSPRIVGEA---V---------------
A0A0S8KNX5      ---IMADILTDVPDSGEISNYSSFMNTQAEMITSSRVVRRV---A---------------
A0A3D3UVZ8      ---ILADILSGEQDRGEISNYESFMNTQAEKITSNSVVQRV---A---------------
A0A354PDV6      ---KNAGLESNAT--NVVEE--DILANHMQMLRSRKIVEGA---L---------------
M5TIT3          ---KSAGLEGDSTGQAIVDE--DILANHIELIQSRMIVGEA---L---------------
F2AXG2          ---ASAGLGGDSTGTDMVDE--DILANHMELLLSRKIVGEA---L---------------
M2BB46          ---ASAGLGGDSTGADMVDE--DILANHMELLLSRKIVGEA---L---------------
L7CLQ6          ---KSAGLGGDTTGTDMVDE--DILANHMELIQSRMIVGEA---L---------------
A0A0J1B719      ---KSAGLGGNSTGTDMVDE--DILANHMELIQSRMIVGEA---L---------------
Q7UF18          ---KSAGLGGNSTGTDMVDE--DILANHMELIQSRMIVGEA---L---------------
A0A2G1W1E0      ---KSAGLGGNSTGTDMVDE--DILANHMELIQSRMIVGEA---L---------------
K5E235          ---KSAGLGGNSTGTDMVDE--DILANHMELIQSRMIVGEA---L---------------
A0A1U7CZ81      ---TQLSLYGQQNSNAQAQPIERFIGTQIAFITTNTVLKPA---I---------------
A0A142YNY8      ---TQPELFGSSSRGDGSSSIERIIETARAALISDRVLNGA---I---------------
A0A1U7GLS6      ---TQPDLFGGIAPGQANERTV-AIETEMGRIRTDRVINDA---L---------------
E8R3W3          -----FGRSIVFNNGVSMGDAHAYMRTQSQLLRSPIVVEDA---L---------------
A0A3D2TNK4      ---KNQDRVATVGDQSIVSN---ILDTHSDLVTSPVVIEQA---IEYLAPE---------
A0A142WSB9      ----KASLPINSQEARRYSD----RSQHVHFLTSDAIAAIA---I---------------
A0A2S8FKY2      PLAFKTIEQTNRNDYRTFKN------TQRQLMVTPFVLNSA---L---------------
A0A432MJP4      LKVTEADAGGGEGGVDRFPT-------YAAILSSPHIVGRA---I---------------
M5UQ35          ASSSSLLEGATTIEDVILST-------HMELFRSRKVIERA---I---------------
A0A3A0DET7      -----ALPRVLESEAPVVQS-ATYLYTQAELIRSTPVLAAA---A---------------
A0A2A2W9R6      TGVRGTSDGAVTMQDEILST-------HIELFGSPKVLQQA---I---------------
A0A353FIP5      ----GSAVGGILGDLSMLSS-APPATAELEVLQSRMIVDPV---V-------APQSESSL
A0A2E1VVJ1      ----GGFQSGFLSEVAVLSPVQPPESKEAEILGSRKLVRMV---AAHPLSTDGPEFAQGL
A0A3M2AEL0      ----EGSEQSLLREFTLFEQ-SPATLAEMEVLGSRAVAQAV---A---LPKGESDLAPEV
A0A351FYP6      --DTSDIAPLLGMQATQSSFDPYFISTEFEKIQSQKVLDEV---V---------------
A0A0S8J591      ----SVDTPDVIEAGARRMATEEFYNSQVENLRSRRIARKL---Y---------------
M5RT57          -YAPFIAYTTPEPQMNP----EDFTETQIELIRSSLVAEQV---L---------------
A0A1U9NL64      -SGPKILDETQGVMTQS----KNYLYTQAELMKSTPIIKEA---I---------------
A0A1G2YPI3      -SGPKIFAETQEGVMTQ---SKNYLYTQAELLKSTPILTAV---L---------------
A0A2E7ESJ6      -KQPPTIPLTGVESQYI---TTSAEAKHAIVIVSPRILTQA---F---------------
A0A2E9VK20      -------KSPIEIREEGNRIIAGERSAHVEIIRSPKVVERA---V---------------
A0A3D4PJK1      -------KSPIEIREEGNRIIAGERSAHVEIIRSPKVVERA---V---------------
A0A142YJ13      -KRPREIFETRESDVGY----RTYQETQLILVKSRKVLEAA---I---------------
A0A0S8GZ23      -LVADLLTGAHESGGIS--NYDIYVNTQAQIIRDNRVLQNV---A---------------
A0A2D5AWU0      -REVDPLNGNAGSTGKA----RTLLKQQQILVKSPAILKPL---S---------------
L0DC26          -VKPRILLQTGEVQSDY----GSYQRTQLALLESRLVLSAA---L---------------
A0A3L7P4E4      -QQAEMPVNTVNGLAPN--GRSDPLASDIQTIMSELTVRPA---I---------------
A0A3L7PEB5      -QQADMPVNSVNGFDPS--GQSDPLASDVRLILSEVTVGPA---I---------------
A0A356KTN1      -EAPDPTRARYEMYSSD-YVATEYLNTQMRILESHSLAVDA---V---------------
A0A2E2N5A9      -ERAKLLAIEQANQNET--LNNDFLQTEIELLKSRGLAERV---V---------------
A0A225EH48      ----PIVSAGKQSMGED---FESFKQTQMRLLKTRMLLDRV---V---------------
A0A1G2YQB7      -VISSILFGGEEAIPMY----RSYMYTQADLIISDRVLQRV---V---------------
A0A353P687      -VISSILFGGEEGIPMY----RNYMYTQADLITSDRVLQRV---V---------------
A0A3L7SI46      -TDGNVLDTTNQSNQRS---IQDIMPTYQKVLTSDRVLEGA---I---------------
D5SZ21          -TGSKVLDGAPEG-AA----MKDLMPTYERIMQGDIVLADA---A---------------
A0A432MFP3      -NQANPYGSLEDP-RS-----IEYLQTQIQLITSPRVLSVA---K---------------
A0A257WS34      -TNGNALDGKDNN-QQS---IQNLMPTYQKVLLSDAVIEGA---I---------------
A0A2E8FLY0      -MGSNVLKTEQEN-QGG---VQENMATNQGVLTSDVVLEEA---L---------------
A0A3D2U1E1      -MGSNVLQESMES-QGG---VRENMANYQGVLTSDLVLEEV---L---------------
A0A1P8WP26      -IGSGVTQDSVQG-ASD---PSRSMPTFRRLMADDEVMRRA---L---------------
A0A3L7V1F3      -KGGNVTEETPNS-GSS---ANSDMPTFIELMSRDEVIVRA---L---------------
A0A2E8B0L9      -TGTDILNSTMMP-NAQ---QDALIPTYERLFSSAVVLDGA---I---------------
A0A3M1VCL4      -TNASVLQEQQST-PRA---VLDQLPTLQEVVVSDRVLEDA---I---------------
A0A2E3GWX1      -TGEGNMDETQQS-QRT---LQDHLPTYTKVLSSEEVLKGT---L---------------
F0SG60          -TGEGNMDETQQS-QRT---LQDHLPTYTKVLSSEEVLKGT---L---------------
A0A2E9VST2      -TGEGNVDQTQQS-QRT---LQDYLPTYTKVLASDEVLKGA---L---------------
A0A356A6X2      -TGDGNVDQTQQS-QRT---LQDYLPTYTKVLASDEVLKGA---L---------------
A0A2E0SMM6      --NGGFDTDDVSGQALL---KNQM-PTYTRLLSSDHVLQSA---A---------------
A0A356EME5      -NPPALVFAIEDKSSGY-------VETQKEMIRSARVLRPV---V---------------
A0A355AI52      -TSRENNPTSMTGSHND---VAAM-ATYEKLVSSPLVLQSASTLL---------------
A0A354PCQ3      FQGVMPV-------------VKNLAQTEKALFLNPIVLGPV---L---------------
A0A2E7EGG1      -VQPYVAFPDREVRDRD--SNRKFVHTQVELLRSPLILGRV---L---------------
A0A2E7K7A9      KNPVPIKEGEVQTFGEL--------TAHIDVIKSPRIVGQA---V---------------
A0A1N6DAJ8      -TQPRILLKVGENESDY---VAYQ-RTQLALLKSRLVLSTA---L---------------
A0A2S8G191      -SQGSLLKQDGEKTGDF----DVYKLTHRQLLRGPFVINAA---L---------------
A0A3L7NDH9      -SQGDSLDTSLTGGRND---PTAM-ATYEKLIASPLVLESA---A---------------
A0A2E0X9P6      -KVPFVAFEQPSTVRDE---ARYF-NTQIELLRGTVVLIPL---L---------------
A0A2N1UCJ3      -TGPKLIADYEGTMTQS---KNYL-YTQSEIIKSTPIIAKV---V---------------
M5UE94          LVRGANSSSSVEGVDTK---EDVL-STHIQLFSSRRILKSA---I---------------
A0A2E0X4J3      -NMPQIIDSGMGLSQ-----SKGFLYTQAEMLRSTPVLAAA---L---------------
A0A1P8WN28      -----VSADPKSQSNSA---TEGLLASYRQLLLSDRVLTDTVKEL---------------
A0A3B9CTT0      -----TGSD-MANFGAP---LEAAMAGYKHLMLSDKSLTQTAENL---------------
A0A2D5NDU9      KAGPEVMALGFGATNYA--------QTQAEVIVSGEILRSA---L---------------
A0A286RGB6      -SVQSVLFPTQQGAGPS---FDIYKATQLEYLRSRFVLVAA---L---------------
A0A1V5N3W2      -IIPSILFSDKDSEGVIPMYESFM-NTQADIIVSDQVIQRV---A---------------
A0A3E0MY27      -EEVIIDAQSRSDGRRI---DDPL-QTHIQLIKSPFVINTA---L---------------
A0A286RLF2      -TGDNALSPTIEAQGSR---ENSLIPTFVNLITSAKVLEGA---I---------------
A0A286RD13      -ERPRVLFDTKDDDP-L---LRNR-QTQTTLVTSNRVLTAA---L---------------
A0A3M1QRP3      RDMIAFKTDNDGITHFY---QQFL-TTQIHKITSARVIERV---L---------------
A0A2E3RCU8      -NGSADHGNVLGVNRND---QQLM-PTHQQLIVSQPVLENA---I---------------
A0A3E0MY88      -NGGSEGSSSMGIDGEN---RRYM-PTHEQLLKSAVVLSG----V---------------
A0A1C3E6N1      -TGSKVLDGAPEGAA-M---KDLM-PTYERIMQGDIVLADA---A---------------
A0A3B8PNV4      -MGSNVLQNDQENQGGV---QENM-ATNQGVLTSDVVLEEA---L---------------
A0A3D1DR40      -MGSNVLQNDQENQGGV---QENM-ATNQGVLTSDVVLEEA---L---------------
A0A2E7RYU8      -MGSNVLQNDQENQGGV---QENM-ATNQGVLTSDVVLEEA---L---------------
A0A3B8LXG8      -MGSNVLQNDQENQGGV---QENM-ATNQGVLTSDVVLEEA---L---------------
F0SI78          MPIEGIDPLSGQTDP--------L-STHIALFNTPVILKKA-------------------
A0A350CI62      -KGSGVTSDATSNSANP---VTEM-PTYIALMSEEEVIARA---L---------------
A0A3C1X4W5      -KGSGVTADATSTSANP---VTEM-PTYIALMSEEEVIARA---L---------------
A0A3D3W3A7      -KGSGVTADATSTSANP---VTEM-PTYIALMSEEEVIARA---L---------------
A0A2E7ENQ5      ---HGGEDSLTGSDTYR---RGML-PTYERLFYSSVVLEQAAARI---------------
A0A1G3AQE9      ---LGSSSAGSVEDNLH---QTQL-PTQVDIVRSDKVLDAA---V---------------
A0A3L7UQT9      HDSLTSSPQSSQANSDV---FQMM-ATYQRIMSGDRVLSAA---L---------------
                                               .                            

A0A2G2JCA2      ------------------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A1N6KFT7      ------------------------------------------------------------
L0DFG4          ------------------------------------------------------------
M5SZR3          ------------------------------------------------------------
M5TW92          ------------------------------------------------------------
A0A0S8FY64      ------------------------------------------------------------
A0A2E3GW02      ------------------------------------------------------------
A0A1I3DDV4      ------------------------------------------------------------
A0A2E3GWC6      ------------------------------------------------------------
F0SLB0          ------------------------------------------------------------
A0A255R1S0      ------------------------------------------------------------
A0A0J1B4A0      ------------------------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A2E2CCW9      ------------------------------------------------------------
A0A3C0AGX3      ------------------------------------------------------------
A0A0S8KNX5      ------------------------------------------------------------
A0A3D3UVZ8      ------------------------------------------------------------
A0A354PDV6      ------------------------------------------------------------
M5TIT3          ------------------------------------------------------------
F2AXG2          ------------------------------------------------------------
M2BB46          ------------------------------------------------------------
L7CLQ6          ------------------------------------------------------------
A0A0J1B719      ------------------------------------------------------------
Q7UF18          ------------------------------------------------------------
A0A2G1W1E0      ------------------------------------------------------------
K5E235          ------------------------------------------------------------
A0A1U7CZ81      ------------------------------------------------------------
A0A142YNY8      ------------------------------------------------------------
A0A1U7GLS6      ------------------------------------------------------------
E8R3W3          ------------------------------------------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A142WSB9      ------------------------------------------------------------
A0A2S8FKY2      ------------------------------------------------------------
A0A432MJP4      ------------------------------------------------------------
M5UQ35          ------------------------------------------------------------
A0A3A0DET7      ------------------------------------------------------------
A0A2A2W9R6      ------------------------------------------------------------
A0A353FIP5      GLNLTLRVDDLDRYSPWKLVRRKLA-GKTLDGALSGELALPIARQNSAPVTVTFHSSNSG
A0A2E1VVJ1      GIGLSIKVDDFDRYWPEASILRRFTGGSVPNGSLEMELLQPYTDPWTHRIELEFLAEGEV
A0A3M2AEL0      GLGLSVTVDDVDRNWPWPAVLRKLGRGEEPTGSLRVEVEQLPRDLTYRAWRIHFSSPEVV
A0A351FYP6      ------------------------------------------------------------
A0A0S8J591      ------------------------------------------------------------
M5RT57          ------------------------------------------------------------
A0A1U9NL64      ------------------------------------------------------------
A0A1G2YPI3      ------------------------------------------------------------
A0A2E7ESJ6      ------------------------------------------------------------
A0A2E9VK20      ------------------------------------------------------------
A0A3D4PJK1      ------------------------------------------------------------
A0A142YJ13      ------------------------------------------------------------
A0A0S8GZ23      ------------------------------------------------------------
A0A2D5AWU0      ------------------------------------------------------------
L0DC26          ------------------------------------------------------------
A0A3L7P4E4      ------------------------------------------------------------
A0A3L7PEB5      ------------------------------------------------------------
A0A356KTN1      ------------------------------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A225EH48      ------------------------------------------------------------
A0A1G2YQB7      ------------------------------------------------------------
A0A353P687      ------------------------------------------------------------
A0A3L7SI46      ------------------------------------------------------------
D5SZ21          ------------------------------------------------------------
A0A432MFP3      ------------------------------------------------------------
A0A257WS34      ------------------------------------------------------------
A0A2E8FLY0      ------------------------------------------------------------
A0A3D2U1E1      ------------------------------------------------------------
A0A1P8WP26      ------------------------------------------------------------
A0A3L7V1F3      ------------------------------------------------------------
A0A2E8B0L9      ------------------------------------------------------------
A0A3M1VCL4      ------------------------------------------------------------
A0A2E3GWX1      ------------------------------------------------------------
F0SG60          ------------------------------------------------------------
A0A2E9VST2      ------------------------------------------------------------
A0A356A6X2      ------------------------------------------------------------
A0A2E0SMM6      ------------------------------------------------------------
A0A356EME5      ------------------------------------------------------------
A0A355AI52      ------------------------------------------------------------
A0A354PCQ3      ------------------------------------------------------------
A0A2E7EGG1      ------------------------------------------------------------
A0A2E7K7A9      ------------------------------------------------------------
A0A1N6DAJ8      ------------------------------------------------------------
A0A2S8G191      ------------------------------------------------------------
A0A3L7NDH9      ------------------------------------------------------------
A0A2E0X9P6      ------------------------------------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
M5UE94          ------------------------------------------------------------
A0A2E0X4J3      ------------------------------------------------------------
A0A1P8WN28      ------------------------------------------------------------
A0A3B9CTT0      ------------------------------------------------------------
A0A2D5NDU9      ------------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A1V5N3W2      ------------------------------------------------------------
A0A3E0MY27      ------------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A286RD13      ------------------------------------------------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A2E3RCU8      ------------------------------------------------------------
A0A3E0MY88      ------------------------------------------------------------
A0A1C3E6N1      ------------------------------------------------------------
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
F0SI78          ------------------------------------------------------------
A0A350CI62      ------------------------------------------------------------
A0A3C1X4W5      ------------------------------------------------------------
A0A3D3W3A7      ------------------------------------------------------------
A0A2E7ENQ5      ------------------------------------------------------------
A0A1G3AQE9      ------------------------------------------------------------
A0A3L7UQT9      ------------------------------------------------------------
                                                                            

A0A2G2JCA2      ---------------------------SNKDVSSTPELKNS-------------------
A0A286U4B3      -------------DSLRLDLDPEFIGNSKA-----------------------------L
A0A1G2XVR0      -------------STMDYKDSPEFNPVKKANIFSIK---------------------ELT
A0A1G3B0P0      -------------STMDYKDSPEFNPVKKANIFSIK---------------------ELT
A0A1E3X4X0      -------------EELKLGNGP-----------------------------------ELP
A0A1U9NNE1      -------------AKR------------GIRICEPD------------------------
A0A1N6KFT7      -------------D--------------SLGSNTPT------------------------
L0DFG4          -------------E--------------SLGPKKTP------------------------
M5SZR3          -------------Q--------------------LP------------------------
M5TW92          -------------Q--------------------LP------------------------
A0A0S8FY64      -------------E--------------------DD------------------------
A0A2E3GW02      -------------E--------------DFRLGELSSI----------------------
A0A1I3DDV4      -------------Q--------------RVNAEEMPGIKA--------------------
A0A2E3GWC6      -------------H--------------ESHLDKLP------------------------
F0SLB0          -------------H--------------ESHLDKLP------------------------
A0A255R1S0      ------------------------------------------------------------
A0A0J1B4A0      ------------------------------------------------------------
A0A1Z8N7H5      ------------------------------------------------------------
A0A2E2CCW9      -------------K--------------EARLNQLP------------------------
A0A3C0AGX3      -------------K--------------EARLNQLP------------------------
A0A0S8KNX5      -------------DDLADRNLPFLEDEPTDPISKLKR-----------------------
A0A3D3UVZ8      -------------DDLVGKNLFFFEAEPNDLVSNWKR-----------------------
A0A354PDV6      -------------T--------------KDGLMDLASIQP--------------------
M5TIT3          -------------E--------------QSNLMALPSIVE--------------------
F2AXG2          -------------DPEDVKDEETGELIKREKLIDLPSVLP--------------------
M2BB46          -------------DPEPVKDEETDELIKREKLIDLPSVLP--------------------
L7CLQ6          -------------E--------------QTKLLDLPSILQ--------------------
A0A0J1B719      -------------E--------------QNELLDLPSIET--------------------
Q7UF18          -------------E--------------QTELVNLPSIES--------------------
A0A2G1W1E0      -------------E--------------QTELVDLPSIES--------------------
K5E235          -------------E--------------QTELLDLPSIES--------------------
A0A1U7CZ81      -------------G--------------DSTVAELP------------------------
A0A142YNY8      -------------I--------------DPQVSGLP------------------------
A0A1U7GLS6      -------------G--------------DATVSELP------------------------
E8R3W3          -------------K--------------DEKYKGLK------------------------
A0A3D2TNK4      ------------------------------------------------------------
A0A142WSB9      -------------E--------------KYGLKDIP------------------------
A0A2S8FKY2      -------------S--------------REDIMSLD------------------------
A0A432MJP4      -----------------------------------------------------EQVGVEN
M5UQ35          ------------------------------------------------------------
A0A3A0DET7      -------------D--------------APENANLE------------------------
A0A2A2W9R6      ------------------------------------------------------------
A0A353FIP5      VATSGKI------L--------------RQQSKAFSL-ANSPLVEIADTKIRLFPEGDLT
A0A2E1VVJ1      LARSSRI------A--------------EPETIRFDPNDTEPIVTMFGRRYKLMITGTLS
A0A3M2AEL0      EVLPDSLWAAVLPG--------------RKQVVRLD--DGKPL-ELAGARIRLIPDGDLS
A0A351FYP6      -------------KSC---ELREKWKKHYGGKQLTD------------------------
A0A0S8J591      -------------NDM---GMYNWEYFRKLGPDRDP------------------------
M5RT57          -------------DDS---EIAE-----LPGLQSIE------------------------
A0A1U9NL64      -------------EEN---DMAS-----MRTFDEID------------------------
A0A1G2YPI3      -------------DTA---GIQQ-----MQTFSEVD------------------------
A0A2E7ESJ6      -------------DNF---NLFR-----LPTFKDDP------------------------
A0A2E9VK20      -------------RDS---QLDQ-----LATLAGSE------------------------
A0A3D4PJK1      -------------RDS---QLDQ-----LATLAGSE------------------------
A0A142YJ13      -------------APP---AIAA----LPIVRNSVD---------------------P--
A0A0S8GZ23      -------------DVL---DDNN-------TLLGTG------------------------
A0A2D5AWU0      -------------ESK---ALRGLKSFSREIIGSKP------------------------
L0DC26          -------------KQA---SVAK----LPILTKMSD---------------------P--
A0A3L7P4E4      -------------SDG---RLRE-----LPSLSGAS------------------------
A0A3L7PEB5      -------------TDG---RLKE-----LPSLSGSP------------------------
A0A356KTN1      -------------KAN---PKIARELELELGREATP------------------------
A0A2E2N5A9      -------------RQL---DLVN-----HPEFAAQPLSVGQGVGTWFARLGAFVRTKQPD
A0A225EH48      -------------SNP---NVSR-----LPDIKGTD---------------------D--
A0A1G2YQB7      -------------DDL---SDKN----I-IASDIEK---------------------PDP
A0A353P687      -------------DDL---SDKN----IKLMEEAKS---------------------RDP
A0A3L7SI46      -------------TRL---PNAH-----RIDLKGTP---------------------K--
D5SZ21          -------------QKL---PVKY-----RTDFRGVA---------------------P--
A0A432MFP3      -------------LDP---KVAS-----QSGVREAP---------------------D--
A0A257WS34      -------------KGL---PSKH-----RHVLRKVP---------------------R--
A0A2E8FLY0      -------------QKL---PEKH-----RIDLKGIP---------------------R--
A0A3D2U1E1      -------------QKL---PAKH-----RVDLKDVP---------------------R--
A0A1P8WP26      -------------ERL---PERF-----KQHFSELT---------------------E--
A0A3L7V1F3      -------------KTL---PKNA-----RVDLVGYP---------------------E--
A0A2E8B0L9      -------------QRLLKSPAEA-----RIDLAGLP---------------------R--
A0A3M1VCL4      -------------ERL--SPEYR-----MVDLQDVP---------------------R--
A0A2E3GWX1      -------------QRL---PRDQ-----QAKFLGMS---------------------K--
F0SG60          -------------QRL---PRDQ-----QAKFLGMS---------------------K--
A0A2E9VST2      -------------LRL---PDTA-----RTKFIGMT---------------------K--
A0A356A6X2      -------------VRL---PDTA-----RTKFIGMT---------------------K--
A0A2E0SMM6      -------------MQL---PPEH-----QIDIGGTP---------------------L--
A0A356EME5      -------------ESP---EIRS----LPELQEKKD---------------------K--
A0A355AI52      -------------EAP---VREL--------FGSQD---------------------S--
A0A354PCQ3      -------------ADA---DLRR-------APSLSD---------------------P--
A0A2E7EGG1      -------------SQP---EITA----MPEIRSRRD---------------------P--
A0A2E7K7A9      -------------KAG---KLTE-----LPSLEGEK---------------------D--
A0A1N6DAJ8      -------------KDP---EVAK----LEVIAKVVD---------------------P--
A0A2S8G191      -------------RDP---EVAK----LPVIKEKVD---------------------P--
A0A3L7NDH9      -------------KLL---DGPT-----RVALGSQD---------------------P--
A0A2E0X9P6      -------------GRS---EIGA-----MEEFQNEP---------------------E--
A0A2N1UCJ3      -------------QRS---DIKR-----LRTFEAKP---------------------ESI
M5UE94          -------------EKH---DLDE----VKSVVDAIS---------------------E--
A0A2E0X4J3      -------------EAP---GMAQ----LQAVRDSDS---------------------P--
A0A1P8WN28      -------------KSL---PPEL--------AAEPD---------------------R--
A0A3B9CTT0      -------------DPK---PPEL--------SG-VD---------------------S--
A0A2D5NDU9      -------------TRF---HEEF--PDSEINKDETI---------------------T--
A0A286RGB6      -------------RQP---EVAR----LPSIREQID---------------------P--
A0A1V5N3W2      -------------DEL---ADKK-----LALFEDPD---------------------PIA
A0A3E0MY27      -------------SEP---GIADISWLKEVKAEGED---------------------Q--
A0A286RLF2      -------------QKL---SRED----LAVDLNMDK---------------------P--
A0A286RD13      -------------QRP---GISQ----LPYIRNQVD---------------------P--
A0A3M1QRP3      -------------ERD---DVRQ-----TSLFDEVE---------------------Q--
A0A2E3RCU8      -------------QHI---PSEC-----LQEFKG-N---------------------R--
A0A3E0MY88      -------------RQL---VEPS----HQVDFQG-T---------------------R--
A0A1C3E6N1      -------------QKL---PVKY-----RTDFRGVA---------------------P--
A0A3B8PNV4      -------------QKL---PAKH-----RIDLKGIP---------------------R--
A0A3D1DR40      -------------QKL---PAKH-----RIDLKGIP---------------------R--
A0A2E7RYU8      -------------QKL---PAKH-----RIDLKGIP---------------------R--
A0A3B8LXG8      -------------QKL---PAKH-----RIDLKGIP---------------------R--
F0SI78          -------------------VEDF----RLGELSSIS---------------------S--
A0A350CI62      -------------RIM---PEKY----RRVDLAGYP---------------------Q--
A0A3C1X4W5      -------------KIL---PEKY----RRVDLEGYP---------------------Q--
A0A3D3W3A7      -------------KIL---PEKY----RRVDLEGYP---------------------Q--
A0A2E7ENQ5      -------------QEL---PAPL-----RVDVTPKP---------------------R--
A0A1G3AQE9      -------------RQL---RPED-----CIDFAGAP---------------------K--
A0A3L7UQT9      -------------EDL---PKEY-----CVDFEGFN---------------------P--
                                                                            

A0A2G2JCA2      -----------------------------VDIIAALG---------RNINVR-----A--
A0A286U4B3      DGSVNKSVSM-------------------DRLARQLL---------GRTEIL-----S--
A0A1G2XVR0      RGNSSPTVRKPEPGKESQEPETPVKYDVDDALINNYL---------SKLTVQ-----M--
A0A1G3B0P0      RGNSSPTVRKPEPGKESQEPETPVKYDVDDALINNYL---------SKLTVQ-----M--
A0A1E3X4X0      SGSSKRR------------------------LIDVYL---------KKLSIT-----P--
A0A1U9NNE1      -----------------------------MDPVAILK---------LMINKETILIEP--
A0A1N6KFT7      ------SLA---QS---------------SDPVGFAR---------GNLKVSRPDRLT--
L0DFG4          ------SLA---LA---------------TNPLEAVR---------GSLKVTRPDRLT--
M5SZR3          ------EIS---AL---------------KTKTKELH---------QGLNVELDENAD--
M5TW92          ------EIS---AL---------------KTKTKELH---------EGLNVELDENAD--
A0A0S8FY64      ------RLT---GLFQAEDMRQMARPGLWHSAFREVR---------AVLGYEPVRPVEAW
A0A2E3GW02      ------------SS---------------SNPMASIS---------SGLSVSRSAKAE--
A0A1I3DDV4      ------HTD---SK---------------TDAVDYVS---------EHISLTKGGQGS--
A0A2E3GWC6      ------TLA---GS---------------EDPARDII---------DGLKVERTAGED--
F0SLB0          ------TLA---GS---------------EDPARDII---------DGLKVERTAGED--
A0A255R1S0      ------DEH---DL---------------GKSAGEIA---------GKLSVGKDGEAS--
A0A0J1B4A0      ------QIA---GL---------------NVKVGDLA---------ENLSVSKGGDGL--
A0A1Z8N7H5      ------CLS---EF---------------QGQQRESW---------HRQLAGKISTRV--
A0A2E2CCW9      ------SLA---GE---------------KDPTQDII---------DTLKVKRISGND--
A0A3C0AGX3      ------SLA---GE---------------KDPTQDII---------DTLKVKRISGND--
A0A0S8KNX5      ------KIDGTQDK---------------RTPEEILK---------QAITNGVIVAAA--
A0A3D3UVZ8      ------KILGTKKI---------------DPAMKLKL---------AIVEDETITVAA--
A0A354PDV6      ------LLT-PAKG---------------EDAADYVI---------SQLEIVKGGAGA--
M5TIT3          ------RIDVDNPS---------------SDAVDYVI---------NHLSVSKGGDGS--
F2AXG2          ------HLD---EK---------------TDAIDYVI---------DQLSIVRGGDGS--
M2BB46          ------HLD---EK---------------TDAIDYVI---------DQLSIVKGGDGS--
L7CLQ6          ------QLS---EK---------------TDAIDYVI---------DQLSIVKGGDGS--
A0A0J1B719      ------HLN---EK---------------TDAIDYVI---------DQLSIVKGGDGS--
Q7UF18          ------HLD---EK---------------TDAIDYVI---------DQLSIVKGGDGS--
A0A2G1W1E0      ------HLD---EK---------------TDAIDYVI---------DQLSIVKGGDGS--
K5E235          ------HLD---EK---------------TDAIDYVI---------DQLSIVKGGDGS--
A0A1U7CZ81      ------FIK---NS---------------TDKLTDLR---------QKLKVKNKDGTV--
A0A142YNY8      ------FIK---GS---------------LSPRTELK---------ERLAIVNPRNTE--
A0A1U7GLS6      ------FIK---NS---------------MAPQADLL---------ERLVVTNQKNTN--
E8R3W3          ------TLE---DL---------------NENERFNW---------LSANIQSSFAGD--
A0A3D2TNK4      ------HRT---DI---------------EGMPPSTW---------VRIIGSRLHTRV--
A0A142WSB9      ------GIA---NA---------------RDPLKAVW---------EDATAKLVSGQD--
A0A2S8FKY2      ------IVR---EE---------------ENPLEWLQ---------EELIV-----GF--
A0A432MJP4      LPTLQLAKR---EG---------------KTPTQAAI---------EELDVSRPDRAA--
M5UQ35          ------SVA---RL---------------DRTVGEIQ---------ENLAVGRGGSGD--
A0A3A0DET7      ------TFH---GV---------------DNRVAFLR---------DNINV-----GV--
A0A2A2W9R6      ------DRA---KL---------------NRSVGQLR---------GGLSISKGGQGA--
A0A353FIP5      GRQFRLNVA---TR---------------REAVERVL---------KELAVSETARGS--
A0A2E1VVJ1      GRKFGVTLR---NL---------------DATVGDLL---------SRLRIRETSRGS--
A0A3M2AEL0      GRTFRLTLR---SV---------------RRAIRDTQ---------ESCRVVETHKGS--
A0A351FYP6      -----------------------------VEARKHLE---------KVIDVS-----Q--
A0A0S8J591      --------------------------------IAVVR---------NWIRVS-----R--
M5RT57          ------------------------------KPIAWLT---------DNIRVQ-----Q--
A0A1U9NL64      ------------------------------NPTGYLK---------KQLQVS-----V--
A0A1G2YPI3      ------------------------------NHISYLK---------KTLNAT-----V--
A0A2E7ESJ6      ------------------------------DPLLKLS---------ENLKVEL----V--
A0A2E9VK20      -----------------------------EPARDII----------DSLKVSRTAGED--
A0A3D4PJK1      -----------------------------EPARDII----------DSLKVSRTAGED--
A0A142YJ13      -----------------------------IEWLS------------QQVQVE-----F--
A0A0S8GZ23      -----------------------------IDRISALK---------TALADGTITIKH--
A0A2D5AWU0      -------------------------------MITELN---------DRIGTV-----V--
L0DC26          -----------------------------IEWLE------------GQLQVD-----F--
A0A3L7P4E4      -----------------------------NLTQTILN---------GLNAER-----T--
A0A3L7PEB5      -----------------------------NLPMTILA---------GLSATR-----T--
A0A356KTN1      -----------------------------EELGGMFQ---------RGVRVE-----A--
A0A2E2N5A9      QAAQGEGTSSKAF----------------DRATEKLM---------AAISVN-----P--
A0A225EH48      -------------------------------PVTFLE---------DRIKLR--------
A0A1G2YQB7      LKSVRNKWSAKKN----------------SDLVLALK---------NAIASNQLSVAP--
A0A353P687      VTAVRNKFSKNNS----------------SDLILLLR---------KAIADNKLTVAP--
A0A3L7SI46      -----------------------------SRWTAVLK---------KNLTVS-----S--
D5SZ21          -----------------------------ADWPGVLK---------KMVTVR-----S--
A0A432MFP3      -----------------------------AE--QYLR---------EMIKVA-----A--
A0A257WS34      -----------------------------ARWADTLR---------SGLSVS-----A--
A0A2E8FLY0      -----------------------------NKWTETLR---------NNLAVT-----T--
A0A3D2U1E1      -----------------------------AKWIDALR---------KQLGVS-----A--
A0A1P8WP26      -----------------------------AEAVAEMQ---------KSLSVS-----S--
A0A3L7V1F3      -----------------------------GQWVRTIK---------DNLSVS-----C--
A0A2E8B0L9      -----------------------------DKWIDALR---------ANLSAS-----G--
A0A3M1VCL4      -----------------------------SKWVKEVR---------SNTYVS-----T--
A0A2E3GWX1      -----------------------------RQAIGTLR---------ENLSVS-----T--
F0SG60          -----------------------------RQAIGTLR---------ENLSVS-----T--
A0A2E9VST2      -----------------------------HQAIEKLR---------SNLTVN-----S--
A0A356A6X2      -----------------------------HQAIEKLR---------SSLTVN-----T--
A0A2E0SMM6      -----------------------------EMQVKTLR---------TQLSTS-----V--
A0A356EME5      -----------------------------VQWLQ------------RELRLT-----S--
A0A355AI52      -----------------------------EILAEIFS---------KSLSVR-----G--
A0A354PCQ3      -----------------------------EIAEQNLR---------KNLSIS-----G--
A0A2E7EGG1      -----------------------------IDWLST-----------QGLLIA-----P--
A0A2E7K7A9      -------------------------------PAQEII---------DSLKVKRLSGTD--
A0A1N6DAJ8      -----------------------------IEWLE------------KELQVD-----F--
A0A2S8G191      -----------------------------VSWLQ------------GALSVN-----F--
A0A3L7NDH9      -----------------------------EIVAVILK---------NHLKIK-----G--
A0A2E0X9P6      -------------------------------PLKHLQ---------EHLAVA-----Q--
A0A2N1UCJ3      AEKIKKQIGLAEP----------------SFTTGEIDNLVIYLK--KLLDVQ-----V--
M5UE94          -----------------------------SENLSPLAYIL------DNLEVTKGGDGV--
A0A2E0X4J3      --------------------------------VGMLY---------EGLAIQ-----V--
A0A1P8WN28      -----------------------------TVWPIRLR---------EMLVVT-----F--
A0A3B9CTT0      -----------------------------LRWPGELR---------KMLTVK-----F--
A0A2D5NDU9      -----------------------------VPWLK------------YHLRAE-----V--
A0A286RGB6      -----------------------------VQWVS------------EHLSVR-----F--
A0A1V5N3W2      RYLTKDSKPLNPV----------------VAIRQAIR---------DGIIAVV----P--
A0A3E0MY27      -----------------------------VAWLN------------ERIDVV-----N--
A0A286RLF2      -----------------------------ETWVEGLR---------RNLAAS-----A--
A0A286RD13      -----------------------------IMWLR------------RNLRVR-----F--
A0A3M1QRP3      -----------------------------NVLTKLLRSPSPGKRLMDGLDVN-----V--
A0A2E3RCU8      -----------------------------ESWHRELA---------SKISTH-----V--
A0A3E0MY88      -----------------------------GPGVGVLA---------SNISVS-----T--
A0A1C3E6N1      -----------------------------ADWPGVLK---------KMVTVR-----S--
A0A3B8PNV4      -----------------------------SKWTEALR---------NNLAVT-----A--
A0A3D1DR40      -----------------------------SKWTEALR---------NNLAVT-----A--
A0A2E7RYU8      -----------------------------SKWTEALR---------NNLAVT-----A--
A0A3B8LXG8      -----------------------------SKWTEALR---------NNLAVT-----A--
F0SI78          -----------------------------SNPMASIS---------SGLSVSR----S--
A0A350CI62      -----------------------------SAWVRMVR---------DNLQAS-----S--
A0A3C1X4W5      -----------------------------SAWIRKVR---------DNLQAS-----S--
A0A3D3W3A7      -----------------------------SAWIRKVR---------DNLQAS-----S--
A0A2E7ENQ5      -----------------------------DEWVEILR---------KNLTAR-----A--
A0A1G3AQE9      -----------------------------SEWSKKLR---------DKLSVN-----A--
A0A3L7UQT9      -----------------------------EVWPTLLK---------NHVSVT-----N--
                                                                            

A0A2G2JCA2      -----------VSGSEMYSVEFQSTD-PVKASLIVNEVAKSYYNLHNQTEAVKDKRVLDL
A0A286U4B3      -----------VRNSQLVKIKVSTGY-PELCKKIADTIADEYIKKNLEDKVLTTSGATDE
A0A1G2XVR0      -----------TGNSDIISISFTGTH-PETLAKMCNMHAKKFLETHLELRFAASQDAVKW
A0A1G3B0P0      -----------TGNSDIISISFTGTH-PETLAKMCNMHAKKFLETHLELRFAASQDAVKW
A0A1E3X4X0      -----------VRNTGVVNVSFSGNY-PDIITDILNAHVKFYKDQELERRFLASQDAVEW
A0A1U9NNE1      -----------GEKTELINIKMKTNN-TAFSEELVDSFIRVYMTMQAYEENQGEDNKLAL
A0A1N6KFT7      ---------------KIIVLQYQSAS-TQESLQMIHAIVASYKKLLETNYQKNNQEVITL
L0DFG4          ---------------KIIVVQYQSAS-PQESLDMIRAVVASYKKLLETNYQKNNQEVITL
M5SZR3          ---------------NILHVSFEGEV-PEECPVIIRGILNTYQDYLEETYDTMSTDTVQL
M5TW92          ---------------NILHVSFEGEV-PEECPVIIRGILNTYQDYLEETYDTMSTDTVQL
A0A0S8FY64      ELLREIVGVRPVKDTNLVDILVRAPD-ANVASLVANLVAQAYVDYSVAARQ-------QS
A0A2E3GW02      -----------D----ILLFTFTCGH-PKDAQKVLEAVIASYFAFLDESQRTASNRTVEL
A0A1I3DDV4      -----------ARDARSLNIAFRHTN-PDEALLILQALVAEYESFLDEQVSRIMSEANRL
A0A2E3GWC6      -----------HHKLNILNLQYTSTS-EEDAKQILNAVVKAYDEYLQDDAQKSHRELTQL
F0SLB0          -----------HHKLNILNLQYTSTS-EEDAKQILNAVVKAYDEYLQDDAQKSHRELTQL
A0A255R1S0      ----------------ILRATYQDGN-PEVAAKVLEAVFETYFDYVETRSQSVGSEAAEL
A0A0J1B4A0      -----------AKSASVLKATYQDPD-PEVAAAALQAIFDSYQDYIDEQTSSVGNEAAEL
A0A1Z8N7H5      -----------VKSTTVLNISYTSTK-PQNAVAIVTAVIKSYLQFVDETHKGTAAKIINV
A0A2E2CCW9      -----------RAFLNILTITYENPN-AKDARTVTQAIVDAYKRYLHEVREENTEDIIQQ
A0A3C0AGX3      -----------RAFLNILTITYENPN-AKDARTVTQAIVDAYKRYLHEVREENTEDIIQQ
A0A0S8KNX5      -----------DRLSELIRITVLHPD-REQARQIVDAFINAYTAVEVSASVEDEDKKLTI
A0A3D3UVZ8      -----------DRRSELINITMRSAN-EEEAKQIVDAFIKAYMEIEVVSADEDENRQLAI
A0A354PDV6      -----------AKSARSLSLAFAHTD-PEESRKILESVLVEYQNYIAGQLESVMSKANEY
M5TIT3          -----------AKNARSLSVSFEHTN-PEDAQVLLTAVMKRYEQFIIAQVEQLMGKANEM
F2AXG2          -----------AKTARTLNITFTHTD-PDDAKRILTAVMSRYQQFLIDQIDQVMSHADKM
M2BB46          -----------AKTARTLNITFTHTD-PDDAKRILTAVMSRYQQFLIDQIDQVMGHANDM
L7CLQ6          -----------AKTARSLNITFTHTE-PDDAKLILTAVMKRYEQFIKDQIEQVMGQANNL
A0A0J1B719      -----------AKTARSLNITFTHTD-PDDAKLILTAVMKRYEQFIIDQVEQVMGRANEM
Q7UF18          -----------AKTARSLNITFTHTE-PDDAKRILTAVMKRYEQFIIDQVEQVMGRANEM
A0A2G1W1E0      -----------AKTARSLNITFTHTE-PDDAKLILTAVMKRYEQFIIDQVEQVMGRANEM
K5E235          -----------AKTARSLNITFTHTE-PDDAKRILTAVMKRYEQFIIDQVEQVMGRANQM
A0A1U7CZ81      ----------------HIQVSFDSTD-AHEAAAIVNAVVASYLRSYKDVQQSRDESHLKR
A0A142YNY8      ----------------FVHVSLESTN-PEEAAAIVNAVVASYLQAQNELTEGADGLMKKS
A0A1U7GLS6      ----------------YVVVSLELND-PEEAALIVNAVVAAYLRNYKDYKAGADKILRAN
E8R3W3          ----------------LMMVSIPTPY-PEEASTLTNTLVNSYLRFANVLEMDRKMDEFSQ
A0A3D2TNK4      -----------TRKKSFIEVTYRSKD-PKTAAAVVRAIIRAYLAFVEKHHKGTAGEIIAD
A0A142WSB9      -----------QSFDAIIEVAYESAD-KAVAKTVVEAIVKAYEDWLGQTKDKNSADLYAA
A0A2S8FKY2      -----------PGDAEILQVSMMSKD-PTSAPKIVNAVVSAYKDEVIETERLARVTRLEN
A0A432MJP4      -----------S----VLRIDYRART-KEEAVLLTDALIRSFEAFLEESYQSNNTKVVTL
M5UQ35          -----------AEAANMLTATFQDED-PEMAAKILQAVYESYFSYIDNQSRAIGSEAADL
A0A3A0DET7      -----------GSQDDIINVSAELPN-AADAAQLVNSIVDAYVSKYAEQRKTNTVEVLTI
A0A2A2W9R6      -----------GASASILRATYRDSD-PETAAKVLQAIFDSYQLYIDGQSRDVGAEAVEL
A0A353FIP5      -----------G----VLQITYKDTD-PDRAAQVVNNLISSYAERSRERLALPAEKTVTY
A0A2E1VVJ1      -----------G----VLQITYSDTS-PSRAQRFVNRLAEMYVAYKHDRLAAQAGATEAF
A0A3M2AEL0      -----------N----VLRLSYFDTD-PERAAQVANALLRAYIEHNKSRLSRQASSTVQF
A0A351FYP6      -----------YRNTSIIELRAYDRD-KNLAQQIAQALAKEYENYRSSLQEERVKAGIDK
A0A0S8J591      -----------VPKTHHVEIWVLWPD-PKMAARMVNAVTDAYTDILKEWRSSAFDASVRA
M5RT57          -----------VGSSELYNISLATSD-PESSAKLVNAILDTYFAVRAKDNEDQTARVLEL
A0A1U9NL64      -----------GKKDDILSVSFDSPY-PAEAAHVVNEIIDSYITYHSQRKRSTSAEVLKI
A0A1G2YPI3      -----------GKKDDIISISYDSPY-PNEAAQLVNTVIDSYITYHATQKRSTSSEILKI
A0A2E7ESJ6      -----------EDGTNVLNIRFIGPY-PEDTQKVVNAVLHTYQQFLQEAYEDSGTETRDL
A0A2E9VK20      -----------HHQLNILNLQYTTSK-SKDATAILNGVIKAYDDYLKDDARKNHAELQTL
A0A3D4PJK1      -----------HHQLNILNLQYTTSK-SKDATAILNGVIKAYDDYLKDDARKNHAELQTL
A0A142YJ13      -----------PRGSEILSISITANGPPSDLSMLVNSVTEAYLSQIVEQDRLERVARFER
A0A0S8GZ23      -----------LTRTEFLGVSMTSRK-PRQAEQIVNAFMKEYMKVVDNIDLGMEDQDLAN
A0A2D5AWU0      -----------DPNTDRLSIAYLSPF-PDEAAKIARATVEEYIAYHKRKKRESAEESAAI
L0DC26          -----------APGSEILRISMTGEK-PEIPMLLVNAVTQAYMDEIVDVEMKQSRQRYDL
A0A3L7P4E4      -----------VEDGQVLDISFKGTD-PDDCAKVVNAVVASYDKNLRETYTDQGMVVSNL
A0A3L7PEB5      -----------VE-GQILDISFKGSD-PVDCAKVVNAVVASYDKSLRESYADKGTVVAKL
A0A356KTN1      -----------LESTYLVDVSYESTD-PKRCDRYANAVAEAYREQLQTLWGEKTQIAEKK
A0A2E2N5A9      -----------RGKSQVVAVEVLLAD-SYVAMKAANALVEGYIASKFEAGVATSATATAW
A0A225EH48      -----------WGSPEILEVSMNGDD-PKQILLIVNTMVDEYIKDADSDERQGRQRRRKI
A0A1G2YQB7      -----------EDNTELIKIAVKSSN-PTSASKIANAFVQAYMTIVASEEVKDGDHKLTV
A0A353P687      -----------EDKTELIKISVKSSN-PSNASKIANSFVQAYMTIVATEELKDGDHKLTV
A0A3L7SI46      -----------TRLTNMIQVRYVSKN-AKTAKLVVDAIVAAYLEYMNEIHKGNSKESMVL
D5SZ21          -----------ARQTNVLELTCRSRD-PKAAAAILYAVLSASIDFLNKNHQGTSQEILQI
A0A432MFP3      -----------RPNTSLIEVAAEAER-AHEAADVVNAVVRSYLDANKEWSEARTNNAIRM
A0A257WS34      -----------ARQTNVMTLRYRSTD-PELSAYIVSSVLNSYLKFMQATHRHSSRETLDV
A0A2E8FLY0      -----------PRRTNLIDVRYRSRD-PQVAATVVNHIVESYLTLMRGIHKNNAGNDIQF
A0A3D2U1E1      -----------PRRTNLIDVRYRSRD-PQTAAAIVNHVVNSYLKLMREIHKSTASEDVEF
A0A1P8WP26      -----------DFGTNVLDVSYRSTD-AKVAAAVVAHVLVAYNSFMNDVNRGSSDKNIER
A0A3L7V1F3      -----------AFSTTVLDLSYKSKD-PKAAQAVLRSMLAAYVEFLDDTHNGSSEESIRK
A0A2E8B0L9      -----------LRRTNIVELNYRSKS-PHAAEAVVDAVVDSYIEFMKENHTDVSVEIVSI
A0A3M1VCL4      -----------IKQTSLIDVRYRSRD-PKAAAAMVEAILAAYLDFMERTHKKGAHDNLEV
A0A2E3GWX1      -----------TRQTNLLSVNYRTTD-PKSAAIIVTEILNSYFAFMQDMHQNSSREMLKL
F0SG60          -----------TRQTNLLSVNYRTTD-PKSAAIIVTEILNSYFAFMQDMHQNSSREMLKL
A0A2E9VST2      -----------TRQTNLLQVSYCSES-PEVASLIVTEILNSYFQFMHEMHESSSGELLET
A0A356A6X2      -----------ARQTNLLEVKYCSES-PEESSTIVTEILNSYFKFMHEMHESSSGQMLDT
A0A2E0SMM6      -----------SPQTSLIDVRFISKS-PETAAYTTNQIIACYIKFMQETHQYGTQNLLTL
A0A356EME5      -----------VGKSEFLQVDFQGPD-PKNAAKIVNAVVKRYFDLLAEVTDERVAKVIAL
A0A355AI52      -----------LRQTNLLELNFRSSH-QDATAVVVAAIIQAYAKFMDESHRGTANSIVDL
A0A354PCQ3      -----------GGTASRLVVSYQDSD-REAAATVCNAIVQSYLRQRDAFDSIRVNNLERW
A0A2E7EGG1      -----------KGSSELLEVAFEGVN-PENSALLVNAIIDAYFTMRQEKRGQRAQSVISL
A0A2E7K7A9      -----------RTYLNILNLTYENKN-SNDAKVIMQAIVDAYHHYLDEVRDQNTGEIIDQ
A0A1N6DAJ8      -----------ASGSEILRISINGEK-PQVPMLLVNAITQAYIDEIVDVETKQRRQRYDL
A0A2S8G191      -----------PDNAEIMEVKLSGES-PQSISKIVNAVVQAYMDEVVDAEANMRRSRLSS
A0A3L7NDH9      -----------VRSTNLIDLKYRAQD-PRAAAMAVGAIIKAYSLFMQETHRGSAGTLVEV
A0A2E0X9P6      -----------IGESELYSVDYVSPS-ASDAATVANLVVLEYLQMQGQQERQRTQLVIDL
A0A2N1UCJ3      -----------GIKDDIIAVSCLSPY-REEAAQIVNAVIEAYVDYQTSQKKSSVSEVLKI
M5UE94          -----------AKDAHTLKATYDDPS-PVDCALILRAIFDEYKIYLDDHFAGTSTQAVEL
A0A2E0X4J3      -----------GADNEIITVSLELPD-PEEAAQLVNAVVDAYVSKYAGDYQDSALELLNI
A0A1P8WN28      -----------ETDEYVLEIKCRSTS-PESTVNVIEGLSVASGKFMDEYQKDLSVELMKQ
A0A3B9CTT0      -----------NSASQDLTISCRSRD-PESTVAVIEALQEVSEQFIEDYQTSLTVTLMNR
A0A2D5NDU9      -----------GSDNDVITLTLDNRH-KHEACALVNEVVEAYQKFQRKMQRNSATELYRI
A0A286RGB6      -----------PGNSEFMNVSFTSTR-PDETAVIVNAIVDAYMREVVDTEQRERRQRLSE
A0A1V5N3W2      -----------GRKTELIKITMDSLN-PKEAELVVDAFVRAYMNIEGSRSMEGGNKNLEV
A0A3E0MY27      -----------PRMTAVLRISMSGDE-KEPVRMIVEAVAQAYLENVVRRERNDLLAKLSE
A0A286RLF2      -----------VYRTNIITVEYRSKD-PGVAARIVGAVVQSYLDFMRSTTQGTTAEIIRI
A0A286RD13      -----------ADQAEILEISMTGGD-PEQIAAIVNAVKDAYMSEVGDVSRNYALERKKL
A0A3M1QRP3      -----------AHNSSILEIAVTLPD-SYDSAVVANAIADEYLRAVREDEQEDSESLAAE
A0A2E3RCU8      -----------VRSTTVLNISATSTQ-PKNAVAMVNAVIQSYLQFVDQTHQGTATKIIQV
A0A3E0MY88      -----------AKGTNIIHVRYQSKD-PDAAEAVLNSLLTSYKNFIKSTHGRTAEDVMEV
A0A1C3E6N1      -----------ARQTNVLELTCRSRD-PKAAAAILYAVLSASIDFLNKNHQGTSQEILQI
A0A3B8PNV4      -----------PRRTNLIDVRYRSRD-PQVAATVVNHIVESYLTLMQGIHKNNAGNDIQF
A0A3D1DR40      -----------PRRTNLIDVRYRSRD-PQVAATVVNHIVESYLTLMQGIHKNNAGNDIQF
A0A2E7RYU8      -----------PRRTNLIDVRYRSRD-PQVAATVVNHIVESYLTLMRGIHKNNAGNDIQF
A0A3B8LXG8      -----------PRRTNLIDVRYRSRD-PQVAATVVNHIVESYLTLMQGIHKNNAGNDIQF
F0SI78          -----------AKAEDILLFTFTCGH-PKDAQKVLEAVIASYFAFLDESQRTASNRTVDL
A0A350CI62      -----------AYNTNVMDISYRSRD-PRAAAAMLTAMLAGYEQFLNETNRGLSEQGLKT
A0A3C1X4W5      -----------AYNTNVMDISYRSRD-PRAAAAMLTAMLAGYERWLNETNQGLSEQGLKT
A0A3D3W3A7      -----------AYNTNVMDISYRSRD-PRAAAAMLTAMLAGYERWLNETNQGLSEQGLKT
A0A2E7ENQ5      -----------VRSTNFIEVSYRSRD-DEAAVAILDAVVESYLDFIDLNQKNVATEIVRI
A0A1G3AQE9      -----------LRNKNIITASYRSRD-PDAAVSVVSAVVACYLKFTDSTLKGQAGEVFDV
A0A3L7UQT9      -----------ERGTTLIDVRYRSRS-PKVAAFIVQRIVTEYINNINRTYGNQTQDAVAK
                                                                            

A0A2G2JCA2      LETEKNSRESGLKDLR----------GVVKTLAIETTG-------------KDPYVVTSS
A0A286U4B3      IVEQLKEIKIKIEDSE----------KKLYKYARENDI-----------------VAMD-
A0A1G2XVR0      LQDQLVDKKLKVEEAE----------EALILYKEKQNI-----------------VGLG-
A0A1G3B0P0      LQDQLVDKKLKVEEAE----------EALILYKEKQNI-----------------VGLG-
A0A1E3X4X0      IDGRLKDLGKDLEKDE----------EELQKYKEDEDL-----------------ITLDN
A0A1U9NNE1      LENKRASTAKQMQQQR----------KIIRQLAEEFGT----------------------
A0A1N6KFT7      VSRARDDLKKELDLLQ----------AEYHKFRKDNPG-----------------FAIGS
L0DFG4          VSRARDELKSELDTLQ----------DEYHKFRKNNPG-----------------LAIGA
M5SZR3          ISEARDLLLRDIRKQE----------FEYREFRRESPL-----------------LTTDE
M5TW92          ISEARDLLLRDIRKQE----------FEYREFRRESPL-----------------LTTDE
A0A0S8FY64      AGEAFEMLQRQMKEQEKALVKAEDDLLTYREQTTIPEL-----------------GTPNE
A0A2E3GW02      IKEAKDDLTESLTKKE----------TAYQQFREDSAL-----------------LWTSD
A0A1I3DDV4      ITQAQGKIESDLKSLE----------EQYVQARQSAPI-----------------IYVGN
A0A2E3GWC6      LNQINNDLTPRLNAKT----------EEYQRFRDEAPL-----------------LWKAP
F0SLB0          LNQINNDLTPRLNAKT----------EEYQRFRDEAPL-----------------LWKAP
A0A255R1S0      IANAQAKNEEELRAAD----------KAYRDFVASVPA-----------------LVLSG
A0A0J1B4A0      IARAQVQNEKALREAD----------QAYREFVASVPA-----------------LISSN
A0A1Z8N7H5      MTQEKDDIGRQLMEEE----------TKLADARVASGD-----------------FSISA
A0A2E2CCW9      LKEAEKQIAAELELKK----------NEYKKFRENAPL-----------------YWEST
A0A3C0AGX3      LKEAEKQIAAELELKK----------NEYKKFRENAPL-----------------YWEST
A0A0S8KNX5      LENERKLLAEKMESQR----------QAIYRLGQEYGT-----------------VALGS
A0A3D3UVZ8      LENRRDYLYEKIENDR----------QTIYQLGQEYGT-----------------VALEG
A0A354PDV6      ITHAKDEVESELRNAE----------QDYLTARKAAPM-----------------LFQGE
M5TIT3          IHEAKQEVESELLASE----------QEHLKARQNAPL-----------------FFQGE
F2AXG2          VQEAKSVVQKNLKEAE----------DEYLAARRKAPL-----------------SFQGE
M2BB46          VTEAKSKVEKSLEDAE----------NEYLAARQKAPL-----------------FFQGE
L7CLQ6          VEQAKTDVQGKLTNLE----------AEHLKFRRDAPL-----------------FFQGE
A0A0J1B719      VNKAKTEVETDLIAAE----------QEHLKARQEAPL-----------------FFQGE
Q7UF18          VNKAKTEVEAELVAAE----------QEHLKARQEAPL-----------------FFQGE
A0A2G1W1E0      VNKAKTEVEAELVAAE----------QEHLKARQEAPL-----------------FFQGE
K5E235          VNKAKTEVEAELVAAE----------QEHLKARQEAPL-----------------FFQGE
A0A1U7CZ81      LTVYLDRLKKDKEEKV----------EALKEIVERGNV-----------------NGQSA
A0A142YNY8      LEDYLKKMIDDKKEKV----------KELSTLMSKGKV-----------------DSQSL
A0A1U7GLS6      LKTYLDEKQKERKQKE----------KDLAALVDSG-V-----------------DARNV
E8R3W3          LRDSYVKFNESLNTKR----------KELQKLAEQYG----------------------S
A0A3D2TNK4      LTNERNQIQASLKSKQ----------LQLQKFRQEVG----------------------H
A0A142WSB9      LQGSRTALIDDISKME----------AAWKAWRDASPY-----------------FYPTP
A0A2S8FKY2      LERVHSETENKARQMR----------SDFKQLAETLG----------------------T
A0A432MJP4      ITEARDLISKELVDLE----------QKYLEIRKKNT----------------------V
M5UQ35          IANAQLKNEETLRRAD----------KAYREFLASMP----------------------A
A0A3A0DET7      LRNEKHKRDAELAECR----------KALDDFRQQHM----------------------E
A0A2A2W9R6      IAKAQVQNEIALQKAD----------QEYRDFVASVP----------------------A
A0A353FIP5      IEGQVERIQLELAEAE----------AELVAFQEEEK----------------------A
A0A2E1VVJ1      VSKEIERIQGELDAAE----------DEIVKYQEANE----------------------T
A0A3M2AEL0      IKDEIERVRRELEDAE----------QELVSYQEAEG----------------------A
A0A351FYP6      LRERMKKTNDEITAMQ----------ANVDDLRAKLGI-----------------SDAAG
A0A0S8J591      LLNRAQDIKREQDKAS----------RAVQDFSAEREI-----------------YALPE
M5RT57          LGQEKQARSVEIQNLR----------EKMRQLGQDVVG-----------------MDPYT
A0A1U9NL64      LQKEKTKRAKELEENL----------HAMMNFKRENEG-----------------LAFEN
A0A1G2YPI3      LRADKTKRDKELSETL----------KKLLDFQNDNPD-----------------IVLED
A0A2E7ESJ6      IVKAKDDLLKKWQMLE----------REYGEFKASTPL-----------------MYNGQ
A0A2E9VK20      LEQINNDLSPRLAAKT----------KEYHEFRRNAPL-----------------VWKAP
A0A3D4PJK1      LEQINNDLSPRLAAKT----------KEYHEFRRNAPL-----------------VWKAP
A0A142YJ13      LKGLFSDYQKDLSGKR----------AKFKELAGSVGT-----------------SDKTA
A0A0S8GZ23      LRKLKLELENKLKNHL----------QELRKINEKYGA----------------------
A0A2D5AWU0      IRGELGSILKVRDDLT----------EKIIRLRTENNI-----------------TQGGE
L0DC26          LKSTWNRYQESLREKR----------KQLKRLTELAGS----------------------
A0A3L7P4E4      LKDAKEEWLTTLRKCE----------DEYAEFRKSSSL-----------------IYNGE
A0A3L7PEB5      LTNAKDEWTTNLRKLE----------AEYAEFRKTTSL-----------------IYNGE
A0A356KTN1      VSEQADLLYQKLTKSE----------QDLRDFLNQSAE-----------------TPLLE
A0A2E2N5A9      MDSRLEELRQKLQESE----------NRLQAYRESEGL-----------------VDLQG
A0A225EH48      IEAHLETLNRLIKSRE----------DRLKDW-----------------------VKLGQ
A0A1G2YQB7      LENERRVMGEKIERQR----------KTLNDMAQEFGT-----------------IVLDN
A0A353P687      LEDERRVMAEKIERQR----------KTLNDMAQEFGS-----------------VILDN
A0A3L7SI46      LNREKAQSEVAIRNKE----------TDLLGLKRDSGI-----------------LLHGN
D5SZ21          LSKEKVELEQKLATRE----------AELIELRGRSLT-----------------FVSNG
A0A432MFP3      LVEYEKELGDKVEAQQ----------KKLIELFKEAEDPRRMLGNLAAMDGGVAPAASGE
A0A257WS34      LTREKRDLESQLTQKE----------QQLHGLKSQVGL-----------------LLSGN
A0A2E8FLY0      MTAEKKKLDEETNQIN----------AELLNLKRQMQI-----------------IS-GP
A0A3D2U1E1      LTKKREKLDEETNAIN----------AELLVLKRQMQI-----------------IS-GP
A0A1P8WP26      LEAQFAEVTKELQELQ----------AYRDELTKRSPD-----------------FV-GV
A0A3L7V1F3      LKQQLKDDNERLTLAE----------AERLRLRNSAPE-----------------LV-ET
A0A2E8B0L9      LEKERVAKEQELQAKQ----------QEMLSLKRAVGA-----------------LG-TE
A0A3M1VCL4      LTRKQRQLEEEIRSKE----------SQLAALRSASEE-----------------IV-TA
A0A2E3GWX1      LTAERKKVEQQMTDKQ----------NELLRLRAESDS-----------------LL-GT
F0SG60          LTAERKKVEQQMTDKQ----------NELLRLRAESDS-----------------LL-GT
A0A2E9VST2      LTTERDNIQKQIFEKQ----------AELLNLQRDSDS-----------------LI-GT
A0A356A6X2      LTKERDNIQNQILVKQ----------SELLDLQRESDS-----------------LI-GT
A0A2E0SMM6      LQQDQANLIAQYKQNA----------TDLIELQRRSDL-----------------LLNNG
A0A356EME5      LDREIANRKKHVEEKR----------RQIQTRTLAETG-----------------KDPFA
A0A355AI52      LQNEKEEVDKKIQVKQ----------EEFLAVRKKVGD-----------------LGIKE
A0A354PCQ3      LEPEIQRWEQEVAERR----------RVVQKLSEQTLG-----------------YAPGS
A0A2E7EGG1      LEDERARRSEEIKLLQ----------AEVRQLQKQLVA-----------------NDPSL
A0A2E7K7A9      LNKANESILSDLEKKK----------QEYKEFRKDAPL-----------------YWENT
A0A1N6DAJ8      LKETWNRYQENLREKR----------KELKRLTELAGS-----------------DDKKT
A0A2S8G191      LERAYSETENELRSKR----------SEFRRLADTLGT-----------------GDTAS
A0A3L7NDH9      LTKEKTDVDLRLQKTE----------AEFLVIRQRVGD-----------------LGIKS
A0A2E0X9P6      LEQERHARSSRLEQLR----------RRVVELSREVTG-----------------TDPFG
A0A2N1UCJ3      LQKEKITRDQELSANF----------KELLEFTRQYGV-----------------ISFEK
M5UE94          LTQLSEETAQEVRDAE----------RKLAEHLAGSQI-----------------MWDGE
A0A2E0X4J3      LREEKRDRQAELDAAQ----------TALDDFRNAHPE-----------------LAVQV
A0A1P8WN28      LERKGETVLKGLLAKE----------NELLEARQNCGD-----------------IALSK
A0A3B9CTT0      LQEDRRGVETKLIEKN----------KELLEERRDCGD-----------------IVINK
A0A2D5NDU9      LDMDRKRYEVEYDTAL----------RALDEYCKKHPA-----------------MRLDM
A0A286RGB6      LDQLYSEKEADVRKLE----------NDLKSLSQQLET-----------------GDSQA
A0A1V5N3W2      LESERKAIQDKIQRQQ----------ETIRKMGEEYGT-----------------IALTG
A0A3E0MY27      LERQHQELEADIGRRR----------KRYNDMVAEVDV-----------------FDGGQ
A0A286RLF2      LTTEKDDIAARLSEKE----------QALQQLSQQIGA-----------------LDVGV
A0A286RD13      LEANYAQTLELVKKRD----------QRYRELANAVGS-----------------ADS--
A0A3M1QRP3      RRRQEELLRKQIEIKE----------EEVDALRKMLRV-----------------HTADD
A0A2E3RCU8      MTREKDNLARQLSAEE----------VKLADARLAAGD-----------------FSIDP
A0A3E0MY88      LQQEKIQLKGEIDRKK----------ERLLEAQRRFGD-----------------FTNGG
A0A1C3E6N1      LSKEKVELEQKLATRE----------AELIELRGRSLT-----------------FVSNG
A0A3B8PNV4      MTAEKKKLDEETNRIN----------SELLDLKRQMQI-----------------ISGPD
A0A3D1DR40      MTAEKKKLDEETNRIN----------SELLDLKRQMQI-----------------ISGPD
A0A2E7RYU8      MTAEKKKLDEETNRIN----------SELLDLKRQMQI-----------------ISGPD
A0A3B8LXG8      MTAEKKKLDEETNRIN----------SELLDLKRQMQI-----------------ISGPD
F0SI78          IKEAKDDLTESLTKKE----------TAYQQFREDSAL-----------------LWTSD
A0A350CI62      LATRLEAIEQEVKELQ----------SRRLHLKASAPE-----------------LVDTG
A0A3C1X4W5      LGTRLEVIEQEVKSLQ----------ARRLQLKASAPE-----------------LVDTG
A0A3D3W3A7      LGTRLEVIEQEVKSLQ----------ARRLQLKASAPE-----------------LVDTG
A0A2E7ENQ5      LDKGRSDVASQLDAKE----------QELLVAQRETGD-----------------LGLRN
A0A1G3AQE9      LSQEKNTLGVELSHKE----------QERLALRQQCGV-----------------LRVGP
A0A3L7UQT9      LTEEKKETSRKLTEKN----------QEFLELQSQTGN-----------------IYDG-
                                                                            

A0A2G2JCA2      SER----------------------------AGTYSPV----------------------
A0A286U4B3      ----------------------------ASQSIILKEL----------------------
A0A1G2XVR0      ----------------------------ETAGIIEQKL----------------------
A0A1G3B0P0      ----------------------------ETAGIIEQKL----------------------
A0A1E3X4X0      LGT-----------------------VEQRQNIVLEKL----------------------
A0A1U9NNE1      ------------------------TSLTGRQEMMLEQV----------------------
A0A1N6KFT7      NGQ----------------------------TLTMRKLEQWSQGINNTTDLMIQLKTQLE
L0DFG4          NGQ----------------------------TLMMRKLEQWSQGINNTTDLMIQLKTQLE
M5SZR3          GGS----------------------------NPVYSRI----------------------
M5TW92          GGS----------------------------NPVYSRI----------------------
A0A0S8FY64      --Q----------------------------SPVLTRR----------------------
A0A2E3GW02      EGN----------------------------NLHQARL----------------------
A0A1I3DDV4      ESS----------------------------NVYLDTF----------------------
A0A2E3GWC6      PGA--------------------DAAPGDVTNIHHQRV----------------------
F0SLB0          PGA--------------------DAAPGDVTNIHHQRV----------------------
A0A255R1S0      G------------------------------NIQRDRL----------------------
A0A0J1B4A0      ING-----------------------RDSLEDVHRLRL----------------------
A0A1Z8N7H5      ESN---------------------------------IV----------------------
A0A2E2CCW9      PGS--------------------EAAVAGSTNVHQERV----------------------
A0A3C0AGX3      PGS--------------------EAAVAGSTNVHQERV----------------------
A0A0S8KNX5      RT-----------------------------DMMLQRV----------------------
A0A3D3UVZ8      RQ-----------------------------DMMLQRV----------------------
A0A354PDV6      GSS----------------------------NVYQDKY----------------------
M5TIT3          GSS----------------------------NVYQDRY----------------------
F2AXG2          GSS----------------------------NIYQDRY----------------------
M2BB46          GSS----------------------------NIYQDRY----------------------
L7CLQ6          GSS----------------------------NIYQDRY----------------------
A0A0J1B719      GSS----------------------------NIYQDRY----------------------
Q7UF18          GSS----------------------------NIYQDRY----------------------
A0A2G1W1E0      GSS----------------------------NIYQDRY----------------------
K5E235          GSS----------------------------NIYQDRY----------------------
A0A1U7CZ81      GESKPKESTKTQGSDP-----APQTKDASIEKFSIEQY----------------------
A0A142YNY8      TPNQASQANTAGPAAPADGTVQDSSKARNLGDVSIEQY----------------------
A0A1U7GLS6      AQREPAPDR------------QGEDPATTLQDVSMEEL----------------------
E8R3W3          GDP------------------IILEMRYQFHQNKVARL----------------------
A0A3D2TNK4      LAV------------------STEDGVIDPKIQRVMKL----------------------
A0A142WSB9      PVV------------------TVNGVATPQMSPQAQAL----------------------
A0A2S8FKY2      SDS------------------ET---LSLAQQGSVQHY----------------------
A0A432MJP4      LAT-----------------------DQSGRSFITRRV----------------------
M5UQ35          LVD------------------TNQDGEASLQDVHRIRL----------------------
A0A3A0DET7      LAV-----------------------QLEQGNVVTQRF----------------------
A0A2A2W9R6      LLN------------------VSGSGVGSLEDIHRTRL----------------------
A0A353FIP5      SV------------------------LSDTAQAIVGRM----------------------
A0A2E1VVJ1      PV------------------------LPEVAKAIVEQQ----------------------
A0A3M2AEL0      VA------------------------LSEEASLLVQRL----------------------
A0A351FYP6      EDS--------------------YS------IVEPEIV----------------------
A0A0S8J591      IR-----------------------------SVVLTNE----------------------
M5RT57          GMP--------------------QKNGG---QAGAGPL----------------------
A0A1U9NL64      NGN----------------------------NIILDRL----------------------
A0A1G2YPI3      SRG----------------------------NILIEQL----------------------
A0A2E7ESJ6      ESI----------------------------NVHAQRQ----------------------
A0A2E9VK20      AGA--------------------DKGPNNVTNIHHQRV----------------------
A0A3D4PJK1      AGA--------------------DKGPNNVTNIHHQRV----------------------
A0A142YJ13      SAV--------------------RQ------QMMVEHL----------------------
A0A0S8GZ23      ------------------------DSLEGLQRVALGDI----------------------
A0A2D5AWU0      -------------------------------TLIQARL----------------------
L0DC26          -DD--------------------KTTLASIHQHELDRL----------------------
A0A3L7P4E4      NVT----------------------------SLSESRM----------------------
A0A3L7PEB5      SVT----------------------------SVSESRM----------------------
A0A356KTN1      EHE----------------------------KLLVERI----------------------
A0A2E2N5A9      IS-----------------------------TIAATEL----------------------
A0A225EH48      APG--------------------EQASVLKMKLLTDEV----------------------
A0A1G2YQB7      RQ-----------------------------QMMMNHI----------------------
A0A353P687      RQ-----------------------------QMMMNHL----------------------
A0A3L7SI46      DK-----------------------NS----HVIIEQT----------------------
D5SZ21          TD----------------------NAT----NVAVARV----------------------
A0A432MFP3      EGQ--------------------RAAF----QVDVDEY----------------------
A0A257WS34      GTS--------------------ESGT----HIAADRA----------------------
A0A2E8FLY0      DN----------------------QNI----NPAAERV----------------------
A0A3D2U1E1      DN----------------------QNI----NPAAERL----------------------
A0A1P8WP26      GDG--------------------ESVV----NLSVANM----------------------
A0A3L7V1F3      GDK--------------------NSGL----SIVSETI----------------------
A0A2E8B0L9      GS---------------------TTVV----HPMVQRV----------------------
A0A3M1VCL4      DG----------------------RQI----SLIAEQI----------------------
A0A2E3GWX1      GD----------------------SVV----SVVNERV----------------------
F0SG60          GD----------------------SVV----SVVNERV----------------------
A0A2E9VST2      GD----------------------NVM----SVVNERV----------------------
A0A356A6X2      GD----------------------NVM----SVVNERV----------------------
A0A2E0SMM6      TET--------------------V-------SLVGQRI----------------------
A0A356EME5      TTL--------------------HAGSG---ANWPHPL----------------------
A0A355AI52      GGK--------------------TM------HPLVERA----------------------
A0A354PCQ3      KTS--------------------ILEN----QGAIALL----------------------
A0A2E7EGG1      TST--------------------SLIGSDV-VISESPL----------------------
A0A2E7K7A9      PGS--------------------EAAVAGSTNMHQERV----------------------
A0A1N6DAJ8      IAN--------------------IH------QHELDRL----------------------
A0A2S8G191      LSL--------------------VQ------QNALQQF----------------------
A0A3L7NDH9      DGK--------------------VM------HPLVERA----------------------
A0A2E0X9P6      QGA--------------------VFNL----DRALSPV----------------------
A0A2N1UCJ3      SGG----------------------------NEVFQRL----------------------
M5UE94          KTR----------------------------NIHKERL----------------------
A0A2E0X4J3      RSS----------------------------DIVSDRF----------------------
A0A1P8WN28      ESE--------------------DS------HPLVQRV----------------------
A0A3B9CTT0      NST--------------------QS------HPLVERV----------------------
A0A2D5NDU9      QGA----------------------------RASVEEH----------------------
A0A286RGB6      LSL--------------------KQ------QITLQQF----------------------
A0A1V5N3W2      RQ-----------------------------DMMLARV----------------------
A0A3E0MY27      ADA--------------------NR------ELLMAEQ----------------------
A0A286RLF2      NSQ--------------------TV------HPLVERA----------------------
A0A286RD13      -------------------------------EVARKKA----------------------
A0A3M1QRP3      ------------------------------------------------------------
A0A2E3RCU8      ESD--------------------VI------HPVVQTV----------------------
A0A3E0MY88      ETD--------------------HV------HPLVERA----------------------
A0A1C3E6N1      TDN--------------------AT------NVAVARV----------------------
A0A3B8PNV4      NQS--------------------I-------NPAAERV----------------------
A0A3D1DR40      NQS--------------------I-------NPAAERV----------------------
A0A2E7RYU8      NQS--------------------I-------NPAAERV----------------------
A0A3B8LXG8      NQS--------------------I-------NPAAERV----------------------
F0SI78          EGN----------------------------NLHQARL----------------------
A0A350CI62      ERN--------------------QNSL----NTISKNI----------------------
A0A3C1X4W5      ERN--------------------QNSL----NTISKNI----------------------
A0A3D3W3A7      ERN--------------------QNSL----NTISKNI----------------------
A0A2E7ENQ5      GST--------------------IT------HPLVHNV----------------------
A0A1G3AQE9      EGE--------------------VQ------HPLVQAA----------------------
A0A3L7UQT9      EGK--------------------ST------NLLSLRV----------------------
                                                                            

A0A2G2JCA2      --------------------------------------------------SELQSRLVSA
A0A286U4B3      --------------------------------------------------TTISDELTRA
A0A1G2XVR0      --------------------------------------------------EGLKSNLTET
A0A1G3B0P0      --------------------------------------------------EGLKSNLTET
A0A1E3X4X0      --------------------------------------------------SELSTELTRA
A0A1U9NNE1      --------------------------------------------------MKLQNELTTL
A0A1N6KFT7      LIKKMESSGSQGNAISLALSQFPTMTPGGSNGQIPQSSGTA------GSYEQLQKELAEV
L0DFG4          LIKKMESSGSQGNAIALALNQFPTVSSNGAGHLTQGMTGAAIGTSGTGSYEQLQKELADV
M5SZR3          --------------------------------------------------AAIQRQQSEL
M5TW92          --------------------------------------------------AAIQRQQSEL
A0A0S8FY64      --------------------------------------------------RALNDEFTRV
A0A2E3GW02      --------------------------------------------------AQIEGQRSEL
A0A1I3DDV4      --------------------------------------------------RRLQDELVTV
A0A2E3GWC6      --------------------------------------------------DAIAAERVKV
F0SLB0          --------------------------------------------------DAIAAERVKV
A0A255R1S0      --------------------------------------------------TAIEAELNTI
A0A0J1B4A0      --------------------------------------------------NNIEQQLGGI
A0A1Z8N7H5      --------------------------------------------------HPVVQSVITL
A0A2E2CCW9      --------------------------------------------------KAIDNERRLN
A0A3C0AGX3      --------------------------------------------------KAIDNERRLN
A0A0S8KNX5      --------------------------------------------------GSLLSTLTEV
A0A3D3UVZ8      --------------------------------------------------ASLLDTLTSV
A0A354PDV6      --------------------------------------------------RRVEEELLNV
M5TIT3          --------------------------------------------------RRLQEELLDV
F2AXG2          --------------------------------------------------RRLQDELLDL
M2BB46          --------------------------------------------------RRLQDELLDL
L7CLQ6          --------------------------------------------------RRLQDELLDL
A0A0J1B719      --------------------------------------------------RRLQDELLDL
Q7UF18          --------------------------------------------------RRLQDELLDL
A0A2G1W1E0      --------------------------------------------------RRLQDELLDL
K5E235          --------------------------------------------------RRLQDELLDL
A0A1U7CZ81      --------------------------------------------------RNFKADILKK
A0A142YNY8      --------------------------------------------------RKWKDRLLET
A0A1U7GLS6      --------------------------------------------------RTIKAQLLDV
E8R3W3          --------------------------------------------------EQLLEEVNQ-
A0A3D2TNK4      --------------------------------------------------NEVLLTAQEK
A0A142WSB9      --------------------------------------------------DRVIREQESI
A0A2S8FKY2      --------------------------------------------------GLVRNELAQV
A0A432MJP4      --------------------------------------------------DGWDSVINQT
M5UQ35          --------------------------------------------------AQIESELSET
A0A3A0DET7      --------------------------------------------------SSLAEELNST
A0A2A2W9R6      --------------------------------------------------KSIEVELATV
A0A353FIP5      --------------------------------------------------SEIDLEQAKL
A0A2E1VVJ1      --------------------------------------------------SSLTLELARL
A0A3M2AEL0      --------------------------------------------------SELDLRDADL
A0A351FYP6      --------------------------------------------------RRYESELITA
A0A0S8J591      --------------------------------------------------RWLQEAAAQA
M5RT57          --------------------------------------------------ERLRERLTAA
A0A1U9NL64      --------------------------------------------------ANLSQAVTDA
A0A1G2YPI3      --------------------------------------------------QRWSTLLTEA
A0A2E7ESJ6      --------------------------------------------------ADYENERVSL
A0A2E9VK20      --------------------------------------------------DAIATERVKV
A0A3D4PJK1      --------------------------------------------------DAIATERVKV
A0A142YJ13      --------------------------------------------------GLARQELMRL
A0A0S8GZ23      --------------------------------------------------TSLREQLRNL
A0A2D5AWU0      --------------------------------------------------TQTRELWTDA
L0DC26          --------------------------------------------------GRAEDELSRI
A0A3L7P4E4      --------------------------------------------------AGIEIERSKV
A0A3L7PEB5      --------------------------------------------------AGIEAERSKV
A0A356KTN1      --------------------------------------------------RINNNALSDI
A0A2E2N5A9      --------------------------------------------------TLTSDRLINA
A0A225EH48      --------------------------------------------------SKFNSTVSSL
A0A1G2YQB7      --------------------------------------------------SRMQEKLTEL
A0A353P687      --------------------------------------------------AKLQEKVTEL
A0A3L7SI46      --------------------------------------------------VKLNDALIEA
D5SZ21          --------------------------------------------------VRLNEEFMKA
A0A432MFP3      --------------------------------------------------ERLSQALLEL
A0A257WS34      --------------------------------------------------RQLNLTLTTA
A0A2E8FLY0      --------------------------------------------------AALNKELIVA
A0A3D2U1E1      --------------------------------------------------QELNKHLIDA
A0A1P8WP26      --------------------------------------------------KHLLARLSEA
A0A3L7V1F3      --------------------------------------------------RLLNIDYSAA
A0A2E8B0L9      --------------------------------------------------ITLNNALVEV
A0A3M1VCL4      --------------------------------------------------ARLNQALLEA
A0A2E3GWX1      --------------------------------------------------VELNRSLAAA
F0SG60          --------------------------------------------------VELNRSLAAA
A0A2E9VST2      --------------------------------------------------IELNRALAKA
A0A356A6X2      --------------------------------------------------IELNHALAKA
A0A2E0SMM6      --------------------------------------------------IALQNSYMEA
A0A356EME5      --------------------------------------------------AGLQTRLTEV
A0A355AI52      --------------------------------------------------IQLNSTLIET
A0A354PCQ3      --------------------------------------------------TRLRSQIAEL
A0A2E7EGG1      --------------------------------------------------KSMQENLAKA
A0A2E7K7A9      --------------------------------------------------KTIDNERRQN
A0A1N6DAJ8      --------------------------------------------------GRAEDELARV
A0A2S8G191      --------------------------------------------------AALRSELTRV
A0A3L7NDH9      --------------------------------------------------IQLNAALIEA
A0A2E0X9P6      --------------------------------------------------DTLYQSLNEI
A0A2N1UCJ3      --------------------------------------------------KALGDSLTIA
M5UE94          --------------------------------------------------EKIEDDLHEL
A0A2E0X4J3      --------------------------------------------------SALTNELNET
A0A1P8WN28      --------------------------------------------------SHLNENLTTV
A0A3B9CTT0      --------------------------------------------------GQINQRFTEL
A0A2D5NDU9      --------------------------------------------------GRVRKLIHDV
A0A286RGB6      --------------------------------------------------STYRNELINV
A0A1V5N3W2      --------------------------------------------------SDLRQQLTQI
A0A3E0MY27      --------------------------------------------------KSLREEIGLI
A0A286RLF2      --------------------------------------------------KAFNQALVEV
A0A286RD13      --------------------------------------------------LTALETLADH
A0A3M1QRP3      ---------------------------------------------------LVNTQRLYL
A0A2E3RCU8      --------------------------------------------------VTLNEAFLDA
A0A3E0MY88      --------------------------------------------------LALHTELTVA
A0A1C3E6N1      --------------------------------------------------VRLNEEFMKA
A0A3B8PNV4      --------------------------------------------------AALNKELIVA
A0A3D1DR40      --------------------------------------------------AALNKELIVA
A0A2E7RYU8      --------------------------------------------------AALNKELIVA
A0A3B8LXG8      --------------------------------------------------AALNKELIVA
F0SI78          --------------------------------------------------AQIEGQRSEL
A0A350CI62      --------------------------------------------------EMLTQEYTNS
A0A3C1X4W5      --------------------------------------------------ELLTQEYINA
A0A3D3W3A7      --------------------------------------------------ELLTQEYINA
A0A2E7ENQ5      --------------------------------------------------VRINEALIDV
A0A1G3AQE9      --------------------------------------------------IALSEQLIES
A0A3L7UQT9      --------------------------------------------------VELNKLLIEA
                                                                            

A0A2G2JCA2      KVEKLVLEVEHQALKE--IHEKETFIVPETGLNQAVEQ----------------------
A0A286U4B3      EAERIGKEIRFLAVQNS-DD----LSSLPGIAD---------------------------
A0A1G2XVR0      KIEKVKLKALSDQIKQY-SKDPTLTKLIPEIVK---------------------------
A0A1G3B0P0      KIEKVKLKALSDQIKQY-SKDPTLTKLIPEIVK---------------------------
A0A1E3X4X0      KTQRIGVETLYNEIQKL-SERPEMIEAITPVIE---------------------------
A0A1U9NNE1      ETKRIALEANVQMKVNG-DKVLLAPTDRMKLKYEFINA----------------------
A0A1N6KFT7      KLKRSITQRMVDNLK------AGRPNSEATVSEDDVAGSFKLDPNVAELYRDLKRAQLRY
L0DFG4          KLKRAMTQRLVENLK------GARPNAEGKVTEDHVAGSFKLDPYVAELYRDLKRAQVRY
M5SZR3          LLRRTELESLIQSLENA-IESGLEPKHLAMLISNAGVQLAAMDDDAEPMGLDRLRMDQKF
M5TW92          LLRRTELESLIQSLENA-IESGLEPKHLAMLISNAGVQLAAMDDDAEPMGLDRLRMDQKF
A0A0S8FY64      QLKRIELGVVVQA---N-LGTGEEPQDLEELL----------------------------
A0A2E3GW02      LIKSSQVRAELEAIQNA-LNRGTSRQALLMMADQARQRAGQSSAE---------------
A0A1I3DDV4      DIERSAVATRLQNVLTS-LDQIKQNKGNSLEMLALIDSESLTRLGTFGSFSSAQTQDFQE
A0A2E3GWC6      ELKYQEITSRIQTLRNA-VQRGESSEALLLLVRTFLQRDQQSNTQTVMTG----------
F0SLB0          ELKYQEITSRIQTLRNA-VQRGESSEALLLLVRTFLQRDQQSNTQTVMTG----------
A0A255R1S0      RRTIAEIETRRQKISSS-VKGQRPEELTDAQLATLLSKEDISRLQMFMDFAEGRSKVEEK
A0A0J1B4A0      RESLSHAKSRRVVIREF-VKGKDPDSLSDVHVMSLLDADEIDRVNAFLAISANRDDQTND
A0A1Z8N7H5      NEAFLDAKKDSLIQQSL-VEGIQRAIVRGEDLKQYAMAVEETIGKELLIKGLGFNTEN--
A0A2E2CCW9      LLKLTELKSKIDSLKAA-IASGESKETLELLAQQYLMGQTRGQAANGNASEGHHLATPGT
A0A3C0AGX3      LLKLTELKSKIDSLKAA-IASGESKETLELLAQQYLMGQTRGQAANGNASEGHHLATPGT
A0A0S8KNX5      EAERIKLEAQVQLLELT-KTQPIAPGELLSMRQSYINE----------------------
A0A3D3UVZ8      EAKRIELEAQVLLLERT-REQPISPEELLKMRQDYINQ----------------------
A0A354PDV6      DIEESSLKTRLERVRET-LGDMDLDGPLSEHLDKLALIDSESMQRLGLYASLQVNAASTA
M5TIT3          DIKESTVRTRLQRVADT-LNEMDDSGDAFDHLDKLALIDSESLERLGVFAGLQMNAADSP
F2AXG2          DIQESTVKTRLARVDET-LKEMDGSVDPIDQLDKLALIDSESLERLGVFAGLQMNSANTA
M2BB46          DIQESTVKTRLTRVDET-LKEMDESVDPIDQLDKLALIDSESLERLGVFAGLQMNSANTA
L7CLQ6          DIQESTVKTRLTRVDET-LKEMDESVDPIDQLDKLALIDSESLERLGVFAGLQMNSANTA
A0A0J1B719      DIQESTVKTRLTRVDQT-LKEMDESTDPIDQLDKLALIDSDSLERLGVFAGLQMNSANTA
Q7UF18          DIQESTVKTRLTRVDET-LKEMDESTDPIDQLDKLALIDSESLERLGVFAGLQMNSANTA
A0A2G1W1E0      DIQESTVKTRLTRVDET-LKEMDESTDPIDQLDKLALIDSDSLERLGVFAGLQMNSANTA
K5E235          DIQESTVKTRLTRVDET-LKEMDESTDPIDQLDKLALIDSDSLERLGVFAGLQMNSANTA
A0A1U7CZ81      KLELNELEFALQKRVAD-SQ---EQDSEVAETTGFQKSQLEARINETFRR----------
A0A142YNY8      QVDLFQAKALLEQRTAD-YQNGAEIEQLESGLRP-SEEELTERIQAAFLA----------
A0A1U7GLS6      QIELMTAKSRLQSRTQD-YQDLGQIEPTAAETATLPEEEVARRIEAEFRS----------
E8R3W3          RIRLAEIRRQILLEEQR-TNRTGTGLTPRRDAEGKSDSNAASRSPAATSPGRLDSREIDD
A0A3D2TNK4      RLSLQANLA----TVET-AYNRGEDLNQHLMHLEAPLGQQVLLSSVGVSPQD--------
A0A142WSB9      QTQRANVQGKIATLKKM-IAANESPDEIQFWVMHALSAGTGGGAEGGGGGGGGGGGVLQG
A0A2S8FKY2      RFELMRAEGELDFLLSS-NKAQIESVSRSGGDGGLTTENAPGVGDDATPRVPVSDADDSV
A0A432MJP4      LVRAVELRT-QLELGKS-LREKGVGLAGIAYALGQFRGDPGESLAISSSA----------
M5UQ35          RKKLAQVRARRQTIRDF-VGGRSRDEITDAEVLAILTEEELSRLKTLVTLNRGDQDDLES
A0A3A0DET7      EIELLQAKA----LFHR-VKSMYDTPKQRPFLLDMAGDDQQ-------------------
A0A2A2W9R6      RAALASARSRRLVIADA-VKGKRADELTDAGVMALLTEEDIARLETLVSIAKERKGGDSG
A0A353FIP5      VMMAERQNQ----LAES-LRK-GSPVEEVGAAVEL-------------------------
A0A2E1VVJ1      RLTIRAHEL----VAER-LQDPEASLMSLAGAIEL-------------------------
A0A3M2AEL0      DLRIRTVKN----LIET-VRTSDSGLERLVSVPDL-------------------------
A0A351FYP6      KGLYTQQATLLQGLQEQSLEELRE------------------------------SIMTAN
A0A0S8J591      NVEMIAAQSLYDAVNKA-VEEG--------------------------------TYENTR
M5RT57          EVDRKMLEMEITAIREA-MAKEDLRIAEVDVEMAVGESQEVLDL----------------
A0A1U9NL64      QLALIEAKSEYDTVKAM-VSDPKKVKQFVEAKRV--------------------SGLYVS
A0A1G2YPI3      KLKTIERNSAYESTKEM-VSDPVKLQQFIEAQRA--------------------RGMYIP
A0A2E7ESJ6      QKQMTELGAQIKSVEEA-LERDDNLESILLLAEKDGH-----------------QGLKEK
A0A2E9VK20      ELLYEEISSRLSTLKSA-IERGESHEALMLLVKTFLQKDQTSNS-----------QTVVS
A0A3D4PJK1      ELLYEEISSRLSTLKSA-IERGESHEALMLLVKTFLQKDQTSNS-----------QTVVS
A0A142YJ13      QSDVRRSQARLNVLKSQPTVATTSNQDFASVE----------------------VREATS
A0A0S8GZ23      ELVISDTLTQIELLSDP-NHPIDIPPDMLKNRSDSINNDPYVRE----------------
A0A2D5AWU0      HFDMLRERATFELFSRA-EADAEKFLDLGRNRRSTKQNPNLEPE----------------
L0DC26          QSELRSLRVEAEVLEEQ-ATLNETMVTPAMIEDAISRDRSIELY-------KEKEGLAQR
A0A3L7P4E4      MIAQTEIQSQIDAIQKA-LERGGSREAITLMLESFNDKKKSGDG-------------LET
A0A3L7PEB5      LIAQTEVQSQIDAIKKA-LDRGGSREAITLMLESFNDKNNSGEA-------------VEK
A0A356KTN1      QRQRIQLNAQLESIQRV-LEQGRPLE----------------------------SASPIA
A0A2E2N5A9      RRQRAESESQFRQVEAMKASRLDELASVPAVLSDPVIQQFKATK--------------AQ
A0A225EH48      SLEIVSHETNLITLQHKQSVIDMQEVSLDELEKAVAKNEKVAPK----------VEARNI
A0A1G2YQB7      ELERIVLQTKIDLHSSK-EEKTITPEMMAKLRHDFINSDLMVQT----------------
A0A353P687      ELERIVLQTKIDLHSSQ-KEKTITPEVMAKLRHDFINSDLMVQT----------------
A0A3L7SI46      QKKTLESRALLISVQHA-LAEGNDIQPYLQQAAGDISREFLLQE----------LGVGAN
D5SZ21          KEETLRATAQLAALEQA-ISRGEDVLQFAMASLDVVGKQFMMGE----------LGLDSQ
A0A432MFP3      EYEEIEARADLEAVRRQ-AAATD-------------PRVWVDRR----------IEQVFL
A0A257WS34      VEQTAEARAFYEAVAYA-VRSGGDIQQFITQVADVVGSQVLLRE----------LGMGSQ
A0A2E8FLY0      QNRTRENRATLEAIENA-AAQGQSIEQFAMQQIEVVGKEFLLRR----------MGLDSQ
A0A3D2U1E1      MNRTREARATMQAIREA-AARGEDIHQFALQQIEVVGKEVFLRQ----------MGLNPQ
A0A1P8WP26      QQEAANAQATLETLRQA-VANGEDVLQYASEL----GEQVLAEV----------MGVSGQ
A0A3L7V1F3      RRISEQSRTQFDGLQRA-IASREDILQFANKTLDTAGRQLIEQS----------MGLGSQ
A0A2E8B0L9      QQERMQLEASLGAVRMA-VRNGSDLRQHMIDLEPLVGRQLVMSG----------LGLSPE
A0A3M1VCL4      KKETINARVFLNAVENA-LATGQDVFQLMQGELEPVGRQMLESE----------LGFSQQ
A0A2E3GWX1      QKETIESRSFYTAVEQA-IRNGENLQQLMAQTNSSVASELMKIG----------IGVDSR
F0SG60          QKETIESRSFYTAVEQA-IRNGENLQQLMAQTNSSVASELMKIG----------IGVDSR
A0A2E9VST2      QQDSIQAQSHYTAVEQA-IRNGESLQQLMNQSNQTLANELMKLS----------AGVDSR
A0A356A6X2      QQESIQARSYYTAVEQA-VRNGESLQQLMNQSNQTLANELMKLS----------AGVDSR
A0A2E0SMM6      QNQMIKMQTLIDALTEA-IENGSNVQQYAEEILGAGPVGNELLG----------QELGLQ
A0A356EME5      EVEREVLEAEWKALNEMPNPLAQQVDEALAGN----------------------VTSAVE
A0A355AI52      QKKRLLLEASYQSLTEA-IKAGQNIRQSLIAIEETLGKEAFLDS----------MGLGDR
A0A354PCQ3      TVELSVRDAQSAMQNNLMQAESDGAGEVLQVAAEALVPDPVFQPRRKHPSESEIEQLVDR
A0A2E7EGG1      QIEHKVLAAQVQALEDS-VQTGPAVPDVLIEREIAGREEVQRVL----------VALNQK
A0A2E7K7A9      LLKLTELKSKINTLKSA-IASGESKETLELLAQQFLMGQARGQSGATTGGVESQAITPGN
A0A1N6DAJ8      QSELRSLRIEHEVSQEK-VTQTASMITPVMIEDAISRDRSIELL----------KARESA
A0A2S8G191      QLDLLRAKGKLAGIQSS---VAANLTEPVVAKKPVVEEEENAPDAKQDVPLEEDSDVELQ
A0A3L7NDH9      QKKRLSLQASQASFQTA-IQNKQNIRQSLMAIEESLGKEAFLDS----------VGLSSR
A0A2E0X9P6      DVNQEVLKAELQALNDAPIVYGDETASSGLFALEISNREDI-------------------
A0A2N1UCJ3      QLDTIKAKATLEAVKK--FDSPQKVRQYAMAQPGISSNLFARDM----------------
M5UE94          TEREAESSSRLTVISDF-LASKDASEITDVDRFSLLSEKEVNRLKLMIEMTRGDVASEAF
A0A2E0X4J3      EIELLEAKALHNRVQRM-YESPTLRPLLADMAMDGKPVDTLEER----------------
A0A1P8WN28      QSRRLQLEATLVSAREL-VATNSDLTSALKKLEEIVGEDVLERI----------PGAGAT
A0A3B9CTT0      RSQRMELEAAMKSARRL-VATQADLTPAVQALQRIVGPEVMQQV----------PGRPGL
A0A2D5NDU9      DQRLLTARTEAATAADF-VDNPKLLAQLNLGATETGKPLISPPE-------------ELS
A0A286RGB6      QLRMLRLQGELSIKKAI-RDKAAQIPVTDREIEAAARTDPVILQ----------LQLRES
A0A1V5N3W2      ESKKLALQSLVQLSEQT-KDKTIVPEKLLERRYDFINSDPTLQM----------------
A0A3E0MY27      RIDILRQQLQISQLQRL-EANDPEQVRQRLIS----------------------NTLAAD
A0A286RLF2      QKERVQLAASLQALENA-VQQGADIRQYLFAADDTLGQQILLGV----------LGFSRE
A0A286RD13      RKHVNELRQQISGLERR-IAILQSRLRYMEEHRPQTSEEERRQRDEAVIQQIVENALRAD
A0A3M1QRP3      DKLESRREDLLLAISNR-EARLKRLELLAASGDGAASAPAPDRR----------FSEDS-
A0A2E3RCU8      KKDRLVQQSLVEGIQRA-IVRGEDLKQYAMAIEETLGRELLAKG----------LGFSTD
A0A3E0MY88      ETERIKHQAALESIRAA-IHSGADLNQFLMSAEQSVGRSVLMTA----------LGINDR
A0A1C3E6N1      KEETLRATAQLAALEQA-ISRGEDVLQFAMASLDVVGKQFMMGE----------LGLDSQ
A0A3B8PNV4      QNRTRESRATLEAIVDA-AARGQNIEQFAMQHLEVVGKEFLLRR----------MGLDSQ
A0A3D1DR40      QNRTRESRATLEAIVDA-AARGQNIEQFAMQHLEVVGKEFLLRR----------MGLDSQ
A0A2E7RYU8      QNRTREARATLEAIVDA-AARGQNIEQFAMQHLEVVGKEFLLRR----------MGLDSQ
A0A3B8LXG8      QNRTREARATLEAIVDA-AARGQNIEQFAMQHLEVVGKEFLLRR----------MGLDSQ
F0SI78          LIKSSQVRAELEAIQNA-LNRGTSRQALLMMADQA------RQR----------AGQSSA
A0A350CI62      RRRTEEARTTSQELQRA-IASGEDILQFAMETLDSAGRQLVEQS----------MGLGTQ
A0A3C1X4W5      RRRTEEARTTSQELQRA-IAGGEDILQFAMEALDSAGRQLVEQS----------MGLGTQ
A0A3D3W3A7      RRRTEEARTTSQELQRA-IAGGEDILQFAMEALDSAGRQLVEQS----------MGLGTQ
A0A2E7ENQ5      RKERMRLDASLAAVRRA-ISQGQDVRQFMLSMEDAGGREMALGM----------LGMSTK
A0A1G3AQE9      QSRRAKLEASLAAIEAA-VHDGEDLEKCILLAAEVVGWEVLRNH----------LGSSAD
A0A3L7UQT9      QRVTLDAWSFLQTVEQA-ARTGQDLQQLMFQAVETLGASILSKQ----------MGLGEQ
                                                                            

A0A2G2JCA2      --------------------------------HPDVLTLR------ARIATNGSTALEYE
A0A286U4B3      --------------------------------NKLINELK------LEYTRLNAK--YAS
A0A1G2XVR0      --------------------------------DGSINTLK------AKYADLQAN--KTM
A0A1G3B0P0      --------------------------------DGSINNLK------AKYADLQAN--KTM
A0A1E3X4X0      --------------------------------NRLIQDLK------ADYARLEAQ--VSN
A0A1U9NNE1      --------------------------------DLTIKALT------EDMAKLERD--VLG
A0A1N6KFT7      DTAKRATR------------------------NTNDPSLK------YARERKVEL--ESE
L0DFG4          NTAKRATR------------------------NTNDPSLQ------YARDRKEEI--ESE
M5SZR3          HSLELEDE------------------------RDLAEGLE------AMLLPLKQQ--ERE
M5TW92          HSLELEDE------------------------RDLAEGLE------AMLLPLKQQ--EQE
A0A0S8FY64      -SISIVRS------------------------DPAVAELY------GRLTQIDLD--LQG
A0A2E3GW02      --------------------------------GVQNASIT------SQLIPLMLE--ESM
A0A1I3DDV4      NQATR---------------------------LKEAETKF------GKLIELQAE--MSR
A0A2E3GWC6      --------------------------------TSERQQLD------SQLLPLLLE--EQV
F0SLB0          --------------------------------TSERQQLD------SQLLPLLLE--EQV
A0A255R1S0      ALTEEERMALALE-------------------RQAQQEEF------RRLMALTTR--RDV
A0A0J1B4A0      EMLSRAVM------------------------QESTRTEY------QQLLTLSSK--ERL
A0A1Z8N7H5      --------------------------------IQVRNQLE------QGLLADISS--LKS
A0A2E2CCW9      SQL-----------------------------DRARTALE------THLMPLLIQ--KNR
A0A3C0AGX3      SQL-----------------------------DRARTALE------THLMPLLIQ--KNR
A0A0S8KNX5      --------------------------------DPAVVAFT------ANITELEQE--LVV
A0A3D3UVZ8      --------------------------------DPAVVAFT------GNITQLEQD--LII
A0A354PDV6      DFQATQPAR-----------------------IAEAQTQY------NNVLQLMSE--KQR
M5TIT3          EFKAAMPAK-----------------------AEEARTQI------THLLQLSSE--KQR
F2AXG2          EFKAAMPAK-----------------------AEEARTQI------THLLRLTSE--KQR
M2BB46          EFKAAMPAK-----------------------MEEARTQI------THLLRLNSE--KQR
L7CLQ6          EFKAAMPAK-----------------------AEEARTQI------THLLRLNSE--KQR
A0A0J1B719      EFKAAMPAK-----------------------AEEARTQI------THLLKLNSE--KQR
Q7UF18          EFKAAMPAK-----------------------MEEARTQI------THLLRLNSE--KQR
A0A2G1W1E0      EFKAAMPAK-----------------------MEEARTQI------THLLQLNSE--KQR
K5E235          EFKAAMPAK-----------------------MEEARTQI------THLLQLNSE--KQR
A0A1U7CZ81      --------------------------------DPSVASLI------QQILETDEE--LAH
A0A142YNY8      --------------------------------DPAIADLR------DEILTVRDR--LSH
A0A1U7GLS6      --------------------------------DPMIADLY------GQKQEVERR--RDH
E8R3W3          LVEEYLQR------------------------DRNLLTAQ------VRLQTIKDS--MKK
A0A3D2TNK4      --------------------------------MQVLGDQQ------KKLFTAQQE--LQN
A0A142WSB9      --------------------------------PSGKAELD------GRLLAARLV--ESR
A0A2S8FKY2      DEVAENGDGDSNDGEVADLKLSDVEMDEAIANDPVSVKLQ------AELDRFEDV--RFT
A0A432MJP4      --------------------------------GRSQALAS------DYVRQLINE--QQR
M5UQ35          VMLSR------------------------YLSQQSAKLEY------DKMLELSSK--LSF
A0A3A0DET7      --------------------------------ALRDIELE------RQVQEVEQA--LAS
A0A2A2W9R6      MDIAR------------------------IVANTSSTSKV------NRLMELLSQ--RQV
A0A353FIP5      --------------------------------DPQTSSML------QELAGLIAQ--ARA
A0A2E1VVJ1      --------------------------------DPLLQSLF------QALQKVDAD--AAE
A0A3M2AEL0      --------------------------------DPVTRTML------QELGDLKAK--RIR
A0A351FYP6      P-------------------------------DAQLDALI------REYQTGQTT--LAN
A0A0S8J591      D-------------------------------TDLLQRLRERLYAYQEIVELEKE----D
M5RT57          ----------------------------------------------RALIADRKSMMHRV
A0A1U9NL64      S-------------------------------GTENTRLK------AELDRLELR--LAD
A0A1G2YPI3      Q-------------------------------DSEKAKIK------SRLDELQDR--LAG
A0A2E7ESJ6      F-------------------------------SSRLALMQ------DRYMALVLQ--QEE
A0A2E9VK20      G-------------------------------ATERQQLD------SQLIPLLLE--EQA
A0A3D4PJK1      G-------------------------------ATERQQLD------SQLIPLLLE--EQA
A0A142YJ13      P-------------------------------DPKMMLIQ------DRISELRGRQARLS
A0A0S8GZ23      ----------------------------------------------TTAILVQLQMELSS
A0A2D5AWU0      -----------------------------------LQEIE------KDLLEKELQ--LQR
L0DC26          A-------------------------------IDRVYRIA--------------------
A0A3L7P4E4      S-------------------------------LTPTQKFT------REIFQLELE--EAL
A0A3L7PEB5      A-------------------------------LTPMQKFT------REIFQLELE--EEL
A0A356KTN1      T-------------------------------NHIVLNLR------NRLSEAELD--LAG
A0A2E2N5A9      A-------------------------------AARVDEVS--------------------
A0A225EH48      A-------------------------------IAQFEKLK--------------------
A0A1G2YQB7      T-------------------------------ASNVANLE------QVLITAK-------
A0A353P687      T-------------------------------TSNVANLE------QVLITAK-------
A0A3L7SI46      D-------------------------------AYTVAKHQ------DELLQDQAE--LQN
D5SZ21          E-------------------------------GMAISRMT------EQLLQEQAK--MRT
A0A432MFP3      S-------------------------------DERVNALR------GAIRDVEAR--IAE
A0A257WS34      D-------------------------------GFILARFE------QQLQEYQAQ--LQS
A0A2E8FLY0      D-------------------------------SWMVMRVR------QQLINDQVE--LRN
A0A3D2U1E1      D-------------------------------SYLDGRTR------QQLINDQVA--YRN
A0A1P8WP26      S-------------------------------VFQTTQIT------QDLFDLEAQ--LQT
A0A3L7V1F3      D-------------------------------AFLIQRIN------QELLDLESQ--LSD
A0A2E8B0L9      A-------------------------------TDLVNSVE------RKLLADRAR--L-D
A0A3M1VCL4      D-------------------------------ALVLSRVE------QQLRSDYAE--LQR
A0A2E3GWX1      D-------------------------------QYVYARLQ------QQMIEDKAK--LRD
F0SG60          D-------------------------------QYVYARLQ------QQMIEDKAK--LRD
A0A2E9VST2      D-------------------------------SYAYARLQ------QQLIEDEAS--LRD
A0A356A6X2      D-------------------------------SYAYARLQ------QQLIEDESS--LRD
A0A2E0SMM6      D-------------------------------RVVVSRLQ------DQLKADQAE--LKS
A0A356EME5      T-------------------------------NPQVQALV------QQIWMAETTLREMA
A0A355AI52      D-------------------------------KQTRISVE------KQLLEDRAQ--LDT
A0A354PCQ3      D-------------------------------PKVAEAKTRISRYKSIMINMEDSDLVRV
A0A2E7EGG1      K-------------------------------ALRDQALN--------------------
A0A2E7K7A9      T-------------------------------QVERARLALE----THLMPLLIQ--KNR
A0A1N6DAJ8      A-------------------------------IKAIERVY--------------------
A0A2S8G191      N-------------------------------ILASDEVIAALKSQIMQLEAEIL--NVE
A0A3L7NDH9      D-------------------------------KDTRTSLE------KQLFEERTQ--LET
A0A2E0X9P6      ----------------------------------------------RELESRLAA--QRD
A0A2N1UCJ3      -----------------------------------ETKLR------DELQSLETE--LEN
M5UE94          Q-------------------------------ADQPIRQATAQAEYDEYLTLVMK--EKK
A0A2E0X4J3      ----------------------------------SVLALQ------EQVQAIEMQ--IVA
A0A1P8WN28      D-------------------------------PKAIEELR------AKVALLETE--LNG
A0A3B9CTT0      D-------------------------------VKAIETLE------DKLNDEQGE--LSV
A0A2D5NDU9      T-------------------------------PSAEAAIL------AQVEKLGNQ--RVE
A0A286RGB6      E-------------------------------LKNLVAQT------RDVLRPEIA-----
A0A1V5N3W2      --------------------------------------LT------QRVAQLEET--LVM
A0A3E0MY27      Q-------------------------------QYGQLRGV------VERLRDQEQ--EMM
A0A286RLF2      E-------------------------------TAARLEVE------RKVVEDRVE--LAR
A0A286RD13      P-------------------------------WIAAAQAR------LSYLETRWF--EER
A0A3M1QRP3      ----------------------------------VWRTLS------AELKKAEFE--VES
A0A2E3RCU8      T-------------------------------IHTRSQLE------QGLIEDIAR--LKS
A0A3E0MY88      D-------------------------------VVGHTNLE------RTLLQDRAT--VQG
A0A1C3E6N1      E-------------------------------GMAISRMT------EQLLQEQAK--MRT
A0A3B8PNV4      D-------------------------------TWMVMRIR------QQLINDQVE--LQN
A0A3D1DR40      D-------------------------------TWMVMRIR------QQLINDQVE--LQN
A0A2E7RYU8      D-------------------------------SWMVMRVR------QQLINDQVE--LQN
A0A3B8LXG8      D-------------------------------SWMVMRVR------QQLINDQVE--LQN
F0SI78          E-------------------------------GVQNASIT------SQLIPLMLE--ESM
A0A350CI62      D-------------------------------SYHVQRIM------QEILDRQSA--LTE
A0A3C1X4W5      D-------------------------------SYHVQRIM------QEILDLQSH--LTE
A0A3D3W3A7      D-------------------------------SYHVQRIM------QEILDLQSH--LTE
A0A2E7ENQ5      D-------------------------------EDFAKQLK------RELNDDYAR--LES
A0A1G3AQE9      D-------------------------------GLQAA-LE------KNLVDYRAE--WET
A0A3L7UQT9      D-------------------------------AWAVAKLN------EELQKLRND--WND
                                                                            

A0A2G2JCA2      KTAVNFKDN------ATYQK-----------------------LQKQILADKEDLAKLKI
A0A286U4B3      EL-GRVKEDH-----PLVQR-----------------------LKTEKSLIEQEIKDEQG
A0A1G2XVR0      LS-EKYGEKH-----PNIAN-----------------------IDLQLKEIENRIKLETL
A0A1G3B0P0      LS-EKYGEKH-----PNIAN-----------------------IDLQLKEIENRIKLETL
A0A1E3X4X0      LS-EKYGPRH-----PQMVR-----------------------LLTQMEAIKDKIDFEVK
A0A1U9NNE1      DQ-QTMVSGN-----PRLEQ-----------------------RKEILTALKTRLDQRRE
A0A1N6KFT7      IE-DLWRQRR-----PLLLRQLTREMANEGDLALQKAEAELTSLAAEEASLYETLKESKE
L0DFG4          IE-DLWRQRR-----PLLLRQLSREMADEGDQAIQKAEAELTSLEAEENSLYETLKESKE
M5SZR3          LL-TLFGPGH-----PTLASVRLR---------IEEAKNFYKTLEKEYEEHHVAIREYAD
M5TW92          LL-TLFGPGH-----PTLASVRLR---------IEEAKNFYKTLEKEYEEHHVAIREYAD
A0A0S8FY64      AL-RSFGLKH-----PEVVA-----------------------LNDEREHVLSGLREAMA
A0A2E3GW02      LL-EKLGEQH-----PKVSE-----------------------VRRRTEVMRTLLSQ---
A0A1I3DDV4      LN-GLFGPNH-----PTVEN-----------------------LRKNIEIVEGLLKE---
A0A2E3GWC6      LL-QRYNDGH-----PDVIN-----------------------IRKRIDIILSYYRK---
F0SLB0          LL-QRYNDGH-----PDVIN-----------------------IRKRIDIILSYYRK---
A0A255R1S0      MR-ATFGDSH-----PSVRS-----------------------LDSEIVNLRKYVDN---
A0A0J1B4A0      MA-AEFGENH-----PSVRA-----------------------LRTELDNMRRFVDE---
A0A1Z8N7H5      LS-SDFGPAH-----PRIIE-----------------------IQNRIQTTKQYIEY---
A0A2E2CCW9      LE-RDFQKNH-----PDLDA-----------------------VNRSIETIINLYRRQGL
A0A3C0AGX3      LE-RDFQKNH-----PDLDA-----------------------VNRSIETIINLYRRQGL
A0A0S8KNX5      AK-QTLSPTN-----PEIEL-----------------------KAELIQTLKAHLEE---
A0A3D3UVZ8      AQ-QTLTAEN-----PELIR-----------------------KNELLKTLKKHLED---
A0A354PDV6      LT-TVFGPSH-----PKVKD-----------------------IQDQIDLVKNFLDE---
M5TIT3          LS-SVFGAAH-----PKVQE-----------------------LEGEIALVKQFLQD---
F2AXG2          LT-SVFGPGH-----PKVQE-----------------------LESEITLVKEFLQD---
M2BB46          LT-SVFGPGH-----PKVQE-----------------------LESEITLVKEFLQD---
L7CLQ6          LT-SVFGPGH-----PKVQE-----------------------LESEITLVKEFLQD---
A0A0J1B719      LT-SVFGPGH-----PKVQE-----------------------LESEITLVKEFLQD---
Q7UF18          LT-SVFGPGH-----PKVQE-----------------------LESEITLVKEFLQD---
A0A2G1W1E0      LT-SVFGPGH-----PKVQE-----------------------LESEITLVKEFLQD---
K5E235          LT-SVFGPGH-----PKVQE-----------------------LESEITLVKEFLQD---
A0A1U7CZ81      TV-GVARKGYD----PARQA-----------------------AEKRKAQLMAKYNSLWD
A0A142YNY8      VV-SNARKGND----PSKRA-----------------------HEARLKQLEGQHADFWA
A0A1U7GLS6      VQ-KGARKVAD----PSRVA-----------------------HDARLAELQAEIEGHWR
E8R3W3          FR-NTQDPSYKKLE-TELRY-----------------------REIDFLRLQNEAREAIR
A0A3D2TNK4      LS-MHYGPNH-----PRIIE-----------------------LQQDVRSLDQYINN---
A0A142WSB9      LS-QLVGDNH-----ADLKN-----------------------VRSEITTILSAYRSQGI
A0A2S8FKY2      LT-EAAYERYRQTNSAEINA-----------------------IETSLKERRAHLEK---
A0A432MJP4      LA-DRFGADY-----SRVRD-----------------------IEEQIARVQQVAADSRR
M5UQ35          LR-LTLGGGH-----PSVRE-----------------------VENEIESLKQYVAK---
A0A3A0DET7      ER-ARWGEGH-----PRVKL-----------------------LRQSLAELRDKLTKMQE
A0A2A2W9R6      MR-ASYGAGH-----PSVVA-----------------------LDTEIASIEKFTPQ---
A0A353FIP5      LE-EKHTEKW-----PPLIR-----------------------LRGQIKKLRTNISN---
A0A2E1VVJ1      LA-IEYTDEW-----PALKE-----------------------LRERSVELRGSIRD---
A0A3M2AEL0      LR-AVYTDQW-----PELVE-----------------------LNQRIEELEGRLLL---
A0A351FYP6      KS-IDLGEGH-----PTIKS-----------------------LKAAMESLNQQIDNRIK
A0A0S8J591      KT-RRYRDQD-----RLSRN-----------------------MEVRVEQVNQQIAVEND
M5RT57          ESTAAGGRND-----PSYLR-----------------------LEAEVEGYEASLKRAVA
A0A1U9NL64      LK-RQVTEDH-----PSVIA-----------------------LEEKIASIETDLEESDQ
A0A1G2YPI3      SL-RQMTPGH-----PVVIA-----------------------IESDISRSKAQIANLDD
A0A2E7ESJ6      LE-GRYGKDH-----PDVLT-----------------------VRRQLERYETTYPELVN
A0A2E9VK20      AL-KRYGSGH-----PDVIN-----------------------VRKRIDLVKSYYRQMGI
A0A3D4PJK1      AL-KRYGSGH-----PDVIN-----------------------VRKRIDLVKSYYRQMGI
A0A142YJ13      RN-ARKGNAD-----PAAQA-----------------------LEREIKQLARTLESHRN
A0A0S8GZ23      YK-QRLTLKN-----PEIER-----------------------ITKSIETFEKDLEIYRA
A0A2D5AWU0      ---RERDQGD-----LLLAE-----------------------LRDEVAVLKERKRDILL
L0DC26          -----RNKND-----PAIKK-----------------------HRDDLEAARAGLAAQHR
A0A3L7P4E4      AL-QDHGEDH-----PKVRS-----------------------IRKRIEMTRKYLSNELS
A0A3L7PEB5      AL-LDLGEDH-----PKVQS-----------------------IRKRIEMTRKYLSNELD
A0A356KTN1      LR-QRFSDEW-----HEVRI-----------------------ARARRDQIKLQLQSEIE
A0A2E2N5A9      ---QRYGPGH-----PELIA-----------------------AKADLDAATASLKTQVS
A0A225EH48      ---TAVKEDS-----PLYAR-----------------------EKDHLAKLEEDLRTTLE
A0A1G2YQB7      ---QQLASTN-----PELAR-----------------------KESLLSALKQRLEELKE
A0A353P687      ---QHLAPTN-----PELAR-----------------------KESLLNALKQRLEELRQ
A0A3L7SI46      RL-MTLGPKH-----PTIRQ-----------------------LEDRIQQTQTWLSERRH
D5SZ21          AL-ESYGPNH-----PKVME-----------------------LRDAIQAKEQWMASRRQ
A0A432MFP3      ARTRIRNPGD-----PAL---------------------------SRLMSQRQILMEQYE
A0A257WS34      LL-AKLGPAH-----PEVQA-----------------------LEERIAATQNYIVNRNV
A0A2E8FLY0      KS-GEFGPNH-----PAIQR-----------------------LVARIRDRQKWLADRPK
A0A3D2U1E1      DS-AELGPNH-----PRMQM-----------------------LSARIKARQQWLSKRPT
A0A1P8WP26      AM-KSYGAKH-----PTIID-----------------------LQNQIATKRNFMTQNPA
A0A3L7V1F3      AR-TRYGENH-----SKIKA-----------------------LTENIQLKKKYLEEYPR
A0A2E8B0L9      TARDYLGPTH-----PEVQE-----------------------LVRNIRNAEQHIQEFQA
A0A3M1VCL4      RL-AFLGPNH-----PRILS-----------------------LRDRIRANEQYVTQYRA
A0A2E3GWX1      KLNNKLGPNH-----PEVQE-----------------------LQQRIDGTNEWLEN-RS
F0SG60          KLNNKLGPNH-----PEVQE-----------------------LQQRIDGTNEWLEN-RS
A0A2E9VST2      KLNGKLGPNH-----PEILE-----------------------LKERVKAARDWMNG-RG
A0A356A6X2      KLNGKLGPNH-----PEVLE-----------------------LQERVKAARDWMNG-RG
A0A2E0SMM6      KL-ATLDYNH-----PDVVV-----------------------LTNRISAAEESLNQRLQ
A0A356EME5      AL-ARNPSQD-----PQCVK-----------------------LSQDLERNKKSLEQMRR
A0A355AI52      LQ-EYYGPNH-----PKVIE-----------------------RTRKIEQMQGYLAQFDV
A0A354PCQ3      RR-EYYEENR-----AKMKD-----------------------WEQRLQEAKLAARDPAI
A0A2E7EGG1      -A-SSRGGTD-----PRIIK-----------------------LNQDIESLESTLESLRD
A0A2E7K7A9      LE-RDYKKNH-----PDLDA-----------------------VNRSIDTIINLYRRQGI
A0A1N6DAJ8      -H-IARNRSD-----PSLKK-----------------------YRDELEAARAELVAQRR
A0A2S8G191      QT-AVPGIQE-----QYVGK-----------------------YRDTIVELEEHVRLRKD
A0A3L7NDH9      ML-EFYGPQH-----PKVIE-----------------------RTNKIRKIEQYLDQFDG
A0A2E0X9P6      RL-TRIRKGT-----QKYAE-----------------------TLADVHDAQSALNERKR
A0A2N1UCJ3      AL-IQCSEGH-----PTVKA-----------------------LKSRIEAAQNKLAAQIE
M5UE94          LR-EKFSDGH-----PQIVS-----------------------LREQIEMMRKFIDNNSS
A0A2E0X4J3      EQ-SRWGEGH-----PRVEV-----------------------LLTSLETLQLRLAEKQA
A0A1P8WN28      LR-RHFGSGH-----SDIIR-----------------------REQQLVGQKQRLAN---
A0A3B9CTT0      LR-RHYGSGH-----PEIIS-----------------------RTSKIQLFEQRVKA---
A0A2D5NDU9      LL-VELQPEH-----WRVAA-----------------------LDRDIAALNSQLSKM--
A0A286RGB6      ---ARYGNRY----------------------------------VQELADVQSRIKARRE
A0A1V5N3W2      AQ-QTLAPTN-----PEIEQ-----------------------QTKTLEAFKERTQKQRE
A0A3E0MY27      KL-IKNPDRS-----EVMKR-----------------------LREQIAEAEKDLAKREA
A0A286RLF2      LL-QEFGNNH-----PRVQA-----------------------LQQRIAANEAFLLAYQD
A0A286RD13      QR-AAQGEKA-----PSAQR-----------------------IQEEMETLRKGLEQRRA
A0A3M1QRP3      AR-DQFGESH-----PTMVR-----------------------LRRQVDFYKQQLAERER
A0A2E3RCU8      LS-SDFGPSH-----PKIIE-----------------------IQNRIQTTKQYIEYHDA
A0A3E0MY88      LL-ENLGPNH-----PRVKE-----------------------MTEKIRMTERHLAEYGE
A0A1C3E6N1      AL-ESYGPNH-----PKVIE-----------------------LRDAIQAKEQWMASRRQ
A0A3B8PNV4      KS-GEYGPNH-----PLIQK-----------------------LTARIRDRQKWLTERPK
A0A3D1DR40      KS-GEYGPNH-----PLIQK-----------------------LTARIRDRQKWLTERPK
A0A2E7RYU8      KS-GEYGPNH-----PLIQK-----------------------LTTRIRDRQKWLAERPK
A0A3B8LXG8      KS-GEYGPNH-----PLIQK-----------------------LTTRIRDRQKWLAERPK
F0SI78          LL-EKLGEQH-----PKVSE-----------------------VRRRTEVMRTLLSQEAG
A0A350CI62      AR-QKYGAKH-----ARIRA-----------------------LETELAVKEKYLREFPE
A0A3C1X4W5      AR-QKYGARH-----ARIRA-----------------------LEAELQVKEKYLADFPE
A0A3D3W3A7      AR-QKYGARH-----ARIRA-----------------------LEAELQVKEKYLADFPE
A0A2E7ENQ5      IQ-DYYGSNH-----PTFIE-----------------------VRQSILKKEEYLAEHGT
A0A1G3AQE9      KR-KNLGDNH-----PELIA-----------------------LEDKIRVTEQSLLEYPG
A0A3L7UQT9      RR-NVLGDNN-----PDLLE-----------------------LAQRIRAHEDLVNNYFQ
                                                                            

A0A2G2JCA2      DLKTIGKEDLEA------------------------------------------------
A0A286U4B3      ------------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A1U9NNE1      DIGKKFEELIEEQINRSSE-----------------------------------------
A0A1N6KFT7      KSIE-GLKTRHETLVKTLGADAPESIEAKSQVDRATEQLGG-------------------
L0DFG4          KAIA-SLREKHENLTKTLGPNSPETIQAKADVDQATEQLGG-------------------
M5SZR3          EAVDVGGYRKWKDASGTMEVSARLISEEESKVTLEREDNGKRVTLATASLSGDDQRLLAK
M5TW92          EAVDVGGYRKWKDASGTMEVSARLISEEENKVTLERENNGKRVTLATASLSSDDQRLLAK
A0A0S8FY64      RAVD--------------------------------------------------------
A0A2E3GW02      --------------EAGERTST--------------------------------------
A0A1I3DDV4      ------------SQAKTQNNPL--------------------------------------
A0A2E3GWC6      ---RGIELPVNPANGKAIVGPN--------------------------------------
F0SLB0          ---RGIELPVNPANGKAIVGPN--------------------------------------
A0A255R1S0      -FRAGSEKDAGEEIVETVEAGR--------------------------------------
A0A0J1B4A0      ------------SRENRPEEDK--------------------------------------
A0A1Z8N7H5      ---------HDAELKTQLDELE--------------------------------------
A0A2E2CCW9      DISADNLESGEFQVA---------------------------------------------
A0A3C0AGX3      DISADNLESGEFQVA---------------------------------------------
A0A0S8KNX5      -RRQEASKAFDDLVEKEAAEAG--------------------------------------
A0A3D3UVZ8      -RKQEASNAFDNLVAKESAVAG--------------------------------------
A0A354PDV6      ----------KKDGTSVGA--G--------------------------------------
M5TIT3          ----------KQDLMNPASAFG--------------------------------------
F2AXG2          ----------QKDLTSPAEMFG--------------------------------------
M2BB46          ----------QKDLTSPAEMFG--------------------------------------
L7CLQ6          ----------QKDLTSPAEMFG--------------------------------------
A0A0J1B719      ----------QKDLTSPAEMFG--------------------------------------
Q7UF18          ----------QKDLTSPAEMFG--------------------------------------
A0A2G1W1E0      ----------QKELTSPAEMFG--------------------------------------
K5E235          ----------QKELTSPAEMFG--------------------------------------
A0A1U7CZ81      ERYGEIRQLVMAEDASFAASAA--------------------------------------
A0A142YNY8      QRYPEIRAQILAELEGRPTPTN--------------------------------------
A0A1U7GLS6      DRYHDIRRRVLAAGDGPMAASG--------------------------------------
E8R3W3          RDLEASRLGNRLSSSPRSATPN--------------------------------------
A0A3D2TNK4      -YHSGAGDRLEAMGKSIPKEVV--------------------------------------
A0A142WSB9      VAPTIEKEDLAAVAQGAAAKSG--------------------------------------
A0A2S8FKY2      -LVIERIAQQQAEGDVRKNSMM--------------------------------------
A0A432MJP4      SVESVEVDDL--------------------------------------------------
M5UQ35          -QQQDKPEVADDEVVVSTVDML--------------------------------------
A0A3A0DET7      IVIEAYVESVRQQ-----------------------------------------------
A0A2A2W9R6      -EGDESSEKKESEFDVPPAEIL--------------------------------------
A0A353FIP5      -AVEARGVALKKQ-----------------------------------------------
A0A2E1VVJ1      -NLASRLEGLRSQ-----------------------------------------------
A0A3M2AEL0      -AVQDTLAALEAQ-----------------------------------------------
A0A351FYP6      ------------------------------------------------------------
A0A0S8J591      RMR---------------------------------------------------------
M5RT57          SSRPKITDQLKSLAELDRR-----------------------------------------
A0A1U9NL64      EFA---------------------------------------------------------
A0A1G2YPI3      EFS---------------------------------------------------------
A0A2E7ESJ6      GTI----KPSRQELFDYVT-----------------------------------------
A0A2E9VK20      DLPTMTTKVNPATGESELV-----------------------------------------
A0A3D4PJK1      DLPTMTTKVNPATGESELV-----------------------------------------
A0A142YJ13      TAQRALSAEPERFESSPVQ-----------------------------------------
A0A0S8GZ23      KAGEKFDEAMVRFMEQKRE-----------------------------------------
A0A2D5AWU0      QYA---------------------------------------------------------
L0DC26          KLYPIVARQLQDAGRESSG-----------------------------------------
A0A3L7P4E4      D------QIAPPAKKMDFL-----------------------------------------
A0A3L7PEB5      ETS----STTGPAKKIDFL-----------------------------------------
A0A356KTN1      KIR----ERLRSERDEKVA-----------------------------------------
A0A2E2N5A9      ------------------------------------------------------------
A0A225EH48      EFRSKVEADIRAALKREIK-----------------------------------------
A0A1G2YQB7      QAS----KNFDEMATMEFKESD--------------------------------------
A0A353P687      QAD----KNFDEMAEKEFKESD--------------------------------------
A0A3L7SI46      VVS----SAMKDVRERELG-----------------------------------------
D5SZ21          VTI----DRLKQLRMEELT-----------------------------------------
A0A432MFP3      QLW----SDLEPTLRAQLA-----------------------------------------
A0A257WS34      IVT----ERLKEMRSNELA-----------------------------------------
A0A2E8FLY0      NLI----KQMQQLSTAQLT-----------------------------------------
A0A3D2U1E1      DIS----AQMSSLAKDRLT-----------------------------------------
A0A1P8WP26      MRM----QAAEENSRGYLG-----------------------------------------
A0A3L7V1F3      QQQ----QEMKRLAETELA-----------------------------------------
A0A2E8B0L9      NVN----RRLDGVQSEQMA-----------------------------------------
A0A3M1VCL4      GMA----QQLRAATETHIK-----------------------------------------
A0A2E3GWX1      AQV----AEGSDKINAELG-----------------------------------------
F0SG60          AQV----AEGSDKINAELG-----------------------------------------
A0A2E9VST2      QQA----SQDSKQLTHDMG-----------------------------------------
A0A356A6X2      QQA----SQDSKQLTRDMG-----------------------------------------
A0A2E0SMM6      STN----NEYHQQHNRKQA-----------------------------------------
A0A356EME5      ELA----TQYQVQYRTAISAKR--------------------------------------
A0A355AI52      IGS----PRSFGGDDTQLA-----------------------------------------
A0A354PCQ3      EKLNRLADEELARRTAQAEFDR--------------------------------------
A0A2E7EGG1      TNRPRIREEMKAMSGLQR------------------------------------------
A0A2E7K7A9      EISA---DNLESGEFQVSKVKD--------------------------------------
A0A1N6DAJ8      KLYPIIQQQLQDMGRDDD------------------------------------------
A0A2S8G191      QIV----KGRAQWQAANF------------------------------------------
A0A3L7NDH9      VAA----PREFAGDDEKFA-----------------------------------------
A0A2E0X9P6      EVQ----EELSSARRAERQLQR--------------------------------------
A0A2N1UCJ3      EFA---------------------------------------------------------
M5UE94          KIQAR--DAQERITPAEML-----------------------------------------
A0A2E0X4J3      EIA---------ENRATMI-----------------------------------------
A0A1P8WN28      -------MQLQLGENVNVGVRD--------------------------------------
A0A3B9CTT0      -------ARADLDRRLQIGIRG--------------------------------------
A0A2D5NDU9      -------RSVDAENLESYA-----------------------------------------
A0A286RGB6      EIR----QELEQRRVRDL------------------------------------------
A0A1V5N3W2      DLE----KTFDEMVAKELTENS--------------------------------------
A0A3E0MY27      DVT----LEIEEQEIIPPE-----------------------------------------
A0A286RLF2      RLR----ARLDNLNIPELS-----------------------------------------
A0A286RD13      ELT----PQLVEFAREQLAKGR--------------------------------------
A0A3M1QRP3      ELELAPPATVGVKRDDEFA-----------------------------------------
A0A2E3RCU8      QLK----TQVDNLESNQLG-----------------------------------------
A0A3E0MY88      RIR----AQVGTLQSTTFG-----------------------------------------
A0A1C3E6N1      VTI----DRLKQLRMEELT-----------------------------------------
A0A3B8PNV4      SVV----DQMQKLSKAQLT-----------------------------------------
A0A3D1DR40      SVV----DQMQKLSKAQLT-----------------------------------------
A0A2E7RYU8      SVV----DQMQKLSEAQLT-----------------------------------------
A0A3B8LXG8      SVV----DQMQKLSEAQLT-----------------------------------------
F0SI78          ERT----STKPASARPDLL-----------------------------------------
A0A350CI62      LQR----TRTDTMTREVLA-----------------------------------------
A0A3C1X4W5      MQR----TRTDTMTRDVLA-----------------------------------------
A0A3D3W3A7      MQR----TRTDTMTRDVLA-----------------------------------------
A0A2E7ENQ5      EGA----EIDGFQNQQ-LG-----------------------------------------
A0A1G3AQE9      RIR----QRM--QDAG-LG-----------------------------------------
A0A3L7UQT9      RAK----MNLTANSAD-LG-----------------------------------------
                                                                            

A0A2G2JCA2      -----------------RYLASKEEELSHVEIRLNGLNISVTKIQEMLDKEMKLAKKTSG
A0A286U4B3      -----------------WLGKAIKAEYQEAVGKEKGLR-------QHLEELKRENNRLEG
A0A1G2XVR0      -----------------SLITKVETDYNVLLASEESYE-------KAYNEQSLVVFDLNR
A0A1G3B0P0      -----------------SLITKVETDYNVLLASEESYE-------KAYNEQSLVVFDLNR
A0A1E3X4X0      -----------------KIISSIETKYKVARAKEDSIR-------ESLEKQKEEALRLNK
A0A1U9NNE1      -----------------FQVAELKAELAKVRENERRIR-------EKLEGTNAELITLGK
A0A1N6KFT7      ------LGKDGLQSELHDRMASIEHSLKSIGSMREEYE-------TKLKEDLVAAKQSEL
L0DFG4          ------LGKDVLQSELRDRMTSIEHSLKSIGTMREEYE-------IKFKDDLVSAKQSEL
M5SZR3          IRADRIRKHEELSEMVEMGLTQLRQELDRTVRTQELLR-------GIYDTEYVSAKELTD
M5TW92          IRADRIRKHEELSEMVEMGLTQLRQELDRTVRTQELLR-------GIYDTEYVSAKELTD
A0A0S8FY64      ------SIHSEYAVLV--------------AREQELVR-------VLLEETRVALEQARK
A0A2E3GW02      ------KPASARPDLLTLYMQSLQEELRTNQEKLKELD-------NLFLSERTHSSNLTM
A0A1I3DDV4      ------FEKLTPELLLNAYTGFLRHDLSALDQRKRELL-------TLAAEAEKNSKSLIE
A0A2E3GWC6      ------GQVEPGSDMISTYMTALTQQQAEMKNRLDELQ-------KLYDESTKQAKSFAR
F0SLB0          ------GQVEPGSDMISTYMTALTQQQAEMKNRLDELQ-------KLYDQSTKQAKSFAR
A0A255R1S0      ------VFDVPPSEILKTYYSVLKGDIAGLKKREEELV-------AQSEQEAKVAKEVEL
A0A0J1B4A0      ------RVEAKPADILASYYQVLQSDISEMEKREEQLL-------ELSEKESKLAKEVET
A0A1Z8N7H5      ------SNQLGPL-----LLQMAQQGLDKARQKESILQ-------ASLDEARFXAVAHQR
A0A2E2CCW9      --------ETKDVDFVNVYLKSMEQQLKELENRELELT-------KLFTQESELAKKVGN
A0A3C0AGX3      --------ETKDVDFVNVYLKSMEQQLKELENRELELT-------KLFTQESELAKKVGN
A0A0S8KNX5      ------TKQLVAK----------RSELEQTRQYEKGLR-------ETLSKEDTETIDLGR
A0A3D3UVZ8      ------NKQLVAK----------RSELEQTREYEKRLQ-------ETLSQQDTQTIGIGR
A0A354PDV6      ------AGMLSPEALLKAYVGFLEHDLATLTQRKRELT-------ILAGNAESQAKTLID
M5TIT3          ------SSTLSPEGLLKAYVGFLQHDLATLSERRKELT-------FLAADAETKAKELIE
F2AXG2          ------DSALTPEGLLKAYVGFLQHDLAALSERRKELE-------YLADEAGKEAQTLIT
M2BB46          ------DSALTPEGLLKAYVGFLNHDLAALSERRKELT-------YLADDAGTKAKELIE
L7CLQ6          ------DSALTPEGLLKAYVGFLNHDLAALSERRKELT-------YLAADAESKAKELIE
A0A0J1B719      ------DSALTPEGLLKAYVGFLQHDLAALSERRKELT-------YLAADAETKAKELIE
Q7UF18          ------DSALTPEGLLKAYVGFLNHDLAALSERRKELT-------YLAADAETKAKELIE
A0A2G1W1E0      ------DSALTPEGLLKAYVGFLNHDLAALSERRKELT-------YLAADAETKAKELIE
K5E235          ------DSALTPEGLLKAYVGFLNHDLAALSERRKELT-------YLAADAETKAKELIE
A0A1U7CZ81      ------AAGSGTVATNALTIEALRARVELSRHQLDTLN-------QLVLSMEIERKATQS
A0A142YNY8      ------PVRDESIK----SIPELRADVEALERERKAIT-------EALAQAELETKESNS
A0A1U7GLS6      ------P-GEPRQK----TVQELKDEVSELESRQASLQ-------KVLDEVKLESKESNS
E8R3W3          ------D-LFANATLEQ-----IERSLREDYEWAELLQ-------QDLQQQTRLLVTHNS
A0A3D2TNK4      ------V-NL------------LRQSTQQAIEKEKQIR-------QAYQQARAEAAAYSG
A0A142WSB9      ------N-KKAGVDLPHVYLYILESQLEEFKIREDLLA-------ARRTEAEGTAKESSL
A0A2S8FKY2      ------T-TSLKLPEVDNTIPELKVRIGVLRQQQRELS-------KEVADLEKEVRTFGR
A0A432MJP4      ----------ILS---------IEQAVASVEALQQEYT-------DRFREDLEQARQILN
M5UQ35          ------G-HYFNV---------LKSDVREYEARERDLG-------SLAEVEAKAAKEVQM
A0A3A0DET7      ----------YEL---------LDQKRSELQAAYDASF-------AAATQASSLLVQL--
A0A2A2W9R6      ------A-TYYTV---------LKSDISEFAKRESELL-------ALSEQESKLAKEVEL
A0A353FIP5      ----------IVS---------LDRAISRWQGQLDALP-------AVERKLAKFQRKA--
A0A2E1VVJ1      ----------EST---------LLTALDEYDVRLDGLP-------RAQRELIRLQREA--
A0A3M2AEL0      ----------QVS---------LQDTISRLRENLEELP-------ATERQLARFSRRA--
A0A351FYP6      -----------------GILAGLELRVNSSLAQVRELQ-------KSVDDAKAKEAKVQE
A0A0S8J591      ----------R------AAQSDAAQKLATAQANYEFLS-------DMLLTNRQRLTQISR
M5RT57          -----------------DTLHELEARLETQLVLENLLG-------LRYKEMLGTAGESGN
A0A1U9NL64      ----------S------AQLAVARERHMAAKKQLDEVS-------TFFEEQRAAAMDLND
A0A1G2YPI3      ----------Q------AQLAVSKQESLAAKETEDQIA-------KYYEDQRKQAVALNQ
A0A2E7ESJ6      -----------------RYLASLKQKQIQLKGQYESLT-------GLFNQEEDAAKELQI
A0A2E9VK20      ----------TGNDPIATYVVALEQQQAELKNRIGELQ-------KLFDRSADQAKDFAQ
A0A3D4PJK1      ----------TGNDPIATYVVALEQQQAELKNRIGELQ-------KLFDRSADQAKDFAQ
A0A142YJ13      ----------D------TRSREVEEYLDILREQEKSLV-------QEIAGLESQMSSLNV
A0A0S8GZ23      -----------------ADLTKAKVQLANYQAMESEYS-------RRLVEELEQNKDMGN
A0A2D5AWU0      ----------R------NYKIDAEIAYNEAKNRETSLD-------LDVTSLQEELGKTNR
L0DC26          -----------------SKTTLLQHRISILSKLEGAME-------DDVKRLNGRTRSITQ
A0A3L7P4E4      ----------Q------VYIESLHQQKKAGEERLLQLN-------SLFEEEQRIAKEQLD
A0A3L7PEB5      ----------E------VYVESLQQQKKAGEERLLHLN-------QLFEEEKRIAKEQLD
A0A356KTN1      --------------------------------VEQGLL-------ERDRNLREESRVFAR
A0A2E2N5A9      -----------------QVVSGIQRNYQLAVANEQSQQ-------ALFDSNKYQIQNLSS
A0A225EH48      -----------------SDIEREKQFVTYKTTLTKKLG-------EEIKRLEKELELARG
A0A1G2YQB7      ------L----------LEMQSYNDKLNQLSKHEQQLR-------DMLKSEDSKTIELGR
A0A353P687      ------M----------LEIQEYKYKLEQISLHQQQLR-------DMLVHEDSKTIELGR
A0A3L7SI46      ----------P------KLLEMVKQRLYQAGAHEQAIR-------EDFEIIRSQALSLNG
D5SZ21          ----------P------RLLQMARQRVQHSQQHEASVS-------AQFDIERQNALSLNG
A0A432MFP3      ----------AEETHPVQIVLRAEQRLLRLERERQLLQ-------QKLDLIELADRSESV
A0A257WS34      ----------P------RLLQMAQQRLLQAQARENSLR-------LQFDQAHAAALAMNS
A0A2E8FLY0      ----------P------SLIDMARQRLSYAQSRETALR-------QDFERENRIVSSYEF
A0A3D2U1E1      ----------P------TLIDMSAQKLRYAELREQALR-------DDFNRESQVVSSFEA
A0A1P8WP26      ----------P------KLIEKTEQRLRMARQQVAQIG-------QDIRAEKTQAMELSM
A0A3L7V1F3      ----------P------RMIQYLRQQMESNQQNEDAIR-------AQLDTEKNKAQRLGQ
A0A2E8B0L9      ----------P------MLLGMVEERLSKTWELEADLE-------REYVAAEASAIRLND
A0A3M1VCL4      ----------P------RLRQMAIRRLMVALEEERSLV-------EQFEQLKKQAIELNN
A0A2E3GWX1      ----------P------RLLQMAKQRYQHAMLNEQEIT-------TRFNHEKTLAADMNQ
F0SG60          ----------P------RLLQMAKQRYQHAMLNEQEIT-------TRFNHEKTLAADMNQ
A0A2E9VST2      ----------P------QMLEMAKQRYQHAVTLEQDIY-------QRFMQEKQVASQMNQ
A0A356A6X2      ----------P------QMLEMAKQRYQHAVTHEQDIY-------QRFMQEKQLASQMNQ
A0A2E0SMM6      ----------E------RLLRIAEQKLSQLKGRYTALK-------KSYDEEEEAGRESTL
A0A356EME5      ----------E------ADLASKKFEIESRRRMEEALR-------ERYEKELKKVAPGVA
A0A355AI52      ----------N------TVANILNQRLESAERQEEWLQ-------KSFERAKEESIGLTS
A0A354PCQ3      ------RLAEV------QRQAEAEQGEINRKLSRDQLVTKIAVLREQYDEELTRMEQFGG
A0A2E7EGG1      ----------Q------QELAMLKTQLETQKLIVQSMR-------SNYDAMVEDISQSGG
A0A2E7K7A9      ------VDFVN------IYLKSMEQQLKELENRETALT-------RLFDQETELAKKVGN
A0A1N6DAJ8      ----------D------SSEALLPHRISILAKLETLLA-------SDVKRLSERSASITQ
A0A2S8G191      ----------K------ASVDKARSEVVLLEQMEKQLV-------DSVTTFEKEAKQFGR
A0A3L7NDH9      ----------Q------MISQILDQKVSAAVQHETWLT-------QSFEQAKQDSIGLAS
A0A2E0X9P6      ----------D------RDIVEKKQELQSLATRRVKLA-------ERLEEQLAELKSGGA
A0A2N1UCJ3      ----------K------NYIELLEIEYDAAKQKEAELS-------ASYEQYKQESQSLNI
M5UE94          ----------Q------TYVGLLKNDVMGLQRQRQVLQ-------TRSEQELKLAKQLEQ
A0A2E0X4J3      ----------A------AYVDSVKSAYELLEHKYAELQ-------RSYDRQFSEAKQVSA
A0A1P8WN28      ------PQVGQ------WLIKQIEAEVQATRQYEQSLK-------HEYSVVEADALELSG
A0A3B9CTT0      ------PEAGQ------WLMDSLQAELNSIQQFESSLQ-------EEYNEVRAEALNISN
A0A2D5NDU9      ----------A------TLLAALDRRVASIQAERQVLL-------PLLADAEREVLAVSE
A0A286RGB6      ----------D------EEIENLNFELSILAQQQDQLQ-------KEVENVRRSAETFGK
A0A1V5N3W2      ----------Q------LQLDKAKAELEQIIVQENILR-------DTLTKENADTIDLGR
A0A3E0MY27      ----------V------AQLNLLQNSLTATQEHLAKLQ-------EQSKTLQQRINELTV
A0A286RLF2      ----------Q------MLLGTLRQRVNELWQKEMSLQ-------AQYELARQEAANLAG
A0A286RD13      ------AVAPP------TETEQIQAEIAQAELEKAVLEDELKVALEQFEKEAAEAEQLGK
A0A3M1QRP3      ----------G------MSPRELRWELEDLRAELTNLE-------AHIARKQKEFTSTFE
A0A2E3RCU8      ----------P------VLLRMAQQGLNKAKQKESILH-------ASLEEARFKAVTHQR
A0A3E0MY88      ----------P------TLTHMMEQALASAWHRENQLR-------AAFAEAKEDAVRLNR
A0A1C3E6N1      ----------P------RLLQMARQRVQHSQQHEASVS-------AQFDIERQNALSLNG
A0A3B8PNV4      ----------P------SLIDMSRQRLRYAESREVALR-------QDFERENRTVSSYEY
A0A3D1DR40      ----------P------SLIDMSRQRLRYAESREVALR-------QDFERENRTVSSYEY
A0A2E7RYU8      ----------P------SLIDMSRQRLRYAESREAALR-------QDFERENRTVSSYEY
A0A3B8LXG8      ----------P------SLIDMSRQRLRYAESRETALR-------QDFERENRTVSSYEY
F0SI78          ----------T------LYMQSLQEELRTNQEKLKELD-------NLFLSERTHSSNLTM
A0A350CI62      ----------P------RLVQYLSQQILKLELNEKAVG-------ERLAAEQAKAQKLSQ
A0A3C1X4W5      ----------P------RLVQYLNQQILKLELNEKAVS-------ERLAAEQSRAQKLSQ
A0A3D3W3A7      ----------P------RLVQYLNQQILKLELNEKAVS-------ERLAAEQSRAQKLSQ
A0A2E7ENQ5      ----------E------MLLSSIQGKLNTAIVHEQNLE-------REFQIAQNQAVEVNG
A0A1G3AQE9      ----------P------MLIGLVHHKLAEAQWLEATLQ-------EDFQQAQNRAMEIDG
A0A3L7UQT9      ----------P------QLLGMARQRYQLAMSRQHTLQ-------QQFDREKSEVANHNT
                                                                            

A0A2G2JCA2      DTFELEIKQRELEELSDIHRMIESRILKIRTEQR--APSRVALLP--EIPVPTVPIEKLP
A0A286U4B3      KSISYKVLKREVDANTQLYEGLLQRMKQATVSSQ-IKTTNVQIVD--RAALPTRPVKPKK
A0A1G2XVR0      KITVYRRLQREADSERAFYDILLKRMKESNIAGD-LQTSNVSILD--PAMEPRTPIGASR
A0A1G3B0P0      KITVYRRLQREADSERAFYDILLKRMKESNIAGD-LQTSNVSILD--PAMEPRTPIGASR
A0A1E3X4X0      KAIKYGILKREADTNKDLYEILLTRLKEASMTGA-LKTSNIRILD--AAVVPRHPIKPRV
A0A1U9NNE1      RHLAIKDHQEQLELTKELYDAINRKIQKIEMESQRPARVSVAYYA------SSVIAKDKR
A0A1N6KFT7      GLLEEERLHGNLDRQKALYNTVLDQLKQAQLVSD-YSSISCQVIE--PPSALPYPVQPRV
L0DFG4          ERLEEERLHGNLERQKALYNTVLDQLKQAQLVSD-YSSISCQVVD--PPSALPSPVQPRV
M5SZR3          YEIAEEEFQSNMEHTRQLYDGVVAQLQAASLSRD-YGGFKANVI---SPPGFSWKVKPEA
M5TW92          FEIAEEEFQSNMEHTRQLYDGVVAQLQAASLSRD-YGGFKANVI---SPPGFAWKVKPEA
A0A0S8FY64      VHVY-SRLERDAERQARVFDVIVDRMREVDLTKD-VGVTNVSFVERASPPQAP--VRPNK
A0A2E3GW02      DENRGRVLREDLNRTKKLYDVVLEKLQEISLVDE-TSVLTATVVN--HPSDGS-EVRLKV
A0A1I3DDV4      FELKDKMIQAEMTRKQTLYDSIVEQLREMDTAAG-LSGYIHEVLE--EPQAGE-EVWPAL
A0A2E3GWC6      FESQDQSYKEDLQRIRSLHDVVTRRIEELSLAHD--EGYQLQQIS--PSQAE--LDFKRI
F0SLB0          FESQDQSYKEDLQRIRSLHDVVTRRIEELSLAHD--EGYQLQQIS--PSQAE--LDFKRI
A0A255R1S0      SMLEGTSLKANLERAQARYDEVFKRLQELNLTND-YSGFATDLLV--QPVPARFPIWPSK
A0A0J1B4A0      TFLLGSSLKANLDRAQARYDEVFQRLHEINLTND-YSGFSTDLIV--MPLPASVPVWPSR
A0A1Z8N7H5      DTSHITMLAQNVSRLRRLHDAIIDQIAGVDLRQG-HGEIQATIIK--DATASGQIVSPKI
A0A2E2CCW9      FQVIDQSYNEEIAQLKSQRDNIFKQLLVERVSQG-NSGYMLTQLA--PVKDE--LVIKRQ
A0A3C0AGX3      FQVIDQSYNEEIAQLKSQRDNIFKQLLVERVSQG-NSGYMLTQLA--PVKDE--LVIKRQ
A0A0S8KNX5      TQLTIQELQDGLLLAKEMYDTVQRRIQDLEMQRK-RPARISVAYY--ADIA---RVLDKR
A0A3D3UVZ8      KQLTIQELQEGLESTKEAYQIVLKRIQDLELQRK-RPTRISVHYN--ADIA---SINDKR
A0A354PDV6      YELQDMVLRKKIERQEKLFDGVVQQLRELDTASG-LSGYVYELLE--TPRPGI-RSWPKL
M5TIT3          YELTEMVLQKKILRQEALFDGVIQQLRDLDTASG-LSGYLYEFLE--VPRLGV-KSRPKK
F2AXG2          YELNDMMLRKAIARQEALFDGVVKQLHDLDTTSE-LTGYLYEILS--IPRTGE-KSWPKL
M2BB46          YELRDMMLRKAIERQEALFDGVVQQLQNLDTTSE-LTGYLYEILT--IPRTGE-KSWPKL
L7CLQ6          YELNDMILQKKIAREEALFDGVVQQLRELDTAKG-LTGYLYEFLA--VPRTGE-KSWPKL
A0A0J1B719      YELTDMILQKKIGRQEALFEGVVQQLRALDTASG-LTGYLYEFLA--VPRTGE-KSWPKL
Q7UF18          YELTDMILQKKIGRQEDLFEGVVQQLRELDTASG-LTGYLYEFLA--VPRTGE-KSWPKL
A0A2G1W1E0      YELTDMILQKKIGRQEDLFEGVVQQLRELDTASG-LTGYLYEFLA--VPRIGQ-KSWPKL
K5E235          YELTDMILQKKIGRQEDLFEGVVQQLRELDTASG-LTGYLYEFLA--VPRIGQ-KSWPKL
A0A1U7CZ81      DTYAAERLKADIETLVEQYKHISEKFENLKFAGT-TD-VDVGLID--AAIAVSEPTNNKR
A0A142YNY8      ETYTARYLQAEIDSMTHDQQIVHRRLEDLKFRTD-RDMVRVSLYD--RAAVPRVPSSSKR
A0A1U7GLS6      ATYQAQFLQNEIRVMVDDERVVNRKLQELEFSTN-KDMVRVEQHD--PAVPPKRPSDDKR
E8R3W3          NSFKIEQIKEELNTADRISELLSNRIEEMRV-EL-DAPPRITLIN--PADAVRIVGDPTK
A0A3D2TNK4      SLVQFRALERAVARDEAKSDILTDKIANIDFRQN-QAPIRATVVR--EPIANNNPVTPQI
A0A142WSB9      FDAADQKRKDEIAAKQKELESVRMQIADYNQSRS-QEGYKVSQLS--QVRIE--RSLKQV
A0A2S8FKY2      SSVEVEMKRSEIASLDEILQQLNTEIERTNI-EL-RGAPRITLLS--EAKTGTVTDKKKP
A0A432MJP4      DQAEEENIRAQLDRQQRLFNTVVDQLKQAQLVGE-YSGVVTQTIE--PPHALRKAVRPRV
M5UQ35          AFMEGNSLKANLDRAQARYDEVFQRLQEINLTND-YTGFSTDLLV--TPSPAMLPVWPAK
A0A3A0DET7      -----NSLQEAYERTANMCDILDERIKEVNLTEE-FGAMNVSILE--VAGPATIPSYPSR
A0A2A2W9R6      SFLKGTAFKANLDRAQARYDEVFKRLQELNLTND-YSGFSTDLLV--MPAPANFPVWPSK
A0A353FIP5      ------------NAYEQIYTYLLGKEQEARIAAG-AAVEAISIVD--WAVPPLLRASPRL
A0A2E1VVJ1      ------------SSHEAVYLILMQRLQEAKIAQA-ATIEQVEIID--RALPPRLRALPNV
A0A3M2AEL0      ------------AAFEQIYTLLLTRLQEAQITEA-ASLATVDVID--WAIPPDSRSRPIL
A0A351FYP6      EGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVEIID--KADTPLRAVRPNV
A0A0S8J591      DMLQLEGLRKQQENIEEMRAVLDKAAETVKTYRS-YEDIKARVIS--QADIPKGKFSPNP
M5RT57          KLLELEFARAELEREERVFDLIAERSMALTTESR-APG-RIVLLQ--PAEPTLHPVASFP
A0A1U9NL64      QLAQYTILESEYQQSKKLNDILDERIKELNITED-VGALNISILE--VARAPKDPSKPQK
A0A1G2YPI3      QINKYTLLQSDWEQTKKDCDILNDRMKELSVTED-VGALNISILE--YARPADKPSKPEK
A0A2E7ESJ6      LQAKDEQFQNEIARTQQLFEVVVKSLEEISLVSD-YEGYNYQTLA--KPTVGD-KVAPLL
A0A2E9VK20      YEEREQTLSDELKRIKSLHDIVANRVEVLSLAPD-EGYQLTQISP--SRAEPDIKHVIKI
A0A3D4PJK1      YEEREQTLSDELKRIKSLHDIVANRVEVLSLAPD-EGYQLTQISP--SRAEPDIKHVIKI
A0A142YJ13      KTMDVHWLDEEIEVASSTAKTVGAEVQSMTVEMQ-A-PPRIRLIE--KASIPTLSDPMKR
A0A0S8GZ23      VQFEIRTRQAEMARDQSEYNLVLERIDDIEIKRQ-R---PARITI--SDEASTGPPVTKR
A0A2D5AWU0      ALQQIDNYESEFDSIRDFSEHLKSRLNELDVENQ-TGALNILVID--YGRPSNTPASPDR
L0DC26          NSVDLFSIQEEIANADEVARTIGKEVEALTVELQ-A-PPRIRLLE--KAELPHTKDEIRQ
A0A3L7P4E4      LQIKDKRYRNDIARSELTFNAIVSQFKDADLAVK-AGYHRTQVLA---PATRGYQVEPNF
A0A3L7PEB5      LQIQDKRYRNDIARSELAFNTIMTQLKDTDLAIK-GGNYRTQVLA---PATRGVQVEPNF
A0A356KTN1      RSRLYESLKNEVDANRTFYEEFASRLKDLLHAAP-LAVANARIID--RAK-GAWRVRPSH
A0A2E2N5A9      KEFKVRELALEVEANRALYDTFLVRLKETAATAD-QNSVNVHVVD--RAMVPEEPVKPNR
A0A225EH48      ANVQGIIDLGDLGPLKEQRAAMEKERLDLDLL-D-RSDSRIQLRQ--PAVVSQLLNIQKK
A0A1G2YQB7      KQLAMQDVKEQLDSSKQMLETIQKRVGELEMERK-R---LARISV--AYLASTAPYQDRR
A0A353P687      KQLAMQDVKEQLDNSKDMYSTIQKRIGELEMERK-R---LARISV--AYLANTAPYQDRR
A0A3L7SI46      QMAQIDIMEMDLKRMRLYYDLILEQMKKIDIGAD-S-GLKISVPT--VAKVVPSAVAPKI
D5SZ21          ELAKLEILQMDTKRLRAFYDLVLERIRGIDLGKD-K-GIRTAVVG--EPKVNPRPVHPKL
A0A432MFP3      EQLEISFAMTKLKQYQAMEQQVQRRLEVLRFESR-PADTITVI----------DPATPGL
A0A257WS34      QLAELERIESDVKRMRTYYDHVLDRIKDIDLGAD-D-GLRIRVVS--EPRVNEQPVSPKL
A0A2E8FLY0      QMSRIKLLNFDLARKRELAVALIDQINRTDLGKE-RGGLRTKIVS--QPKAAKSPVTPRL
A0A3D2U1E1      LMGRIRLLNFDLARKRELAIALATRISRTDLGKE-RGGLRTKIVS--QPKVAKAPVSPRL
A0A1P8WP26      TLREIQDINREIERRHEYRASLTDKMDLIDLTGD-T-FIRTEISS--PPRVNQLPVSPRP
A0A3L7V1F3      ILADLARNERENLRLSERIQEYQNQVDGIGINKD-K-MVITSIPR--KPTLSTRPVNPRL
A0A2E8B0L9      RHAELSIVESQVQRLSNVHDMLLDRIANVDLNSE-GGDVRVSMVN--EPKANERPVSPRL
A0A3M1VCL4      RHLQMEILSLELNRLRSLNDLFLERIKELDLGSD-SGALKTEVVS--HPKVVPQPVSPRL
A0A2E3GWX1      RLVLLQMAERDLARLQSDYDMLRERINALDLNQQ-T-SLRTRITK--HAEPNPAPVSPRL
F0SG60          RLVLLQMAERDLARLQSDYDMLRERINALDLNQQ-T-SLRTRITK--HAEPNPAPVSPRL
A0A2E9VST2      RLMMLQLAERDLSRLQNDYDMMRDRINTIDLNKQ-S-SLRTRITK--HAEPNRIPVTPKL
A0A356A6X2      RLMLLQLAERDLSRLQSDYDMMRDRINTIDLNKQ-S-SLRTRITK--HAEPNRTPVTPKL
A0A2E0SMM6      VMSMIKQKETDQERILHQHDTLLQKIREVDLD-D-RAEVLAKIVK--KPEISRDPISPNK
A0A356EME5      DMVSIEFEQAELTRATDVLNLIEQRVVELRTE-R-QAPARVVLFD--EATPPDAPLVEIP
A0A355AI52      DISQLDIVETDLNWLRQLRNTLLNQIASVDIRQE-NGGVRTTVVR--EPVVAERPVSPKL
A0A354PCQ3      TSAELQFAQEELAVSNSVLMKLRDRVAAIRTERR-QDG-AVRTLT--LATPPSSPVTALP
A0A2E7EGG1      QTLDLKFKQAELNRKQQVFDSISERAAQIATE-M-YAPSRVELVQ--KATTPEVPVQNLP
A0A2E7K7A9      YQVVDQAYNEEIAQLKTQRESIFKQLLLEKVAQG-NSGY--TMTQ--LSPVKDELVIKRQ
A0A1N6DAJ8      NSVDLFSVQEEIANADEIARTIGKEVEALTVE-L-QAPPRIRLLE--KAELPRTKDEIRQ
A0A2S8G191      SSIDVEMMRTEIDSLEGILSRLGHEIENTKIE-L-KSDSRVTFFQ--DAQPPKSKNPRSF
A0A3L7NDH9      EMARLDIADHDLRWLRELRNTILNQIASVDLRQE-HGGVKMSVVR--EPLVPSKPVSPNL
A0A2E0X9P6      QSAQLEFAKAELAREEKVFELIAARKLALQTELD-APD-RITLKQ--SAAVPARPLNPIP
A0A2N1UCJ3      KATEYAIIETKLEQSKRFCEILDDRIKELNVSEE-AGALNISILE--TARPAEFATSPKK
M5UE94          AEVQAESMRRDLERRQAIFDDTQSTLKELNFVRD-YAGFSTDVIG--DAESQERPAWPRP
A0A2E0X4J3      LALKLASLQEAIERSESENELVDEQIKEVNLTEK-VGATKVNIME--VALPALEPSYPSR
A0A1P8WN28      KLAGIQVAEREVETLRELHSSLLKRLNSINPDHG-SGAFKVAPLS--DPRIPKFAVYPVL
A0A3B9CTT0      KLASIDFKEREIESLTELRSSLLNRLNSIKISEN-ATHFKVAVLS--DAMVPRTPSLESL
A0A2D5NDU9      HELEYNQLNSRAERTKQTLDNAYAQLQRINIDPD-SGKTVAHVLD--YAEPNEAKLASGQ
A0A286RGB6      GSIEVEFLRAEVELARKTLQTIAEERNRLAIE-L-RAKPRITVVQ--RAEVPRVADSDRR
A0A1V5N3W2      KQLAIQEQQDQLALNQELYETIRRRIQELEVERK-RP---ARISV--AYNASSLPLPSKR
A0A3E0MY27      FKPELERRKDELERLESVSNELGLRLQKLQLELS-VQKPKVSLRG--EATVPAMYDSSNR
A0A286RLF2      GLAQLEMLKNDITGLRELYGGLVRRITSLDLA----GDLRASVIT--EPRENRSPVSPSL
A0A286RD13      YSADLEAERAEVERLKAIAARMGDELERWNIELA-APPRVRVLEE--ASTPRISNINDKY
A0A3M1QRP3      SAGALSKALRELQTMREQYEQIRRTRQQQEIERF-APASIRKIAD--ARPSGAADVDKRP
A0A2E3RCU8      DTAHITMLEQNVMRLRRLHDAIIDQIASVDLRHG-EGEIRATIIK--EAAASGQIVSPRL
A0A3E0MY88      DLHEIQFLEREIGQLSNLYGALADRIASVDLAKD-QGDIRSEIIK--EPAASRVPVSPRL
A0A1C3E6N1      ELAKLEILQMDTKRLRAFYDLVLERIRGIDLG-K-DKGIRTAVVG--EPKVNPRPVHPKL
A0A3B8PNV4      QMSRIKLLNFDLARKRELSVALIDQINRTDLGKE-RGGLRTKIVS--HPKAAKLPVTPRL
A0A3D1DR40      QMSRIKLLNFDLARKRELSVALIDQINRTDLGKE-RGGLRTKIVS--HPKAAKLPVTPRL
A0A2E7RYU8      QMSRIKLLNFDLARKRELSVALIDQINRTDLGKE-RGGLRTKIVS--HPKAAKLPVTPRL
A0A3B8LXG8      QMSRIKLLNFDLARKRELSVALIDQINRTDLGKE-RGGLRTKIVS--HPKAAKLPVTPRL
F0SI78          DENRGRVLREDLNRTKKLYDVVLEKLQEISLVDE-TSVLTATVVN--HPSDG-SEVRLKV
A0A350CI62      TLTELGDLDRQIEHLYDQQKSLQSQSDGIGLN-K-DTFLSTKVSS--RPTVPIRPVSPRL
A0A3C1X4W5      TLTELGDLDRQIEHLYEQQSSLQSQSDGIGLN-K-DTFLSTKVSS--RPTVPIRPVSPRL
A0A3D3W3A7      TLTELGDLDRQIEHLYEQQSSLQSQSDGIGLN-K-DTFLSTKVSS--RPTVPIRPVSPRL
A0A2E7ENQ5      KVARVAIIEHDLRMLRELHDTLRNRIANLDIRQD-QAEVRMAVVS--EATASDSPVHPRL
A0A1G3AQE9      QVARLDNLDREVERLRRLHDVLCDRINDLDLSRE-GQQICATLLD--EPRVNRTPVSPNL
A0A3L7UQT9      LMANLIIVEMERNRLQANDESLLKQIEKLQLV-S-GEGIKVDLNK--LPKAGKLPSSPRL
                                                                            

A0A2G2JCA2      YKN------MLMIF---MVGLAAPFGLAV-LKEALTVKVSGREQLELQSNTPVLAEISQL
A0A286U4B3      RLN------VFLSM---VVGLVMGTGIAF-FLEYLDNTIKSADDVEKHLNATVLGVLEKV
A0A1G2XVR0      NSQ------IMKGV---MIGLALGIGLAF-FLDYLDNTVKSTEDVENYLGVTLLGLVERA
A0A1G3B0P0      NSQ------IMKGV---MIGLALGIGLAF-FLDYLDNTVKSTEDVENYLGVTLLGLVERA
A0A1E3X4X0      KLN------IILAI---IVGLTLGVGLAF-FLDYLDRTLSTPEDVERYLQVPLLGAVGRI
A0A1U9NNE1      QKL------AIVAV---LGSICCGGFLGV-MIDRSDKRMRTPTDLNKSLSTRIIGTTVCP
A0A1N6KFT7      KMT------LLMGL---MTGLFLGIGLAY-LADRLDPRIRTLDEVRKVLEFRLIGTI---
L0DFG4          RMT------LALGL---MGGLLLGMGLAL-LVDRLDPRIRTLDEVRKVLNFALIGTI---
M5SZR3          LIV------FPMAI---FVGTFFGFGLAC-LAELANRTFRTSDEISKHLMLPVIGRIALA
M5TW92          LIV------FPMAI---FVGTFFGFGLAC-LAELANRTFRTSDEISKHLMLPVIGRIALA
A0A0S8FY64      QVN------LILGA---LLGVLLGVGLAY-GLEYLDDTVKTPDDVERRLNMPWLGYV---
A0A2E3GW02      FNY------AGMGG---MGGLAIGMLVGL-LLEYSDKRFRSPEEMMQMLGVPILGHIPEM
A0A1I3DDV4      NIC------VAGGM---FLGLCLGVLVAI-CNDQFDNRFRTPSEIDSALGVPVIAQVGKI
A0A2E3GWC6      LKI------VGGIT---IMLLVATYGLLF-LLALRDTTIKSLADVRSLFEAPILGTLPSV
F0SLB0          LKT------VGGIT---IMLLVATYGLLF-LLALRDTTIKSLADVRSLFEAPILGTLPSV
A0A255R1S0      SKI------AMAGL---MAGGMLGLALAV-LAELIDRTFKNPGEVEKAAGASIIAHLPQM
A0A0J1B4A0      TKI------AALGI---LAGGMLGLALAL-LAEMTDRTFHDPAEVERIVGASILAHVPRL
A0A1Z8N7H5      SRI------IVCWI---LGTLGIGFVLVY-VQDTIDDRFRTPEELSKRVGQPLIGLVRAL
A0A2E2CCW9      LKF------LMAGA---AGGLGLILAFSY-FREMRDTTMKSVDEIRNQLHLPILGEVPCF
A0A3C0AGX3      LKF------LMAGA---AGGLGLILAFSY-FREMRDTTMKSVDEIRNQLHLPILGEVPCF
A0A0S8KNX5      VKY------SAALV---FTALVCGMGLAH-LRDKADQSLRTPDDVAKRIGIRIIGTTTSL
A0A3D3UVZ8      VKY------SVALV---FGSLVCGMGLAY-LRDKADQSLRTPDDVAKRIGIRIIGTTTSL
A0A354PDV6      SIC------ALGGL---MLGLFGGLFLSI-ANDLRDSRFHSAVEFEQFIGLRTLGRIGKV
M5TIT3          SLC------ALGGL---MLGLFMGLSLAV-ANEIQDGRFRSSAELDEAIGLPRLGSVGKL
F2AXG2          PLC------GLGGL---MLGLFSGLFLAV-ANDVRDGRFRSAAELDEAIGLPSLGRVGKL
M2BB46          PLC------GLGGL---MLGLFSGLFLAV-ANDVRDGRFRSAAELDEAIGLPSLGRVGKL
L7CLQ6          PLC------GLGGL---MLGLFSGLFLAV-ANDVRDGRFRSAAELDEAIGLPSLGRVGKL
A0A0J1B719      PLC------GLGGL---MLGLFSGLFLAV-ANDVRDGRFRSAAELDDAIGLPSLGRVGKL
Q7UF18          PLC------GLGGL---MLGLFSGLFLAV-ANDVRDGRFRSAAELDEAIGLPSLGRVGKL
A0A2G1W1E0      PLC------GLGGL---MLGLFSGLFLAV-ANDVRDGRFRSAAELDDAIGLPSLGRVGKL
K5E235          PLC------GLGGL---MLGLFSGLFLAV-ANDVRDGRFRSAAELDDAIGLPSLGRVGKL
A0A1U7CZ81      IKY------VVIVP---SVILCLVLGLFA-LLEVKAERVADPDALSTRVQSEVFSLPPLP
A0A142YNY8      IKL------MAAAP---MGIMALVLGIFS-LLEVKAERVGDPDQLSTRVQSEVYSLPPIP
A0A1U7GLS6      LKL------MAAVP---VGVLAVLIGLFS-LLEIKAERVGNPDALSTRVQSEVYSLPPIP
E8R3W3          RLK------LSGMI---GAGVFFASLVGIALLEFYSNRVDNLNVLGASMGMNVIGAIPTL
A0A3D2TNK4      RLI------AAVCL---LGGTCVGVVMAY-AQDVLADRFNSPEELTLQLGVPVLAMVKKL
A0A142WSB9      LKV------FGACG---LLGLISVFALAY-VREWYDTSVRSVDEVRQLTGAHVLGIVPHF
A0A2S8FKY2      IMI------TAAAA---LAGFVLPGGLLL-LRDFRKKHLSDLPTTRDELGLELLGTIPRL
A0A432MJP4      LLT------LCMAL---MSGLVLGTMAAL-AADGLDSRVRSLDEVRSMLGSRILGVIPRL
M5UQ35          SKI------AAIGI---LLGAMLGAALAM-IAELLDRTFKNPEEVERVVGAPILAHLPLL
A0A3A0DET7      ARF------LAVGL---MLGGVVGFGLAW-LRELLDHRLKSVDEISEVVQLPVFGVVPQS
A0A2A2W9R6      SKI------AIMGV---MGGIMLGLGLAM-LAELADRTFRNPGEVESVVGAPILAHMPML
A0A353FIP5      TLS------SLAGI---LLGLFLGSFFAL-WRESSQKKIRSTAQMEAVTGLTQWASIPDF
A0A2E1VVJ1      RAN------LVVGI---LLGLAIGSILAL-ARESFTRRIRSAAQLEATTQLPVLGTIPDF
A0A3M2AEL0      AMN------TALGL---LLGLVAAFALGL-YREGRVRKILSIAQLETATGLPQVGVIPDF
A0A351FYP6      PLN------ISLGV---IVGLILGVGLAF-FIEYLDTSVKTIDDVERALDAAVLGVIPQN
A0A0S8J591      ALN------LPLGL---VVGLMVGIIAAF-FFEYLNTTIRMPRDIEDGLGLPVLGFVPAM
M5RT57          LRN------MAIAA---FLSGCLPFGLAL-LWELSTKPISDVDQLTSNTTQTTVSEVAKL
A0A1U9NL64      ARV------AAMAL---VLGLMAGGGLAL-LRDFMDKRIRGAEEITALLGLPVLGVIPLM
A0A1G2YPI3      AKY------MAMAL---VMGLMLGGGLGL-LRDFMDQTLHSAEDISAVLSMPVLGVVPSM
A0A2E7ESJ6      LKV------MPIAA---LFGVVVGFGIAY-LVDVADKAFRTPDEVASLMRLPVIGHVPLI
A0A2E9VK20      ---------VGGCL---VMTLMSTYAFLF-LREMRDTSVKSLADLRAIVDTPILGTLPSI
A0A3D4PJK1      ---------VGGCL---VMTLMSTYAFLF-LREMRDTSVKSLADLRAIVDTPILGTLPSI
A0A142YJ13      YKL------SGAAG---AGALVAFLGCLS-LLEFRSRKVDMPDEVSDRLGLRIIGDLPRL
A0A0S8GZ23      EKL------LAALA---IGALALGISFAL-LMGKIDKTIYDPEDIERCIGVPMIGTTSDL
A0A2D5AWU0      VSM------MAYAL---AGGVGLAFAIVM-LRSFSDKKMRIIGELPHVLNVNVVGVMPRL
L0DC26          IKM------AGMAG---CGAFALTLLGIS-LWETRARRIDSAADVIQCLGMNLFGTLPIL
A0A3L7P4E4      QKC------IIVGS---VAGIAVGLLLGL-LVEAADKSFRSPDDISQTLRLPIVGISPQI
A0A3L7PEB5      QKT------MIMGS---ALGVLVGLLLGF-LVEAADKSFRSPDDISQTLRLPIVGISPQI
A0A356KTN1      SRN------VILGL---LFGFGLGAVIAL-IFERLSDRLRTLKDAVNALGIPVLGVVPHQ
A0A2E2N5A9      PLI------VAVAG---LIALFFVAGTGV-VKDVLNDTFTTTEDIENKLNIPVLGIVPLV
A0A225EH48      ILC------GIAAF---FAGFLLIALAVA-FLEWRSRRVDSVDQVVNELGLRVIGTIPAF
A0A1G2YQB7      MQF------SIALM---MAGCVSGMGLAL-LTNKLDVRLKTPDDM-KRIGVRIIGTTTS-
A0A353P687      MQY------SLAIT---MGSLVFGLGLAL-ITNKLDLRLKTPDDITKRIGVRIIGTTTS-
A0A3L7SI46      STT------VFLCT---LFGLMSGMAIIY-VIDVLDDRFRSPDELQTQLGLPMLAMIREM
D5SZ21          SLT------VAVSL---MAGISLGLALVY-LADLLDDRFRSPEETSLQLGAPVLSFIPSL
A0A432MFP3      MLSNKRDKFLALTP---LAMLGLVLGLVT-LVELRSGRVGGTEELSGRLAAEVFA-VPPL
A0A257WS34      STT------GILCL---FLGTTLGLGVIY-LRDAIDDRFKSPDELQAQLGLPVLAMIRQM
A0A2E8FLY0      LVV------ALCAL---TTGLGLGLGLIY-VLDYFDDRFRSPDELQLQTNLSVLAMVGEL
A0A3D2U1E1      LIV------AFAAI---VGGLGSGLGLIY-VLDYFDDRFRSPEELQVQAGLPVLAIVGEL
A0A1P8WP26      VIV------GFLSI---FFGTAGGLGIIW-VLDIMDDRFRAPEELKLQLDTQILTMVPAL
A0A3L7V1F3      AIT------GILSL---MLGSIAGLGIIW-VLDIMDDRFRTPEELKLQLDTQVLSMIPRM
A0A2E8B0L9      ALT------GILSL---IGGLGIGCALVY-VMDLVDDRFRSPDELRDQLGVPVLAMVRRL
A0A3M1VCL4      VLV------ALVAL---TLGTTTGLGMIY-VLDSIDDRFRSPEELQLQLGAPVLAIVRKL
A0A2E3GWX1      TLT------LAMSI---VAGMGLGALTVL-LMDLLDDRFHSPDELKSQLGAPVLAMVREL
F0SG60          TLT------LAMSI---VAGMGLGALTVL-LMDLLDDRFHSPDELKSQLGAPVLAMVREL
A0A2E9VST2      TST------LMLSI---FAGLFLGATTVL-LLDLLDDRFHSPDELKRELGAPVMAMVRSL
A0A356A6X2      TNT------LLLSI---LAGLFFGATTVL-LLDLLDDRFHSPDELKRELGAPVMAMVRSL
A0A2E0SMM6      VRT------ALFSL---IMGISLGVGVIV-VLEALDDRFRSADEIKYHLNLPVLAMVRRM
A0A356EME5      LAK------MGLAA---MVAFCVPFGLAL-GWERIVRRISGAEDLEHETNLAVIGEIARL
A0A355AI52      SLT------ILAVL---TGGLASGIGIIF-VIDTLDDRARSPEELQAELNLPTLATIGIL
A0A354PCQ3      VKH------MGMAA---SAAMMVPFLFGL-LWEL---RMRRITDSSMCGELSVIGEIARL
A0A2E7EGG1      WKM------LLVSV---LASISLPFGLFL-IWERTLKRVTSSEQLQVDNNLPVVGEIACL
A0A2E7K7A9      LKF------LMAGG---AAGLGLVLAFSY-FREMRDTTMKSVDEIRNQLHLPMLGEVPQF
A0A1N6DAJ8      IKM------AGMAG---CGAFALALVGVS-FWEFRSRRVDSAADVIKSLGMNLFGTLPSL
A0A2S8G191      AKI------GMFG----FAGMMIPVAGFV-FWDLRSQRINAPSDISKNLRINVLGAIPFV
A0A3L7NDH9      LLT------LVAVL---VGGGAVGIGMIV-VVDVLDDRIRSPEDLQTFAGLSLLTMMGSL
A0A2E0X9P6      YEL------LLVVC---AASLATPFAVGA-LREVSVRRIATADDLERETALNLLGEVTRF
A0A2N1UCJ3      APT------LAASL---ILGLLFGLALAI-TRERLDWRLRSAEEISMVLATPVLGIVPSM
M5UE94          LIV------LALGI---FAGGMFGMGMAL-LADLMDTTFVDPDDVQATLGAPVLAHVPRF
A0A2E0X4J3      PKF------LAAGV---MLGSLMGFGLGW-LRNLLDHRLKSADEIGEALQLPLVGAIPLA
A0A1P8WN28      TNT------LVMFC---VAAVALALGVIY-VIDLMDDRLRSPEEVRDELGLNVLGIIRKL
A0A3B9CTT0      NSR------LIFYC---VLAVMAAMGVIY-VLDLMDDRLRTPEDVQDELGLPVLGIIRRL
A0A2D5NDU9      PIR------LPTGI---LLGLLAGIALAW-FQGMLDTRVRTAEELQRRLPVPILASMPQT
A0A286RGB6      IQL------AIMGG---LAGFILPGAVLL-WWDVRRKPVNTAHELPHAVGVDVWGTIPLV
A0A1V5N3W2      IKL------MGAAL---FGALAAGIFLAF-VRDKADKNLYTPEDLARTVGVAVVGTTSQL
A0A3E0MY27      DRY------TVLAA---LAGFGLAIVGVS-LYEFQFRRLSSAHDMTEGLGMTVMGDVPLL
A0A286RLF2      PRV------LIMVI---LGGLTLGMFVVY-VMDVLDDRFRSVEEIQWQLRAPVLSIIREM
A0A286RD13      RLV------SFLGL---MAFLGTGAAVV--LLDFFLRPVSSAYQISYGLGLPVLGDLPLI
A0A3M1QRP3      KLS------LAAVFGAAFAGLLAGLARAY-FTGALFE----VEGLHDRTVSQAGPLLGPL
A0A2E3RCU8      SRV------IVFWF---LATIGIGFALVY-VQDTIDDRFRTPDEMSKRVGYPIISLVRAL
A0A3E0MY88      KTV------AAACL---FSGLVIGGVVIF-VLDTLDDRFRSPEDVTMRLGAPTLAMVAQL
A0A1C3E6N1      SLT------VAVSL---MAGISLGLALVY-LADLLDDRFRSPEETSLQLGAPVLSFIPTL
A0A3B8PNV4      LVV------ALCAL---ACGLGAGLGMIY-ILDVLDDRFRSPEELRLQLDVPVLALVGEM
A0A3D1DR40      LVV------ALCAL---ACGLGAGLGMIY-ILDVLDDRFRSPEELRLQLDVPVLALVGEM
A0A2E7RYU8      LVV------ALCAL---ACGLGGGLGVIY-ILDVLDDRFRSPEELRLQLDVPVLALVGEM
A0A3B8LXG8      LVV------ALCAL---ACGLGGGLSVIY-ILDVLDDRFRSPEELRLQLDVPVLALVGEM
F0SI78          FNY------AGMGG---MGGLAIGMLVGL-LLEYSDKRFRSPEEMMQMLGVPILGHIPEM
A0A350CI62      PIA------VLLSL---LIGTGTGLAVIW-VLDIMDDRFRTPEELKLHLETQVLSMIPRM
A0A3C1X4W5      PIA------VLLSL---LIGTGTGLAVIW-VLDIMDDRFRTPEELKLHLDTQVLSMIPRM
A0A3D3W3A7      PIA------VLLSL---LIGTGTGLAVIW-VLDIMDDRFRTPEELKLHLDTQVLSMIPRM
A0A2E7ENQ5      LTV------LATVI---VSGLSLGIGLAY-VLDVLDDRFRSVDELKDQLNVAVLAIVRQL
A0A1G3AQE9      ART------VLAVL---TLGLGLGLGAVY-ILDILDDRFRSREEMQSVLGVPALAIVQEL
A0A3L7UQT9      VLV------VAVCF---ILGIGGGLGLIY-ILDLLDDRFRSPDELRMQLGVPVLAMVRAM
                                                                            

A0A2G2JCA2      PKRRTMSP---------------------GNSTVSTSLRMYEESIDS--------LRTNI
A0A286U4B3      EVERDEVENF-------------------DTILHELPKSTFAEAVRN--------VRTGI
A0A1G2XVR0      KQSKENKDANL------------------ELLTSEAPKSVFSETIRN--------IRTGI
A0A1G3B0P0      KQSKENKDANL------------------ELLTSEAPKSVFSETIRN--------IRTGI
A0A1E3X4X0      EMDKQKRRSEQPTPASGLGGIADDNVFVPELFVHRKSKSNIAEAIRN--------IRTNI
A0A1U9NNE1      TE-----------------------------VKRSELSERLADDYRT--------IRANI
A0A1N6KFT7      -------PKLLVDQLTLMG-EV-------GLVSHAMPRSVWAEAYRS--------VRTSL
L0DFG4          -------PKLRSDQISLMG-EI-------GLVSHAMPRSVWAEAYRS--------VRTSL
M5SZR3          RV--SAKPQLDPEEMDDSL-DR-------SLCTYFRPISVESESYRA--------LRTTL
M5TW92          RL--SAKPQLDPEEMDDSL-DR-------SLCTYFRPISVESESYRA--------LRTTL
A0A0S8FY64      -------PQMHSDGSREGLVSL-------AQHAIQHATDSSTEAFRS--------IRTNI
A0A2E3GW02      PA--SQKRRKRNKSGDTVPIDP-------TLVNYHRPNSRIAEAYRL--------IRGTL
A0A1I3DDV4      TR--SRDKRKKGR-------------------MIVDAQAPEAESFRL--------LRTYL
A0A2E3GWC6      TN--PQKNLEMARQTG---TSP-------MLYYYHDPASPEAESCRS--------VRATF
F0SLB0          TN--PQKNLEMARQTG---TSP-------MLYYYHDPASPEAESCRS--------VRATF
A0A255R1S0      VE--SKLAKQAKVGSK---ISP-------MITTFHQPRGIDAETFRV--------LRTTL
A0A0J1B4A0      KE--SALKKKVKEGSG---ISA-------MIPTFHLPRGTEAETFRV--------LRTSL
A0A1Z8N7H5      PE--LSGEGLKKVS------------------AFSDPVSVFVESFRT--------LRTSL
A0A2E2CCW9      AD--SDAAVD---ESE---FAP-------ALWYYYRPASREAEAFRS--------LRTSL
A0A3C0AGX3      AD--SDAAVD---ESE---FAP-------ALWYYYRPASREAEAFRS--------LRTSL
A0A0S8KNX5      HT--VKPALL---------------------------PERIIGDYQT--------IRANL
A0A3D3UVZ8      NT--VKPALL---------------------------PEQIVGDYQT--------IRANL
A0A354PDV6      NS--MRQGVKGLIATE---------------------LTPDAEAIRM--------MRTLL
M5TIT3          NS--INQGVAGLIATE---------------------LSPNAEAFRL--------GRTVL
F2AXG2          NS--INQGIKGLIATE---------------------LSPDAEAFRL--------GRTVL
M2BB46          NS--INQGIKGLIATE---------------------LSPDAEAFRL--------GRTVL
L7CLQ6          NS--INQGIKGLIATE---------------------LSPDAEAFRL--------GRTVL
A0A0J1B719      NS--INQGIKGLIATE---------------------LSPDAEAFRL--------GRTVL
Q7UF18          NS--INQGIKGLIATE---------------------LSPDAEAFRL--------GRTVL
A0A2G1W1E0      NS--INQGIKGLIATE---------------------LSPDAEAFRL--------GRTML
K5E235          NS--INQGIKGLIATE---------------------LSPDAEAFRL--------GRTML
A0A1U7CZ81      MV--RASNKLNGPA-----------------------EDDQIDRFIQ--------RLDHL
A0A142YNY8      MS--RSPRRLGAPG-----------------------DDDQIERFIQ--------RLDHL
A0A1U7GLS6      MA--RSPRRLGAPG-----------------------EDDQIDRFIQ--------RLDHL
E8R3W3          PR--QTNSSRSISKPN---DRQ-------VVW-----EGMLRESINE--------IRSHV
A0A3D2TNK4      DA--LNGENLET------------------IHTHACPNAPETEAFRT--------LRTVL
A0A142WSB9      QK---RNQNSAMAHTG---ISP-------QVVYLHHPGSRESEAYRS--------LRTTL
A0A2S8FKY2      PR--GIVRKPKALSHN---LGP-------Y-------EDQVRDSSDS--------VAATV
A0A432MJP4      SK--AELAETTEPG----------------LVVHQRPGSLTAEAYRA--------LRTGL
M5UQ35          KT--SKLKRHVRPGSV---VSP-------MIVAFHAPRSSEAETFRV--------LRTGI
A0A3A0DET7      SA--SADRALAGQ------------------LVLQAPRSSVAEAIRT--------LRTAL
A0A2A2W9R6      RE--SRLQKQAIKDSE---ISP-------MVAAFHVPRATDAETFRF--------VRTSL
A0A353FIP5      RH--GANKIEAAKGKE-----H-------FLALLDAPDSRVAEAYRG--------LRANL
A0A2E1VVJ1      RR--GLARSQRARGKV-------------FLALLHDPESAAAEAYRS--------LRASL
A0A3M2AEL0      RR--GGTRSKHSRARD-------------YLPLRDEPDSPTAEAYRA--------LRANL
A0A351FYP6      ---------------------V-------GSLMDEGDESPHAEAYRV--------LRTNI
A0A0S8J591      SPKFKDFAT------------R-------SLISHLDSRSGPAEAFRG--------IRTEV
M5RT57          PVRTI----------------S-------IGSRQTKAMSIFEESIDS--------LRVGL
A0A1U9NL64      SK--RKSMAE-----------R-------GRRVALNPSSPVSEAYRT--------VRTAV
A0A1G2YPI3      SR--RESVTD-----------R-------GRKTYLDSKSNWAEAYRT--------IRTAV
A0A2E7ESJ6      DPEKIPKLPGCNIE-------P-------IMCTVHKPKSPQAESYRA--------VRTAL
A0A2E9VK20      ANPAKNLQAARETGLA-----P-------MLYYYHDPGSPEAEACRS--------VRATF
A0A3D4PJK1      ANPAKNLQAARETGLA-----P-------MLYYYHDPGSPEAEACRS--------VRATF
A0A142YJ13      DHARLDDPSG-------------------------RDRDRLVQSIDA--------VRTML
A0A0S8GZ23      TH-----------------------------VEKKLLLEQVAEDYQT--------IRANL
A0A2D5AWU0      KG--PRSRAR-----------T-------GRIVEEQPGSSAAEAIRN--------LRTAT
L0DC26          PR--RSRILG-----------S-------GDAEHRRWGSMLIESVDA--------ARTAL
A0A3L7P4E4      QLGRRDRTNPID---------P-------AIVTIHRPRSQSAEAFRG--------VRTYL
A0A3L7PEB5      QLGRRDRTNPID---------P-------AIVTIHRPRSQSAEAFRG--------VRTYL
A0A356KTN1      REDE-----------------V-------ELLALRESRSVYAEAFRR--------ARVQL
A0A2E2N5A9      QQ--AQGAQL-------------------ARMYSEGNNPLFTETIRT--------IRTKL
A0A225EH48      PS----------------------------KSSLRSGDAGQAQNWRFVLNESVNSARTML
A0A1G2YQB7      ---------------------K-------EKIKESMWPRQLADDYHA--------ICINL
A0A353P687      ---------------------R-------DKIKKAMWPRQLADDYHS--------ICINL
A0A3L7SI46      EA--LDGSGL-----------D-------AIVTYAKPDSLEAESFRT--------LRSS-
D5SZ21          PT--YDGNGL-----------D-------SVHAFVAPHESSTEAFRT--------LRTA-
A0A432MFP3      PTTRDAERAR-----------L-------EGPGYDPKFEQFVQQLDH--------LRVA-
A0A257WS34      PQ--PEGEGI-----------Q-------QVLTFVKPSAAEAECFRT--------LRSA-
A0A2E8FLY0      PA--ADGPGL-----------A-------SVPTFSEPNGVETEAFRT--------LRTA-
A0A3D2U1E1      PPGNAETKGL-----------D-------AVQTFAEPNGSENEAFRT--------LRTT-
A0A1P8WP26      EQ-FS-GEGF-----------N-------SVLCHVKPNSTEAESFRG--------LRTN-
A0A3L7V1F3      EE-LQ-GEGF-----------A-------AVMCHSKPHSKEVEAFRA--------LRTS-
A0A2E8B0L9      TV-AG-NEGA-----------E-------SLQVHVAAGAVESEAFRT--------LRTT-
A0A3M1VCL4      QQ-LE-GTGV-----------A-------SVLTFAKPNGVETEAFRT--------LRLK-
A0A2E3GWX1      PM-LDVETGL-----------E-------SIYTHTKPNSVETEAFRT--------LRTA-
F0SG60          PM-LDVETGL-----------E-------SIYTHTKPNSVETEAFRT--------LRTA-
A0A2E9VST2      PA-LPHTHGL-----------E-------SIFTYTKPNSVETEAFRT--------LRTS-
A0A356A6X2      PT-LPHTHGL-----------E-------SIFTYTKPNSVETEAFRT--------LRTS-
A0A2E0SMM6      EE--TGGYAI-----------D-------AVQTHVNPNSVESEAFRT--------LRTA-
A0A356EME5      PE--RSTKAGK----------T-------TSRRMAQKLRLYEESIDS--------MRTFL
A0A355AI52      EE--EDFEDGIGL--------E-------TVHMWNISDDAAAESFRT--------IRTVL
A0A354PCQ3      PS--GTRSYK--------------------------GRRIFEESIDS--------LRANL
A0A2E7EGG1      PE--KSIT-------------H-------ELDDDIDQLGLFEESIDS--------LRTGL
A0A2E7K7A9      TE--EPAHMDDSQFD------S-------ALWYYYRPASREAEAYRS--------LRTSL
A0A1N6DAJ8      PQ--RSRGFR-----------S-------GEAENVRWKSMLVESVDA--------ARTTL
A0A2S8G191      P--------------------R-------SVLVNSSRNSKKQEYWKNLIAESVGGIVARL
A0A3L7NDH9      ED--EADRDEEGSGL------E-------STHMHKSNDDAASEGFRT--------LRTV-
A0A2E0X9P6      PM--RPVASRLR---------S-------LPAWHHREMIVFAESIDS--------LRTQL
A0A2N1UCJ3      SD--KGKKDNGN---------K-------GQKVHLEPKSSIAEAYRS--------IRTSV
M5UE94          DP--IKRKRKDPPFEID----S-------SIRVHHQPRTPAAEVFRV--------LRTGL
A0A2E0X4J3      PG--VKNRAE-----------A-------GMMLVNAPRAAFSEAVRT--------LRTSF
A0A1P8WN28      PQ--HEVDQ------------A-------RIYVNDFPQTTHAECFRT--------LKTS-
A0A3B9CTT0      PE--EQLSQ------------C-------KIYLEKFAQTVQAEAFRT--------LKTA-
A0A2D5NDU9      QA--APKET------------D-------APTTTWDNEHEFAEAART--------LRTAI
A0A286RGB6      PT--RA---------------L-------QMLPEENGRSRRYQRWRALFSESVRKVAARI
A0A1V5N3W2      NY--RDKIGL---------------------------RQQLVSDYQT--------IRSNL
A0A3E0MY27      S--------------------E-------RPWRLPGMSGIDPISLQGMMDESVDSIRSLL
A0A286RLF2      PP--REGEGV-----------E-------VLEVVADPNSPASESFRT--------LRTA-
A0A286RD13      E--------------------R-------PIMRWMSRNGHMPETMRSVLIESVDQLRTIL
A0A3M1QRP3      PL--VR---------------D-------PRSATAEEFTVQSECVRM--------VRTAL
A0A2E3RCU8      PE--LGGKGI-----------E-------KVSAYNDPASVFVESFRT--------LRTS-
A0A3E0MY88      DM--THQTGV-----------E-------AVHTHVDPNSPECEAFRT--------LRTA-
A0A1C3E6N1      PT--YDGNGL-----------D-------SVHAFVAPHESSTEAFRT--------LRTA-
A0A3B8PNV4      PV--TDELGL-----------S-------SVRMLSEPNSTDTEAFRT--------LRTA-
A0A3D1DR40      PV--TDELGL-----------S-------SVRMLSEPNSTDTEAFRT--------LRTA-
A0A2E7RYU8      PV--TDEPGL-----------S-------SVRMLSEPNSTDTEAFRT--------LRTA-
A0A3B8LXG8      PV--TDEPGL-----------S-------SVRMLSEPNSTDTEAFRT--------LRTA-
F0SI78          PA--SQKRRKRNKSGDTVPIDP-------TLVNYHRPNSRIAEAYRL--------IRGTL
A0A350CI62      TE--LPGEGF-----------E-------AVMCHVRPHSREVEPFRA--------LRTS-
A0A3C1X4W5      SE--LPGEGF-----------D-------AVMCHVRPHSREVEAFRA--------LRTS-
A0A3D3W3A7      SE--LPGEGF-----------D-------AVMCHVRPHSREVEAFRA--------LRTS-
A0A2E7ENQ5      SP--TSATGV-----------D-------SLQVHVAPNDVASESFRT--------LRST-
A0A1G3AQE9      KM--NQNSGI-----------D-------QLPTYASPNAAEVEAFRT--------LRTA-
A0A3L7UQT9      EP--TGGTGA-----------D-------AVLCHAKPNGVETEAFRT--------LRTA-
                                                                            

A0A2G2JCA2      MLP--NNSDDI-----KV---IVVSSACSREGKTSVACQLAISLARSSGRKTLLIDGDMR
A0A286U4B3      MLS--SADNPK-----RI---MLVTSTTPSEGKTFVASNLAIVIAKTGKK-TLIVDCDFR
A0A1G2XVR0      MLS--TTDTPH-----KS---LLITSTKQGEGKSFIAANLAIAFAQTGKK-TLLVDTDFR
A0A1G3B0P0      MLS--TTDTPH-----KS---LLITSTKQGEGKSFIAANLAIAFAQTGKK-TLLVDTDFR
A0A1E3X4X0      IFT--ATDTPR-----KL---IMIASANPDEGKTFFVSNLATVIAHTGKK-VLMVDTDMR
A0A1U9NNE1      SM---LEEENQ-----HI---LAVTSSQPKDGKTTFSINFAASLAQNDRK-VLLIDGDLR
A0A1N6KFT7      EFL--RRSRQV-----QL---ILVTSAHSGDGKTTTASNLAISFAMAGRK-VLLVDGDLR
L0DFG4          EFL--RRSRQV-----QV---ILVTSSHSGDGKTTTASNLAISFAMAGRR-VLLVDADLR
M5SZR3          FFH--NRSREQ-----SV---IQVTSACPGDGKSTVAGNLGVSIAQSGKR-VLLIDADLR
M5TW92          FFH--NRSREQ-----SV---IQVTSACPGDGKSTVAGNLGVSIAQSGKR-VLLIDADLR
A0A0S8FY64      YFS--GQRGEM-----KT---LMVTSAAPQDGKTVFAANLATTMAQDGKR-VLLVDADLR
A0A2E3GW02      LLT--MGGERA-----RV---IQFTSPDPGDGKSTTCSNIALATANSGKR-TLVIDLDLR
A0A1I3DDV4      LRE--VKAGNL-----RT---AMITSSQAKDGKSTILANLGASFAELGLK-VLIIDGDMR
A0A2E3GWC6      FVR--ASDAGA-----RI---IQFSSPEPGDGKTTTISNLAISMAQAGKK-VLLIDADLR
F0SLB0          FVR--ASDAGA-----RV---IQFSSPEPGDGKTTTISNLAISMAQAGKK-VLLIDADLR
A0A255R1S0      LFM--AKRQSK-----KI---FMITSPSPADGKSTTIANLAVSMAQTGKR-VLLVDADMR
A0A0J1B4A0      LFL--TKSQSK-----KV---FLLTSPSPSDGKSTTIANLAVSVAQTGKR-VLLIDADMR
A0A1Z8N7H5      TLS--GVDS-------TR---IAFTSSEPGDGKTTVIANLAVVCAQSGKK-TLLIDGDLR
A0A2E2CCW9      LLK--TDRSGA-----KV---LQMTSAEPGDGKTTSISNLALAIAQTGRK-VLIVDADLR
A0A3C0AGX3      LLK--TDRSGA-----KV---LQMTSAEPGDGKTTSISNLALAIAQTGRK-VLIVDADLR
A0A0S8KNX5      GLL--GGEGIP-----KK---LVITSPGMKEGKTTFAINLATSIAESGKR-VLLVDGDLR
A0A3D3UVZ8      KLL--GGRGIP-----KK---LVVTSPGMKEGKTTFSVNLATSLSESGKK-VLLIDGDLR
A0A354PDV6      LMD--VKSKKL-----QT---IAMTSPMQGDGKSTVISNLAVSFSQLGMS-VLVMDCDLR
M5TIT3          LPE--IRSGKL-----RT---IGFTSSMQGDGKSTVAANFAVSFSQIGLR-VLVIDADMR
F2AXG2          LPD--IRSGKV-----RA---IGFTSPMQGDGKSTVVSNFAVSFSQVGLK-VLVIDADLR
M2BB46          LPD--VRNGNV-----RA---IGFTSPMQGDGKSTVVSNFAVSFSQVGLK-VLVIDADLR
L7CLQ6          LPD--IRKENV-----RA---IGFTSPMQGDGKSTVVSNFAVSFSQIGLK-VLVIDADLR
A0A0J1B719      LPD--IRSGSV-----RT---IGFTSPMQGDGKSTVVSNFAVSFSQVGLK-VLVIDADLR
Q7UF18          LPD--VRNGNV-----RA---IGFTSPMQGDGKSTVVSNFAVSFSQVGLK-VLVIDADLR
A0A2G1W1E0      LPD--IRNGNV-----RA---IGFTSPMQGDGKSTVVSNFAVSFSQVGLK-VLVIDADLR
K5E235          LPD--IRNGNV-----RA---IGFTSPMQGDGKSTVVSNFAVSFSQVGLK-VLVIDADLR
A0A1U7CZ81      RFA--VCGDHPEVGLGRC---VLITSAIGGEGKTTLAAQLAARCGHAGHS-TLLIDADLR
A0A142YNY8      RFA--VCGDHPEVGLGRC---VLISSAVGGEGKTTLAAQLAARCGHSGHS-TLLIDADLR
A0A1U7GLS6      RFA--VCGDHPDVGLGRC---VLISSAVGGEGKTTLAAQLAARCGHSGHA-TLLIDADVR
E8R3W3          LHA--NMPTPP-----RV---LLVTSSMPREGKTTLSSYLAVSMASCGHR-TLLVDCDFR
A0A3D2TNK4      SLS----EQNC-----ER---ILISSSEPGDGKTTISANLSVALAQAGHR-TLVIDADLR
A0A142WSB9      FFS--TRETGE-----KV---IQVCSAEPGDGKSTTTANLAVALAQSGKS-VVLIDADLR
A0A2S8FKY2      LRR--SLSEQC-----QV---LLISSAMPREGKSSLTCHLAISLAQAGRK-VVVVDFDLR
A0A432MJP4      EFV--RRERDV-----RV---IVVCSPSPGDGKSTVTSNLAIGLAQAGRR-VLLIDCDLR
M5UQ35          IFR--CKSEGK-----RA---FMITSPSPADGKSTMIVNLAASMAQTGKR-VLLVDADMR
A0A3A0DET7      HFG--MAGEDV-----KV---LAITSPMPGDGKTTIASNLALAMAQADQR-VLLIDADLR
A0A2A2W9R6      LFL--AKKQSK-----QV---FLVTSPSPSDGKSTTIANLAVSMAQAGKR-VLLVDADLR
A0A353FIP5      TFA--AKRNEI-----KS---LAITSASQGEGKSTTIADLAISLANSGAT-VLLVDADLR
A0A2E1VVJ1      RFA--TGGREI-----RT---MAITSAGQGEGKSTTLADLAIALAQGGKK-VLLVDADLR
A0A3M2AEL0      RFL--AKGQAI-----KT---LAITSSVQGEGKSVTTCDLAVALAQTGAR-VLLVDADLR
A0A351FYP6      LFA-GRKSEDQ-----TT---FTVVSGGAGEGKTTTMFNLAVVFAQMGDR-ILVVDSDLR
A0A0S8J591      MLR--SDLRQV-----KT---GMVTSTSPQEGKTTVAVNWAITLAQAGNK-VLLIDGDLR
M5RT57          LLG--EKHNDI-----QT---LVVTSAVHGEGKSSISSQLAVSIGRATGEPVLLIDGDLR
A0A1U9NL64      FFG--VPKESC-----KT---ILVTSPQPAEGKSTLISNLGITMAQAGQK-TLIVDADFR
A0A1G2YPI3      FFG--APKDEA-----KT---ILVTSPMPADGKTTLASNMAIAMAQAGQR-VLILDADFR
A0A2E7ESJ6      YFN--SRGERH-----QV---IQVTSPMPGDGKSTLASNLAVTIAQSGKS-VLLLDADFR
A0A2E9VK20      FVR--AADVDA-----HI---IQFTSSEPGDGKTTTISNLAISIAQAGKR-VLLIDADLR
A0A3D4PJK1      FVR--AADVDA-----HI---IQFTSSEPGDGKTTTISNLAISIAQAGKR-VLLIDADLR
A0A142YJ13      LSV--ERQHSF-----QV---VMVTSATKGEGKTSLSCHLATSLARAGRR-TLLIDCDLR
A0A0S8GZ23      GLL--SNGKIP-----HK---MVVTSSGVREGKSTFAVNLATSLAQAGKR-VLLIDGDLR
A0A2D5AWU0      TFA--LPKDSH-----GV---VLVTSSVSGEGKSVTASNLAFALATGGRR-TLLIDGDLR
L0DC26          LHV--SRTESV-----RV---VMVASALGGEGKTSLSSHLATSLARAGRR-TLLVDGDLR
A0A3L7P4E4      MAA--TRGEGH-----RI---VLLTSPEPGDGKSTMSSNLAVTLAQTGKS-VLLIDADMR
A0A3L7PEB5      LAA--TRGAGH-----SI---VLLTSPEPGDGKSTMSSNLAVALAQTGKS-VLLIDADMR
A0A356KTN1      NAVGAFPSEGC-----GV---LLCVSGIPREGKTLSALNLAIASAQAGRR-TLLIDADMR
A0A2E2N5A9      EMA--NTDHYS-----QV---IVTTSALPGEGKSTLSANLAHALAQLGK--VILIDADLR
A0A225EH48      LHT--AKTQNM-----QV---LMVTSAMQGEGKTSLASQLATSMATAGLR-TLVLDCDLR
A0A1G2YQB7      GLM--NNCTIP-----NK---LAITSAGPQEGKSTLAVNLAMNLAKIGKK-VLLIDGDLR
A0A353P687      GLM--NNCTIP-----NK---LVISSASPREGKSTLAVNLATNLAKIGKK-VLLIDGDLR
A0A3L7SI46      -IT--FSTSNT-----QR---LVMTSTEPGDGKTTTLANLSVAFAQAKKK-TLLIDADLR
D5SZ21          -IQ--FAGDDI-----RR---LVITSTEPGDGKTTVSTNLAVAYAQSGRR-TIIIDCDMR
A0A432MFP3      -LC--GEGGQD-----GRGRCVLITSAVGGEGKTTLAAQLAVRCAEAGAS-TVLIDADLR
A0A257WS34      -IS--FCAGDT-----HR---LCVTSTEPGDGKTTTLANLAVAFAQAGKK-TLLIDADLR
A0A2E8FLY0      -LA--FSSNPT-----TR---LAVTSTEPGDGKTTILANLAVAFAQSGKK-TLLIDADMR
A0A3D2U1E1      -LA--FSSEPT-----AR---LVVTSTEPGDGKTTVLANLAVAFAQSGKR-TLLIDADMR
A0A1P8WP26      -LE--FAGGDT-----GR---IVCTSTEPGDGKTTISSNMAVAFAQSGRR-TLIIDADMR
A0A3L7V1F3      -IE--FSPQET-----NR---LVCTSTEPGDGKTTVSSNLAVAFAQSGKR-TLIIDADMR
A0A2E8B0L9      -LA--FSGQDL-----QR---IAITSSEPSDGKTTVLTNLAVSYAQAGKR-TLLIDCDLR
A0A3M1VCL4      -LM--FSETPA-----QR---LVVSSTEPGDGKTTVLSNLAVAFAQAGKR-TLLIDADLR
A0A2E3GWX1      -IE--FASETH-----QR---ISISSTEPSDGKTTVISNTAVAFAQAGRR-TLLIDGDMR
F0SG60          -IE--FASETH-----QR---ISISSTEPSDGKTTVISNTAVAFAQAGRR-TLLIDGDMR
A0A2E9VST2      -IE--FACENH-----QR---ISITSTQPSDGKTTVISNTAVAFAQAGKK-TLVIDGDMR
A0A356A6X2      -IE--FACENH-----QR---ISITSTQPSDGKTTVISNTAVAFAQAGKK-TLIIDGDMR
A0A2E0SMM6      -IS--FNTHES-----RR---LLVTSTEKSDGKTTVMANLAVAFAQANKK-TLIVDTDMR
A0A356EME5      VLA--EEIKGA-----RV---LAVTSAASNEGKTSVAAQLALSLARASGKPTLLIDGDMR
A0A355AI52      VMG----TEDS-----ER---IAVTSAEPGDGKTTISSNLAIAYQQAGKR-VLIIDADMR
A0A354PCQ3      FLS--TRWKDT-----RS---IAVVSSISGEGKSSVASQLSLSIAKATGQTVLLVDADLR
A0A2E7EGG1      VLS--QKNESI-----QV---VVVSSSVAGEGKSSVASQLAVSLARSSGMPTLLIDGDMR
A0A2E7K7A9      LLK--TERNGA-----KV---LQVTSAEPGDGKTTSVSNLALAIAQTGRK-VLIIDADLR
A0A1N6DAJ8      LHV--SRTESV-----RV---VMVASALSGEGKTSLSSHLATSLARAGRR-TLLIDGDMR
A0A2S8G191      FRP--SATRQY-----RV---VMISSALAGEGKTTLAGQIAYALAESGAR-TILVDFDLR
A0A3L7NDH9      -LA--MNGSQS-----QR---IAISSSEPGDGKTTASTNLAVAYSQAGKR-VLLIDADMR
A0A2E0X9P6      MLTQGLGVGGV-----RV---LAVASAGSGEGKTSVATSLAVSFAKATQHATLIIDADLR
A0A2N1UCJ3      FFG--VPKGQA-----RT---ILITSPAPSDGKTTMVSNLAIAMAQAGQK-TLIVDADFR
M5UE94          LVA--ARKNGH-----QV---IQVTSPLPGDGKSTTSVNLAMAFAQTGKR-TLIVDADLR
A0A2E0X4J3      HFG--LGGPDV-----RA---VCVTSPTAGDGKSTVASNLAIAMARAGQR-TLLIDADMR
A0A1P8WN28      -IT--LSPMDT-----KC---IAITSTEASEGKTTTTVNLAASYAQTGQR-TLLIDADMR
A0A3B9CTT0      -VT--LTAQQS-----KC---LAVTSTDAGEGKTVTTVNLAASFAQTGQK-TLLIDADMR
A0A2D5NDU9      YFG--LAQIEG-----TS---IQITSAEPGPGKSTIASILAIAMAKAGHR-TLLIDGDLR
A0A286RGB6      IRE--SEHERL-----QV---IMVTSAVPGEGKTTLASQLAASLAQMGQK-TVILDFDLR
A0A1V5N3W2      RLL--SDGEIP-----KI---LVVTSPASGDGKTTLAINLSLSLAQTGQK-VLLIDGDLR
A0A3E0MY27      LHS--ASCESV-----QV---VMVTSANSGEGKTTISSSLAASLGRSGRR-TLLIDGDMR
A0A286RLF2      -LA--LSDRPT-----GA---VVVTSTQPGDGKSTVSANLALTYAHVGKR-TLLVDGDLR
A0A286RD13      LHR--AERQGL-----KV---VLVTSALAREGKTTLVAQLATSLARAGRR-VVVVDGDLR
A0A3M1QRP3      LQR--LPHDRC-----NV---IQITSASPGAGKTTFAIMLAKSLAHIGKR-VLLVDADLR
A0A2E3RCU8      -LA--LSAAES-----TR---LALTSSEPGDGKTTVIANLAVVYAQSGKR-TLLIDGDLR
A0A3E0MY88      -LS--FNPEET-----QR---LVVSSAEPGDGKTTVLSNLGTSIAQSGKK-VLMIDADLR
A0A1C3E6N1      -IQ--FAGDDI-----RR---LVITSTEPGDGKTTVSTNLAVAYAQSGRR-TIIIDCDMR
A0A3B8PNV4      -LS--FAGRPT-----QQ---LVITSTEPGDGKTTVLANLGVAFAQSGKR-TLVIDADMR
A0A3D1DR40      -LS--FAGRPT-----QQ---LVITSTEPGDGKTTVLANLGVAFAQSGKR-TLVIDADMR
A0A2E7RYU8      -LS--FAGRPT-----QQ---LVVTSTEPGDGKTTVLTNLGVAFAQSGKR-TLVIDADMR
A0A3B8LXG8      -LS--FAGRPT-----QQ---LVVTSTEPGDGKTTVLTNLGVAFAQSGKR-TLVIDADMR
F0SI78          LLT--MGGERA-----RV---IQFTSPDPGDGKSTTCSNIALATANSGKR-TLVIDLDLR
A0A350CI62      -IE--FSPQDT-----NR---LVVTSTEPGDGKTTVSMNLSVAYAQSGRR-TLVIDADMR
A0A3C1X4W5      -IE--FSTQDT-----NR---LVITSTEPGDGKTTVSMNLSVAYAQSGKR-TLVIDADMR
A0A3D3W3A7      -IE--FSTQDT-----NR---LVITSTEPGDGKTTVSMNLSVAYAQSGKR-TLVIDADMR
A0A2E7ENQ5      -LA--FSEQGS-----EC---VAISSSEPGDGKTTVLSNLGASSAQAGKR-TLLVDADMR
A0A1G3AQE9      -LS--LANQET-----HQ---LVVSSAEPGDGKTTVLANLAVAIAQSGKK-TLLIDADLR
A0A3L7UQT9      -IS--FSDRQA-----QR---IVVTSTEPGDGKTTVMSNLAVAFAQSGKR-TLLIDADMR
                                         *     **:      .           :::* *.*

A0A2G2JCA2      SPDIHNVFEVPKS-P-GLAEVLNRDIPLKDA----INR-EW------SDSVHLL-TAGTL
A0A286U4B3      KPRVHKAFNIQMM-P-GLTNHILGDNDLDSI----IKH-TA------IPNISVI-TCGLI
A0A1G2XVR0      KPRQHKIFGIDLK-P-GLSNHFIGEIDYESI----IKH-VN------IPHLNII-TCGLI
A0A1G3B0P0      KPRQHKIFGIDLK-P-GLSNHFIGEIDYESI----IKH-VN------IPHLNII-TCGLI
A0A1E3X4X0      KPRLNKIFSVERN-P-GVSNVLAGEASIESC----IKD-TE------ISNLNLI-TSGSV
A0A1U9NNE1      KPDIARILNLPEG-TTGLSDVLEGKPFANALWY------AP------SAGFDVL-GNYDR
A0A1N6KFT7      KPAQHKIFRLKGD-Q-GLSHILRRLLPLSRV----VQQ-TQ------IENLDFI-ASGSD
L0DFG4          KPSQHKIFGLKAD-Q-GLSHVLRRLLPLSRV----VQQ-TQ------TENLDFI-ASGPE
M5SZR3          KPRQHLFFGSEIG-I-GLSNMIVDGAEPTDA----IRA-TP------VHNLWLL-SAGQK
M5TW92          KPRQHLFFGSEIG-I-GLSNMIVDGAEPTDA----IRA-TP------VHNLWLL-SAGQK
A0A0S8FY64      RPALHRAFELERS-P-GLTNLLVEGRALQEI----VQQ-PSDGQLEGLQNLYVL-SAGAK
A0A2E3GW02      RPTVHKLFGLDRD-V-GVSTFLTSDVEWADC----IQQ-TS------VPNLDVI-TAGKK
A0A1I3DDV4      APTIHRFLNMPID-R-GLSETLQGKTKLDEV----IRP-TG------IEGLSVM-TAGSA
A0A2E3GWC6      RPMVHRLFGLREE-I-GFSEVLQGELELLNA----IQP-TK------IENLSVL-SAGAI
F0SLB0          RPMVHRLFGLREE-I-GLSEVLQGELELLNA----IQP-TK------IENLSVL-TAGAI
A0A255R1S0      RPTIASRFGVERG-P-GLSDYLHGDATLMEC----LHH-TE------QENLVIC-PSGSR
A0A0J1B4A0      RPTVAANFGVERS-P-GLSDLLSHDGPINPATLAECVQASE------QDSLTLC-TSGSR
A0A1Z8N7H5      RPGLTRLLDLKSK-P-GLSDLLNADDEVSGMISDYLAP-TD------APNLDVL-PAGPR
A0A2E2CCW9      RPTIHKLFGLANS-V-GLGDVLTGEIDAQTA----IRE-TR------VSHLSIL-TAGML
A0A3C0AGX3      RPTIHKLFGLANS-V-GLGDVLTGEIDAQTA----IRE-TR------VSHLSIL-TAGML
A0A0S8KNX5      KPDVARLLNLPKG-ARGLQDVLSG-VEFEDV----VYS-IA------SSGLDVL-AADYH
A0A3D3UVZ8      KPDVARLLNLPKG-SRGLQDVLCG-VKFEQA----VFS-VA------STGLDVL-AADFQ
A0A354PDV6      RPSIHNFFSVKRE-N-GLVDVLADELEPMEA----IRD-TD------VENVHVL-PAGAP
M5TIT3          RPGVHRFFSVDKA-N-GLSEVLEGQLAFEDA----VKE-TR------ADNVFVV-TGGAT
F2AXG2          RPSAHRYFSIGKE-D-GLCDVLEGRLEIPES----IKV-TE------AENVSVM-TAGSS
M2BB46          RPSAHRYFSIGKE-D-GLCDVLEGRLEIPEA----IKV-TE------ADNVSVM-TAGSS
L7CLQ6          RPSAHRYFSLGKE-D-GLCDVLEGRLEIPEA----IKV-TE------AENVSVM-TAGSS
A0A0J1B719      RPSAHRYFSLGKE-D-GLCDVLEDRLEISEA----IKA-TE------ADNVFVM-TSGSS
Q7UF18          RPSAHRYFSLGKE-D-GLCDVLEGRLEIPEA----IKV-TE------AENVSVM-TAGSS
A0A2G1W1E0      RPSAHRYFSLGKE-D-GLCDVLEGRLEIPEA----IKA-TE------ADNVFVM-TSGSS
K5E235          RPSAHRYFSLGKE-D-GLCDVLEGRLEIPEA----IKA-TE------ADNVFVM-TSGSS
A0A1U7CZ81      RGSLCSLLDIPEG-L-GLSDVL-KEEANVED----VAIPVQ------GGTFHLL-CAGTP
A0A142YNY8      RGALSPLLDVADS-K-GLSDLLMNEDLNPED----LAIPVQ------GGTFHLL-SAGTP
A0A1U7GLS6      RGALSPLLDVPEG-A-GLSDALMNDGLNVEE----LAIPVQ------GGTFHLL-SAGTP
E8R3W3          RPMSHQLFGTQKS-P-GLAEIFRNEIDLWSA----IQT-TS------FNLLSTL-AAGEG
A0A3D2TNK4      RPGFTTLMQLKGQ-P-GVADLLTSPETPAQSAPPLIHS-TI------VKDLDVL-PAGLR
A0A142WSB9      RPTVHDLFALPRQ-L-GLAEVLTGAIPLESG----LKA-TP------VANLSVL-TAGIP
A0A2S8FKY2      RPSMHSIFGLPVG-P-GVGDILVGEAKLADS----IRP-TD------IPNVDLL-PAGIK
A0A432MJP4      KPSQDRIHGIDRA-P-GLSEVLRGISTWREV----LQP-SA------AEDLRIM-TTGGP
M5UQ35          RPTVAASLGVSAE-Y-GLVDYLKGKAGFEDV----LHP-CE------QAGLFVC-TDGSR
A0A3A0DET7      KPSQHTIFDLSTE-K-GLATVLSARMPVGDA----IVR-LR------ESSLEVL-PCGPL
A0A2A2W9R6      RPMVAKTFGIERS-P-GLSDYLNHVVCFSES----LHE-CE------QINLTLC-PAGSR
A0A353FIP5      RPSIHKLFSIQSN-P-GLVDAISGESPCEDL----AQQVSS------IPNLHIL-PSGKV
A0A2E1VVJ1      RPVVHKYFDAEVS-P-GLSEVLLEKNPWQDC----VHK-AP------VANLDVL-PAGAM
A0A3M2AEL0      RPVVHRLFGFPIS-P-GLSDVLKEDASPEKL----MHP-TN------IDGLSVL-TAGSR
A0A351FYP6      RPSMHRYFKVSNT-I-GLTNLLLGQNTLDEV----IQT-SE------SPNLHFI-PSGKL
A0A0S8J591      KPMIHRAFNMKPD-R-GLSTLLSEKDSATVY----IKK-TD------IENLHVL-PGGPI
M5RT57          APDIHNIFQVSNN-L-GMTSVLEGRATLDEA----VIR-DW------SDQIHLL-PAGRL
A0A1U9NL64      RPKQHEVFEFDRE-P-GISNILAGESQIDSV----IKN-TS------IDGLDVL-ACGPS
A0A1G2YPI3      KPMQHRIFKLNHE-NRGLSSVLAGAARLEDA----IHQ-TE------VKGLDLL-ACGPE
A0A2E7ESJ6      RPTQHEVFAMEAP-EIGLASVVAGDAEPADAWQEIPF----------VPNLRIM-ACGPR
A0A2E9VK20      KPMVHQLFGMRED-I-GLSECLSGEIEMANA----VQD-SG------IENLHIL-SAGAI
A0A3D4PJK1      KPMVHQLFGMRED-I-GLSECLSGEIEMANA----VQD-SG------IENLHIL-SAGAI
A0A142YJ13      KPSLHEIFEVPSE-P-GLCEVLSGEIGWEGV----VRE-TE------VRDLSLI-LAGRC
A0A0S8GZ23      KPDIERLLNLPHD-SWGLMDVLYGLKKFEET----VRS-VP------LSGLDVLTADGRN
A0A2D5AWU0      MPSLHEIYGVENL-A-GLGQVMTRSITTDKV----IVQ-NV------AAGLDLM-PAGDP
L0DC26          RPSAHELFDQPCV-P-GFCEVLRGEIDIVGA----VQP-TV------ISGLSLL-TAGFS
A0A3L7P4E4      RPTVKRLFSLKNK-M-GLSNLLGDVSLDVNECIESVTF-EG-------STLDIL-SSGEC
A0A3L7PEB5      RPTVKRLFGLKNN-T-GLSELLDEVPPDINECIQTVSF-EG-------SNLDIL-ASGEC
A0A356KTN1      SPRVHRILGQPLE-P-GLADAIEGKV---EDLGERLRR-TQ------VENLWVM-GAGRC
A0A2E2N5A9      KPTLAKNFGRPKG-SMGLTDIIENRASLESC------I-TQ------VSGVDMI-CAGTA
A0A225EH48      NPSLHKLFDSPLT-P-GCAEVLLQEVDVSDA----VQP-TT------VPNLWLI-PAGQC
A0A1G2YQB7      KPDIAKYLNLDNKGK-GMHQLLADFK-----LRDLLMH-AD------TPGLAVLTAEPCD
A0A353P687      KPDIAKYLKLDNKGK-GMHQLLADFK-----LRDLLLY-SD------VPGLSVLTAEPCD
A0A3L7SI46      RPGMTQLLELKGP-R-GLSQILRETTPVAECCLENIFN-LG------IENLDVM-PSGSR
D5SZ21          RPGLSKTMKLRGS-Y-GLSTILRNDDSIENSLRNNVVV-SD------LAGLDII-PAGPR
A0A432MFP3      RATLGRLFEVPDC-P-GLSDVLRGDAQLEDAL---VPI-SQ------VGGCQLL-PAGSP
A0A257WS34      RPGMTQLLGLKGQ-Q-GLSHVLRDSRPVQESCLDNIFH-LG------QENLDVM-PSGAR
A0A2E8FLY0      RPGMTALMDLRGP-R-GLSTVLRGDEPIANTATANLFA-TE------LGTLDVM-PAGPR
A0A3D2U1E1      RPGLTAMMDLRGQ-Q-GLSSILRSNLPPDTATQGNVFS-TH------LEHLDVI-PSGAR
A0A1P8WP26      RPGLSTLLDLRDD-K-GLSVILRSTDEFDEAVQGNLRA-TA------VDGLDVI-SCGPR
A0A3L7V1F3      RPGLSTLLGLRDD-T-GLSKILRDSDELEVSIERNLRK-SD------VKGLDVI-SCGPR
A0A2E8B0L9      RPGLTKLFQLRGV-A-GLSDILRGNDEVPAMCEERIQA-AG------VDGLDVL-VCGPK
A0A3M1VCL4      RPGMTTLFGLRAA-P-GLSTVLRSEEPLQVALQGCLFQ-SG------CAGLDFI-PSGPR
A0A2E3GWX1      RPGLTRLFDLRGQ-Q-GLSSILRDDQTIEESAKANMVH-TG------LMNLDII-AAGPR
F0SG60          RPGLTRLFDLRGQ-Q-GLSSILRDDQTIEESAKANMVH-TG------LMNLDII-AAGPR
A0A2E9VST2      RPGLTAVFALKGQ-A-GLSTILRDTASIEESALKHITK-TR------LENLDVI-SAGPR
A0A356A6X2      RPGLTAVFALKGQ-A-GLSTILRDTATIEESASKYITK-TR------LENLDVI-SAGPR
A0A2E0SMM6      RPGMTNLLEMRKE-E-GLSKLLRSDEPIHQCAVELIQP-SG------APNLDIL-PSGGR
A0A356EME5      APDIQEVFEVRKS-P-GLAEVLGGECDLHEA----IVP-TW------TPSVDVL-PGGEA
A0A355AI52      KPGLTKLIDRRGQ-V-GLSDILRGTEEVAEQASGLAIQ-TG------SVPVDII-PAGRR
A0A354PCQ3      CPDQHRLFGLEMG-P-GFSAVLAGKASLLDA----VNS-RL------GNLIHLL-PAGQL
A0A2E7EGG1      SPDIHRIFKVENK-P-GLVGVLSGECDFEDA----VNR-EW------SEHVHVL-PAGYL
A0A2E7K7A9      RPTVHKLFGINNA-V-GLGDVLAQEIDAQTS----IRE-TR------ISNLSIL-TAGML
A0A1N6DAJ8      RPSAHELFDQPCV-P-GLSEVLRDEVDVADA----IQP-TA------AGGLWLL-PAGLC
A0A2S8G191      RPALDTAFDVNLV-P-GVTEWLSGEVEIQDA----IQE-TG------MRNLDII-AAGDW
A0A3L7NDH9      KPGLTKLVGFRSM-P-GLSDILRGNQPVSDHASACIRR-SG------SVPIDII-PAGQR
A0A2E0X9P6      APSAARMLGLPNQ-P-GLADVLRGDLPAVET----IAQ-VG------SSTAFLL-PAGRS
A0A2N1UCJ3      KPMQHNIFGFANEVEKGLSSILSGQISLDDA----IRS-CP------TDGLFLL-TSGPE
M5UE94          KPRVARLLHLSGE-S-GFSEALQDLCDPTDV----VQS-TV------SDNLFAV-SAGAI
A0A2E0X4J3      KPRQHVTFGLSTE-I-GLSTLLADRRPAADA----MQA-TD------VDNLTVI-TSGPV
A0A1P8WN28      RPGLSRLLEIRGN-G-GLSEVLRADSDIPQMCKERVVQ-TE------VPLLEVL-PCGPR
A0A3B9CTT0      RPGLSRLLEVRGN-G-GLSEILQADGGIAELASERVTP-TD------VDGLYVL-PCGPR
A0A2D5NDU9      KPVQSKRWQVSGP-G-GITSAVAEDLRLIAA----VHE-TE------VDGLDLL-AAGTP
A0A286RGB6      RPSLHEVFNLPIS-P-GVSEVLRAEISLKDV----VRP-TE------LENLFVV-TAGYW
A0A1V5N3W2      KPDIAHFLKLPEN-YWGLQDVLLGLRRWEEA----VYT-LP------EAGVQVLTADHRN
A0A3E0MY27      RPAVHRMLDLPLD-T-GLSEVLRGEAAVEEA----IRP-SR------APGLWVM-PAGRC
A0A286RLF2      RPGLTQLLGLRGE-P-GISEVLRDTAPIAEAIQARLKK-NI------VPDLDVL-PCGRR
A0A286RD13      RPRLHRLFRCPLS-P-GLSELAKNLARPEEI----VRN-AE------IENLYVV-TAGHC
A0A3M1QRP3      NPSIAGRLGVSGA---GQEFLASLLDAQAGQTPRRDRA-TN------VPGLRVLVSSRPA
A0A2E3RCU8      RPGLTRLLDLKSH-R-GLSDVLAADDPIQEIIPGHVVP-TA------AANLDVL-PAGPR
A0A3E0MY88      RPGLTALFALKRE-H-GLSDVLNAPEPVEEVATRYVRG-TG------IPDLDVL-PSGPR
A0A1C3E6N1      RPGLSKTMKLRGS-Y-GLSTILRNDDSIENSLRNNVVV-SD------LAGLDII-PAGPR
A0A3B8PNV4      RPGLTRKLNLKGS-R-GLSTILQSEDPIAVSAAGNLFA-TE------LGSLDVI-PAGPR
A0A3D1DR40      RPGLTRKLNLKGS-R-GLSTILQSEDPIAVSAAGNLFT-TE------LGSLDVI-PAGPR
A0A2E7RYU8      RPGLTRKLNLKGP-R-GLSTILQSEEPIGISAASNLLA-TE------LNSLDVI-PAGPR
A0A3B8LXG8      RPGLTRKLNLKGP-R-GLSTILQSEEPIGISAASNLLA-TE------LNSLDVI-PAGPR
F0SI78          RPTVHKLFGLDRD-V-GVSTFLTSDVEW----ADCIQQ-TS------VPNLDVI-TAGKK
A0A350CI62      RPGLSTLLGLRDD-V-GLSRLLRSPDDLDTAIAANLRT-TV------VQGLDVI-SCGPR
A0A3C1X4W5      RPGLSTLLGLRDD-V-GLSRLLRSADDLETAIAANLRT-TV------VQGLDVI-SCGPR
A0A3D3W3A7      RPGLSTLLGLRDD-V-GLSRLLRSADDLETAIAANLRT-TV------VQGLDVI-SCGPR
A0A2E7ENQ5      RPGLTRLFGFRGK-G-GLSDVLTKPNDLNELCEERIQK-TA------LAGLDVL-PAGPL
A0A1G3AQE9      RPGLTALMAMRGI-E-GLSSVIRSEEDIVRAAVAHIRP-SG------LAGLDVL-ASGPR
A0A3L7UQT9      RPGMTALLGLKGQ-Q-GLSQVLRDERPIAASVAENLFT-QI------TPGLDVI-PSGSR
                                *                                           

A0A2G2JCA2      MT---SPHKLLGTNV-FDKLMKGVRGRYRYVVLDTPPVLAASEALVMA--KQADVSLVCA
A0A286U4B3      PP---NPSEMLGSHS-MEKFCKEIMDRFDTVILDTPPAMAVTDTIVLS--NMVDGIIYVI
A0A1G2XVR0      PP---NPSELLGSHS-MEKFCDNVRNRFDIIIFDTPPTMTVTDAVVLS--RNVDGVVFVI
A0A1G3B0P0      PP---NPSELLGSHS-MEKFCDNVRNRFDIIIFDTPPTMTVTDAVVLS--RNVDGVVFVI
A0A1E3X4X0      PP---NPSEMLGSAS-MEKFCDDIRKMFDYVLLDSPPIMSVTDATILA--RLTDASLLLV
A0A1U9NNE1      CL---KACDRLSRPE-VQSNIRNLCRYYDHVVIDTPPVLAFPDALLWA--RIADATILAS
A0A1N6KFT7      VD---NPAELLASSA-LTDFVAEIRNLYDMVVFDSSPLLAVTDPSILS--AVVDGVVLVV
L0DFG4          VD---NPAELLASAT-FTDFVSEIRNIYDMVVFDSSPLLAVTDPSILS--AMVDGVVLVV
M5SZR3          TP---DPAELLTSTR-FAELMAQFREDYDYVIVDSGPLLAVSDPRIVM--AHTDGLLLSV
M5TW92          TP---DPAELLTSTR-FAELMAQFREDYDYVIVDSGPLLAVSDPRIVM--AHTDGLLLSV
A0A0S8FY64      TP---NPAELLGSSA-MARLVRQSREQYDVVIFDSCPAMFVADAAPIA--SGCDGVVIVL
A0A2E3GW02      NE---QYGELLHNPK-LASVLDALRDKYDVIFIDSPPVLAVADATAIA--PLADSLLLVI
A0A1I3DDV4      VR---NPAELLQSEV-FDQVLEDCKSRFDMVLVDSGPVLLVSDPAIVS--QKCDIAMLVV
A0A2E3GWC6      PA---KPAELLSSAK-LHYLFGEATREYDFVLVDSPPILAVSDPSITA--RSVDAMMLVV
F0SLB0          PG---KPAELLSSAK-LHYVFGEATREYDFVLVDSPPILAVSDPSITA--RSVDAMMLVV
A0A255R1S0      TS---SPSELLESDR-FLEFIENVREGCDLVFFDAPPVLAVADPAIIA--LHVDCVLMGV
A0A0J1B4A0      TS---EPSELLESDQ-WVAFLDLARKTYDVILIDTPPLLAVADPSIVA--DEVDGVFLAV
A0A1Z8N7H5      RQ---NPSELLASDR-LAQIFAWAETKYDQILVDCPPTLVASDAVLVG--RIVDGMVLIV
A0A2E2CCW9      PE---NPSEMLMSRA-FSELVNQLRKEYDYVLIDTPPLVVVSDPSVIA--SIVDGVLLVV
A0A3C0AGX3      PE---NPSEMLMSRA-FSELVNQLRKEYDYVLIDTPPLVVVSDPSVIA--SMVDGVLLVV
A0A0S8KNX5      NAA--DAYELLALPS-TAHRIDTISKKYDHVIIDTPPALGFPDALLWA--KVGDAVILTS
A0A3D3UVZ8      DSA--DAYEMLALPS-TAKRINAISRKYDHVIIDTPPALVFPDALMWA--KIGNAVILVS
A0A354PDV6      TS---TPAELLQSPR-FDQLLEILKEKYDVVLLDLPPVLAVSDPLVVA--PKVSGVVVVF
M5TIT3          SP---RPAELLQSDK-LGEVLEAAKTQFDLVLVDLPPVLAVSDPIVVM--PRLDGGILVV
F2AXG2          SQ---TPAELLQSQR-LDEVLAVVREDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVV
M2BB46          SQ---TPAELLQSQR-LDEVLAVVKEDFDLVLVDLPPVLAVSDPVVVM--PRLDGGILVV
L7CLQ6          SQ---TPAELLQSQR-LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVL--PRLDGGILVV
A0A0J1B719      SH---TPAELLQSQR-LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVV
Q7UF18          SQ---TPAELLQSQR-LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVV
A0A2G1W1E0      SQ---TPAELLQSQR-LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVV
K5E235          SQ---TPAELLQSQR-LDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVM--PRLDGGILVV
A0A1U7CZ81      VA---DTSRLFQGRN-FGMMIARLRQMYDLIIIDSPPVLPVPDGLIMG--RWTDGAVLAS
A0A142YNY8      TS---DTSRVFQGRA-FGMLIARLRQLYDLIIIDSPPILPVPDALIMG--RWTDGVVLTS
A0A1U7GLS6      TS---DTSRLFQGRA-FGMLIARLRQLYDLIIIDSPPILPVPDALIMG--RWTDGVVLAS
E8R3W3          DP---QTIELLNHNL-LAGLIEQARGVFDFIIIDSAPVLPVSDTLLVG--RAVDAALFVV
A0A3D2TNK4      RP---NPAELLSSKA-FIELLAWAESKYDRVIVDCPPVLAVSDAQIVG--RLVDGAILVV
A0A142WSB9      PE---NPAELLSTSN-LEGLVQELRGRYDFVLFDSPPVLAVSDPCIIA--PQADAMLLVV
A0A2S8FKY2      EQ---SVPRSASTGR-LDQLFADLRKSYDFIIVDAGPVLGSPSTRFLAQPQHVDGVILSI
A0A432MJP4      VE---NPAELLMSER-FRSLVAELRGEFDRVLIDTSPLLYVADPSIVA--PSADGVLLVL
M5UQ35          TS---QPAELLETDR-FAEFMAEARSAFDVILIDTPPLLAVADPVIVS--EHVDGCLLAV
A0A3A0DET7      PA---NPVELLNNGY-FAELLESLKTRYDRIVIDSPPVLPVADARVIA--AVSDATLLVL
A0A2A2W9R6      TS---APSELLESES-IAEFIANARQSFDMVFIDSPPLLAVTDPAIIA--LHVDGCLLTV
A0A353FIP5      DVGGINPGDLLAQEK-MSEIADSLRGAYDYVFFDVPPVLAVADASSFL--NRLDAILLLV
A0A2E1VVJ1      VK---NPGDLLASEG-LVQLTESFLSEYDRVLFDVPPVLAVADASAFL--HNLEAIFLLC
A0A3M2AEL0      TA---RPGDLIASPA-MQGFLQDVRGSFDYILFDIPPVLAVADASGFV--SQLDALFMLC
A0A351FYP6      PS---SSMGVLNSAK-MKEFVAEMKSRYDYVFFDAPPIMGVSDASVLA--SAVDLCVLVV
A0A0S8J591      PS---NPAELLGSRK-MRTLVAEAAERYDSVIIDASPVLGVADANILS--TMVDCVVLVV
M5RT57          RV---NPHQLMTRES-LNKIFNELRAQYRYIVIDTPPILSASEAILLA--RCADGSLLCT
A0A1U9NL64      IP---NASELLNSDE-FGELLSSLKAKYDRILLDAPPVMPVADARILA--AMCDVTLLVL
A0A1G2YPI3      VP---NPAEILNSDT-FAKLLERLSNKYDRIVIDSPPVMPVTDAQILA--AICDITLLVL
A0A2E7ESJ6      PE---NPSELLSSES-FANVLQLLRDQFDFVIVDTPPVLAVSDPMAVA--ARVDGVILTF
A0A2E9VK20      PA---KPAELLSSSK-LHYLLGQAKRDYDFVLVDSPPVLAVSDPCITA--QSVDTVMLIV
A0A3D4PJK1      PA---KPAELLSSSK-LHYLLGQAKRDYDFVLVDSPPVLAVSDPCITA--QSVDTVMLIV
A0A142YJ13      NP---EAIELLPRQP-LPDLIIALREQYEFIIVDSSPVLLVTDTLIIS--QHIDAVLFSV
A0A0S8GZ23      PA---EAVELLEKPQ-TAECINNISQRYDHVIIDTPPVLAVPDARLWA--RMADAVVLSS
A0A2D5AWU0      FG---KPAELFESGL-FPKLLDFLRKKYDCIVVDSPPILESSESRVMA--SEVDLCIFVT
L0DC26          DS---DSIQALASLD-LRAMFDQLKEHYDFLVIDSSPVLPVADALLIG--QHVDAVIFSV
A0A3L7P4E4      PI---DPGERLMSDR-MESLLNMLRDRYEWIIIDSPPVLAVTDSATLS--RLVDGVILVV
A0A3L7PEB5      PI---DPGERLMSNR-MENLLSMLRDRYEWIIIDSPPVLAVTDSATLS--RLVDGVILVV
A0A356KTN1      EA---NPGELLARDDTFHQLVWRLRRRFDRIVIDSPPVVAVSDATLMA--QAADAVIQVV
A0A2E2N5A9      VR---DPLSLLSSSR-FSALIEALKTRYDRIVVDSPPTQGVSDAMVLA--AHAEALLFIV
A0A225EH48      SN---RVIAALAQGHPLETLFNRLRGQFDFIVVDSCPVLPVADALLVG--QHVDGVVISI
A0A1G2YQB7      IA---IINKLIHHKN-LVEFINEVSRIFDHVIIDTPPILAAVDALLWS--SMVDGVIMTS
A0A353P687      IS---IINRLIHHKN-MVEFINEISRIFDHVIIDTPPVLAAVDALLWA--SMVDGVILTS
A0A3L7SI46      PA---NPSELLASDR-FNDILAWAESAYDQILIDAPPVLAVTDPAIIG--RLVDGAVVVI
D5SZ21          PA---NPLELLSSTR-FSELLAYVESQYDQVLIDAPPILAVSDAGVLG--RMVDGVVLVV
A0A432MFP3      EA---YPNRILRGKA-FAPMLERLRRSFDVVIIDTSPVLPVPDALILG--RLADGAVIAT
A0A257WS34      PI---NPSELLSTER-FSDVIAWAETIYDQILIDAPPILAVADPAIIG--RMVDAALVII
A0A2E8FLY0      PL---NPAELLHGDR-FSELLAWAETVYDQILIDAPPALAVSDAAIIS--RQVDGGLLVV
A0A3D2U1E1      PA---NPAELLHGTR-FSELLAWAESIYDQILIDAPPALAVTDAAIIS--RQVDGGLLVV
A0A1P8WP26      PV---NPAELLSSER-FANLLAWAETRYDQIIVDAPPVLAVSDPLIIA--RLVDGVVLVV
A0A3L7V1F3      PV---NPAELLSSER-FSNMLAWAETKYDQIIVDAPPVLAVSDPAIVG--RLVDAVILVV
A0A2E8B0L9      PP---NPVELLTDSR-FVDVIAWAETHYDQVLIDCPPVMAASDAAVVG--RLVDGIMLVV
A0A3M1VCL4      PS---NPAELLGSPR-FVDLLAWAETTYDQILVDAPPALAVADPTAVG--RFVDGALLVI
A0A2E3GWX1      PS---NPVELLTSDR-FAELIAWAEGEYDQILIDAPPSLAVTDPAIIG--RLVDGVILTV
F0SG60          PS---NPVELLTSDR-FAELIAWAEGEYDQILIDAPPSLAVTDPAIIG--RLVDGVILTV
A0A2E9VST2      PS---NPVELLTSER-FEELIGWAEGVYDQILIDAPPSLAVTDPAIIG--RLVDGIILTV
A0A356A6X2      PS---NPVELLTSER-FEELIGWAEGVYDQILIDAPPSLAVTDPAIIG--RLVDGIILTV
A0A2E0SMM6      PV---NPSELLSSNR-LSDFLAWAETVYDQIIIDAPPILAVSDAGIVG--RLADTLILIM
A0A356EME5      KQ---NVHKLVGNGE-LSAILRQVSQKYAYVVLDTPPILAASESLVLA--KAADASLVCA
A0A355AI52      PP---NPGELLLGDR-FAELLAWADGEYDQVIVDAPPVLAGTDAAAVG--RLCDGLMLVV
A0A354PCQ3      TA---SPHRLMSPER-LQEFMREALSHYSYVVIDTAPVLSAGETLAVA--STMEATLLCV
A0A2E7EGG1      DR---SPHKLMANEG-FKQLIAKARDSYRYIVVDTPPVLAASESLVMA--RDADATLVCA
A0A2E7K7A9      PE---NPSEMLMSRR-FAEMVNQLRNEYDYILVDTPPLVVVSDPSVIA--STVDGVLLVV
A0A1N6DAJ8      DS---DSIQALACRD-LRAMFDQLKEQYDFIVVDSSPVLPVADAMLIG--QHVDAVLFSI
A0A2S8G191      GH---NSFRELTSNR-MDAFFKKLRQEYDYVIVDGSPILPVVDARLIG--QYVDGVVMAV
A0A3L7NDH9      PS---NPAELLLSER-FSELLSWAETTYDQIIVDASPVLAGTDAAAIG--RVCDGLVMVI
A0A2E0X9P6      QD---NPHHLLLGGR-IKELFDRLQRDYALIVVDTPPVLAASESLVLA--RAADAVVLCL
A0A2N1UCJ3      IL---NPSELLNSEA-FSNLLKELTHRYDRVIIDSPPVTSVADSQILA--AICDITILVI
M5UE94          PA---NPSELLQSDR-FSQLINVWRDKFDFIVVDTPPVLAVSDAAVVS--EEMDNVLLAV
A0A2E0X4J3      PS---HPVELLNNGY-FADLVTSLSEQFDRVIIDSPPVMPVADARVIA--AMSDATLLVL
A0A1P8WN28      IL---NAGMLLSMPA-LADILDWAVSEYDQVIVDCPPTLPVSDAAIVG--RYVDSMLFLM
A0A3B9CTT0      IL---NAGTLLSMPA-LSELLDWAVANYDQVMVDCPPSMPVSDAAIVG--RYVDGLLYLM
A0A2D5NDU9      PS---NPTEILNSEK-FGDLIAQACATYDRVIVDSSPMLPVADARILA--TKCDATVLAV
A0A286RGB6      SP---HRMAVLANGV-IGGLFRQLREDFDFVIVDGSPVLPVADTRFIS--THTDGVVLSV
A0A1V5N3W2      NG---QAIDQLARPE-TAEIIRTISQNYDHVIIDTPPVLAIPDALLWS--KMADAVVLSS
A0A3E0MY27      DH---ESIQSLTKEI-LGATLEQLRAEFDIIVIDTGPVLSVVDPLLIG--QHCDGAIVSV
A0A286RLF2      PA---NPAELLAGPR-TAELLNWAVEHYDQVIIDSPPAPLASDTAIWG--RLADGVILVL
A0A286RD13      DG---EVLEAVSQGK-LDRFLQSLRDQCDLVLVDSSPILTTADALILA--HVADSVVLSV
A0A3M1QRP3      RL---EESEILAGVA-PQRCLDAWRERYDMVLLDCSPILPVADARILA--RLADGTIMVV
A0A2E3RCU8      RQ---NPSELLASDR-LAQILAWAEGEYDQILVDCPPTLVASDAVLVG--RITDGMVIVV
A0A3E0MY88      RP---NPAELLTSRR-LADLLAWAETHYDQILVDSPPVLAASDVMVIG--RIVDGLVLVI
A0A1C3E6N1      PA---NPLELLSSTR-FSELLAYVESQYDQVLIDAPPILAVSDAGVLG--RMVDGVVLVV
A0A3B8PNV4      PT---SPAELLHGGR-FAELIAWAESSYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVV
A0A3D1DR40      PT---SPAELLHGGR-FAELIAWAESSYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVV
A0A2E7RYU8      PG---SPAELLHGGR-FAELIAWAESAYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVV
A0A3B8LXG8      PG---SPAELLHGGR-FAELIAWAESAYDQILIDAPPTLAVSDPAIIG--TMVDGVLLVV
F0SI78          NE---QYGELLHNPK-LASVLDALRDKYDVIFIDSPPVLAVADATAIA--PLADSLLLVI
A0A350CI62      PV---NPAELLSSER-FAALLSWAETRYDQIIVDAPPVLAVSDPAIAG--RLVDAVVLVV
A0A3C1X4W5      PV---NPAELLQSER-FAALLSWAETRYDQIVVDAPPVLAVSDPAIAG--RLVDAVVLVV
A0A3D3W3A7      PV---NPAELLQSER-FAALLSWAETRYDQIVVDAPPVLAVSDPAIAG--RLVDAVVLVV
A0A2E7ENQ5      PT---DPSGLLTNRR-FAEFVAWACDHYDQVLIDTPPILAASDASIVS--RLTGGLVLII
A0A1G3AQE9      PS---NPAELLSSQR-FSELLAWAESVYDQILIDSPPVLAASDTAVIG--RLTSGVVLVV
A0A3L7UQT9      PS---NPAELLASER-FSELLAWAETCYDQILVDAPPVLAVADPIIIG--RMVDAAVLVV
                                              :..*  *     .             .   

A0A2G2JCA2      MRDVSRISQVQSVVERLESVGASPMGTVLNGVSA-------------SYYSYHYGHYGYN
A0A286U4B3      KSGKISKESARRSLHQFAGKKAEVLGVVINSVDAARGDFYG------YGYGYGYGVEEKG
A0A1G2XVR0      KSGQTPKELTRRALLQYKNSKSDLLGIILNLVDVSKGGYYSYYYSHYYKYGYGYGAEPPK
A0A1G3B0P0      KSGQTPKELTRRALLQYKNSKSDLLGIILNLVDVSKGGYYSYYYSHYYKYGYGYGAEPPK
A0A1E3X4X0      KTGETNRDAVKRSIAQFNDINAKVLGVVMNNVDLSKGSYYYHYYQYYYRYGYGEEEEKKG
A0A1U9NNE1      FAGKTAADDLKEAYGRLHELNITVLGTVLNGVHTAHSY---------NKYGYRY------
A0A1N6KFT7      RPEATKRHDAERTVELLKTMESPVLGFIVNGIDRQNASGYGQ------GYGY---GYGYG
L0DFG4          RPEATKRHDAERTVELLKTMESPVLGFIVNGMDRQGTGSYGQ------GYGYGQ-GYGYG
M5SZR3          RLDKTTRKQAETAREILLSLDAPIVGIVANCVRTSELDALGR-----ARYGYGA-YEGYH
M5TW92          RLDKTTRKQAETAREILLSLDAPIIGIVANCVRTSELDALGR-----ARYGYGA-YEGYH
A0A0S8FY64      KASKSRCKAADRARRQLAAVNGRIIGAVLNDVRPKTLRRYGS-----YGYYYYD-YHRYY
A0A2E3GW02      KNSKHSRPHAKQARESLDLVGAPLEGMVVNLVCEETSYRYEG-----G-HYRRG-MYGSN
A0A1I3DDV4      RPAIDTKRKVFESIRRLTSSKSNLRGCILNTYGSSKEFTRDS-----GYYSSYN-YYGYG
A0A2E3GWC6      RMQKNNRPSIKRTLELLGSHGVNLMGVIANGVEATG-----G-----E-YSYRG-GYGGG
F0SLB0          RMQKNNRPSIKRTLELLGSHGVNLMGVIANGVEATG-----G-----E-YSYRG-GYGGG
A0A255R1S0      RIEKNNRTLVERAADILREQSTPAEAVIVNG-RASRRGYGYT-----G-YNYYS-KKEYG
A0A0J1B4A0      RIEKNNRTLVERATEVLTDKGIAIEGVIVNSRDSRSNHYAYS-----S-YDYYG-KKQYG
A0A1Z8N7H5      RPDKNRRKLVXRAXQNLTEMKIPLFGLVANGVGAENNKGYSF-----G-EGEGY-GYGYG
A0A2E2CCW9      RIDKNRRGVIRKVQQIIQTNGIKVAGILANSVKSGKP--GDY-----D-YGSGP-GYSDY
A0A3C0AGX3      RIDKNRRGVIRKVQQIIQTNGIKVAGILANSVKSGKP--GDY-----D-YGSGP-GYSDY
A0A0S8KNX5      FAGHTTMPDLKEATDRLAQINVRVLGTVLSSVQAEHSYYRHG----------HS-YYAQS
A0A3D3UVZ8      YAGHTTMPDLKEAKERLLQINVKVLGTVLSSVQAEHSYYRHG----------HS-YYAQS
A0A354PDV6      RAVTARKSEVANTLRRLSSAGAVTVGSVLNTLGAQKEFSSDG--------GYYG-YYRSG
M5TIT3          KIANVRRDEVVNTLHRVESAGGNFVGCMINAFGSGKKFDSDG--------GYYG-YYKSD
F2AXG2          KVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGAGKKFDSDG--------GYYG-YYKSD
M2BB46          KVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGAGKKFDSDG--------GYYG-YYKSD
L7CLQ6          KVANVRRDEVVNTLRRIDSSGGKMLGCMLNAFGAGKKFDSDG--------GYYG-YYKSD
A0A0J1B719      KVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGAGKKFDSDG--------GYYG-YYKSD
Q7UF18          KVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGAGKKFDSDG--------GYYG-YYKSD
A0A2G1W1E0      KVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGAGKKFDSDG--------GYYG-YYKSD
K5E235          KVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGAGKKFDSDG--------GYYG-YYKSD
A0A1U7CZ81      RYDISRAPQVERARRQLTNAGIPVLGTVINGMKSSDAYYGRY-----S-YSR----GRSG
A0A142YNY8      RYDVSRAPQVERARRQLDLAGIPVLGTVINGMRTSDSYYGRY-----S-YSRPG-ASTTD
A0A1U7GLS6      RFDVSRAPQVERARRQLDLAGIPVLGTVINGMRTSDSYYGRY-----T-YSR----QQSD
E8R3W3          MRNQSRRDRVYDAYERLHRFGIPVLGTVVTAATSPK-RYGYD-----P-YGY----YSYG
A0A3D2TNK4      RPEKNHRRSVMRAVESFHATGCHVFGVVANGLSSDSSGYGY------G-YGYGY-SYDGG
A0A142WSB9      RLEKNNRTVLRRACEQLDAHGIRLLGVIANDAAASTQTE-----------GSYG-NYEEY
A0A2S8FKY2      FKDVSQVAQVDDAKRILNSFGAPIIGTVLS--------------------GYSS-GMYYS
A0A432MJP4      RPSEIRRAAMHRVAEVVQMMGTPLLGSVVNADGSDDAQFLHA-----G--RYYG-RYGRS
M5UQ35          RVAKNNRTIVQRAAEILDEHGSRAMGVVINTQSPRSGDYGYS-----S-YNYYG-KKENG
A0A3A0DET7      RAERSTRRSAIGARNELWRVHANRLGVVLNSVPLRK----QA-----A-YGYGD-PYGYG
A0A2A2W9R6      RIEKNNRTLVERAAEILRDQRVPIDGVIVNGRDSRRRSYGYS-----S-YNYYG-KGEYG
A0A353FIP5      RFNLSSESEVAGACHRLKLAGAKTLGAVLNGQKG----------------GD-----EKD
A0A2E1VVJ1      RSNLLPEAVIEQATHRLRVSGAPAIGAILNGHRPSRLQRDYS-----S-YGY-----GYG
A0A3M2AEL0      RAGVVPEVVAASATKRIRLTGAKLMGCILNGVRAPRLGR-YS-----R-YGY-----SYG
A0A351FYP6      QYRKYPQLMTQRAKDMVIKVGGDLVGVVLNNINISQ-----------DSYYYYYSGYYYD
A0A0S8J591      QASKNRRGLVMRAKNQLASVNARLAGAVLNNVRGTKG----------DYYYYRQ-RYQPV
M5RT57          RRNVSREGQVKIAHDRLTKAGIKPLGTVLNGVPT-------------RSYAKTYGSYDYA
A0A1U9NL64      RADSSTRNVSVAACEALAGVGARPLGVVVTAPGKKMSK---------YGYGYGY-GYGYG
A0A1G2YPI3      RAEKSTRRNCLQAKHGLLSVGAHVLGVVVNDVPKKGH----------YGYYGSY-GYYYG
A0A2E7ESJ6      RIHKRARPLALRARDALVTTGANVIGVVVNGVDHETSSYY-------SEYKYGYAGYRYG
A0A2E9VK20      RLHKNRRPSVKRALEMFEAHEIPLLGVIANGLQDAS-----------GDYQYRG-GYGGG
A0A3D4PJK1      RLHKNRRPSVKRALEMFEAHEIPLLGVIANGLQDAS-----------GDYQYRG-GYGGG
A0A142YJ13      LRDVSQLPQIRAAFDWLTSMGVRILGAVVSGVP--------------AGSKHNY-GSYPG
A0A0S8GZ23      LAGQTESSDLKETLDLLSQINVKILGNVLCNVSPSSS-----------HYRYRY-GYGYG
A0A2D5AWU0      RLCVSTSPNAIRALGILRGVDARVVGTFVNDDSAKKT----------NAYAGGI-AYGAF
L0DC26          MRDVSRIPTVHAAYERLSRLGIRMLGAIVTGEQT-------------DHYGSSY-PSVSR
A0A3L7P4E4      RMNGRTRMGAVRAAETLRTLGANILGLIANGIDPTKH----------GGYGYQY-GVYGA
A0A3L7PEB5      RMNGRTRMGAVRAAETLRTLGANILGLIANGIDPTKH----------GGYGYQY-GVYGA
A0A356KTN1      SARTSSRSAATQANTELSRLGAAPVGLIFNQQPQDEA----------GAYFYYY-SR-YG
A0A2E2N5A9      RSEVTSSTEVERGVAQLRQNATPVDWVILNQVDIKKA----------ERHGYRY-SSYYD
A0A225EH48      LQDISQLPKVLTASEKLTQLNIPLLGAVVNGIKP-------------DIHAYGY-NYVKQ
A0A1G2YQB7      LAGRTETPDLKESIERLKQININLIGIVLSNVSYNKV-----------YYRYGH-DY-YG
A0A353P687      LAGHTETPDLKDTIERLKQINVNLLGIVLSNVKYNQI-----------YYPYGY-GY-YG
A0A3L7SI46      RPDKNRRKLVLRAVESFRMSGVEVIGIVANHIGSKSNS----------EYGYGY-GYSYG
D5SZ21          RPDKNQRRSVIRAAETLRMWGNNLLGLALNNMSSDRAG----------GYGYGY-GYGYG
A0A432MFP3      RHDQSRFPAVERANGLLTGAGIPVLGVVVNGARTSDR-----------RFGTGY-ATYTY
A0A257WS34      RPDKNRRRMVVRAVKSFIGAGVQVVGIAANHLANSPSQ----------DYGYGY-GYGYG
A0A2E8FLY0      RPDKNRRRMVIRAAESMAAVEATLIGAVINHIA-DTAGSEY--------YGCGY-EYDSK
A0A3D2U1E1      RPDKNRRRMVVRATESLAAVGSTMLGAVINHVT-AEAGGDY--------YGYGY-GFEYG
A0A1P8WP26      RPDKDRRRMVIRAAEALHNVGSNLLGVVVNHLSGSEAE----------GYGYGY-GYGYG
A0A3L7V1F3      RPDKDRRRMVIRATETLQTLGCTLLGVVINHLTTTDTD----------GYGYGY-GYGYG
A0A2E8B0L9      QPEKNHRRLVLRAAEQLLSMGVNLIGVVPNRVG-DDSSGYY------GGYGYGY-GYGYG
A0A3M1VCL4      RPDKNRRKMVIRAAEAFRAVDVPLLGIVVNNVSAEDGDGYY-------GYGYGY-GYGYG
A0A2E3GWX1      RPDRNRRRMILRAAESLQSLGANLLGVVVNRLS--DSSGEY-------SYGYGY-GY--G
F0SG60          RPDRNRRRMILRAAESLQSLGANLLGVVVNRLS--DSSGEY-------SYGYGY-GY--G
A0A2E9VST2      RPDRNKRRMIIRAAESVTSLGGNLLGVVVNGLS--DSRGEY-------GYGYGY-GYGEG
A0A356A6X2      RPDRNKRRMILRAAESVTSLGGTLLGVVVNGLS--DSRGEY-------GYGYGY-GYGEG
A0A2E0SMM6      RPDKNRRGMVFRSIETLQMFGIHISGVVVNHLTPDQGGEY-------YGYGYGY-GYNED
A0A356EME5      MQDVSRASQVRTACERLVAAGCRPVAAVLNGVSS-------------RRYEYSY-GYYES
A0A355AI52      RPEKNRRRVLIKAVETLRMLGVTLFGTIVNAVGLEE-----------MGYGYGY-GYGYG
A0A354PCQ3      MRDVSRLDSIHQTTRRLEAAGASVIGTVFSGVTSRQYVYRY------GDYQYAL-SGGDI
A0A2E7EGG1      MRDVSRENHVRMTYHRLLSVGARPVGTVLNGVPTRQYARRY------GTYGYET-ASSYS
A0A2E7K7A9      RIDKNRRGVIRKVQQIIQTNGIKITGLIANNVITNSL----------VGYDYID-NEGYQ
A0A1N6DAJ8      MRDVSRIPKVQEAYERLAKLGIRMLGAIVTGEKS-------------DHYGSKY-EYSAR
A0A2S8G191      LRDISRGVKVEEARELLNVFNVPFLGAVVVGITKEDV--------------YNY-TSQRN
A0A3L7NDH9      RPEKNRRRIIVRSVQTLRAFGVNIFGAVINGVGIEA-----------DGYGYGY-GYGYG
A0A2E0X9P6      LSDVSQSQQVRRAARCLDATGSRIAGAVLSGVPM-------------RRYTYAY-DYRPR
A0A2N1UCJ3      RAEKSTRKLAQQAREALAGIGARVLGAVVNDVSPKHSRYGYYSHY--SYYGYGY-GYGRK
M5UE94          RIIKNGRKSAIRACDILQRSGSEVGAIIVNGYQSKDKKYGYTGGYDADAYGYGY-GESHK
A0A2E0X4J3      RAERATRRLCQAARNELWQVRAKRLGVVVNGVPMRGA----------GSYGYGG-GYGYG
A0A1P8WN28      NPDKTHRRSVARAVDQLRSMGLKIVGIVANTSLSEDTS----------SYGYQY-GYGYG
A0A3B9CTT0      NPATTHRSMISRTVDTLRSLDLTPVGVVVNMGLSSEKEGQGYG----YGYGYGY-GYGYE
A0A2D5NDU9      SGGSTSTKNVSAAYDALTQVNATVLGIVLNNMPKMKGE---------VAYSYGY-GYGGG
A0A286RGB6      VRDISRAPQLRAARQVLESFHVRVLGAVMTGSAEDVY------------YAYPY-HSP--
A0A1V5N3W2      LAGHSNLTDFQETFHRLSQLHVRILGNVLANVAARHSY---------NRYGYGY-GYGYG
A0A3E0MY27      VRRVSQISNVYETCQRLQGTGIRLLGSVVNGVSGSQVSV--------GYYGYGY-GYEDG
A0A286RLF2      QPEKNKRRAVIRAAEYLALLKIPLLGIVINRLSNEKE----------KDYS---------
A0A286RD13      IQDKSRLPRVFEAVQRLRSVDLPLLGIVLHGTAPSRY----------RSYYRSY-TIDVE
A0A3M1QRP3      RDGHSDRRDVLDAIQTLRSAGGTILGSVFNGVPSR------------GGYYYHG-SYGYG
A0A2E3RCU8      RPEKNRRKVVFRAAQNLSEMKIPVYGLVANCIKAENG----------KGYNFGE-GEGYG
A0A3E0MY88      NPAKNRRRLVTRAYESLRTMGVTVLGIVANRIDQDQS----------KGYGYGY-GYTYS
A0A1C3E6N1      RPDKNQRRSVIRAAETLRMWGNNLLGLALNNMSSDRA----------GGYGYGY-GYGYG
A0A3B8PNV4      RPGTNRRRMVLRAAESITAIDADLLGVVINNVDSDTG----------GDYD---------
A0A3D1DR40      RPGTNRRRMVLRAAESITAIDADLLGVVINNVDSDTG----------GDYD---------
A0A2E7RYU8      RPGTNRRRMVLRAAESITAIDADLLGVVINNVDSDTG----------SDYD---------
A0A3B8LXG8      RPGTNRRRMVLRAAESITAIDADLLGVVINNVDSDTG----------SDYD---------
F0SI78          KNSKHSRPHAKQARESLDLVGAPLEGMVVNLVCEETSYRYEGGHYRRGMYGSNY-NYGTN
A0A350CI62      RPDKDRRRMVIRAAETLRTLGCTLLGVVVNHLNVDDA----------GGYGYGY-GYGYG
A0A3C1X4W5      RPDKDRRRMVIRAAETLRTLGCTLLGVVVNHLNLDDA----------GGYGYGY-GYGYG
A0A3D3W3A7      RPDKDRRRMVIRAAETLRTLGCTLLGVVVNHLNLDDA----------GGYGYGY-GYGYG
A0A2E7ENQ5      QPSKNHRRLVHRAVDEIRAANLELIGVVINRISDDGD----------SAYGYSY-GYGQG
A0A1G3AQE9      QPAKNRRRAVMRCVENLSVLKIPLLGIVLNRIGSEKE----------GGY-YGY-GYG-G
A0A3L7UQT9      RPDKNRRRMVIRAAEAFSAVEVNLMGVVVNHLSSDSS----------GDY-YGY-GYGYG
                                                                            

A0A2G2JCA2      HA----------------------------------------------------------
A0A286U4B3      KK----------------------------------------------------------
A0A1G2XVR0      ------------------------------------------------------------
A0A1G3B0P0      ------------------------------------------------------------
A0A1E3X4X0      ------------------------------------------------------------
A0A1U9NNE1      ------------------------------------------------------------
A0A1N6KFT7      YG----------------------------------------------------------
L0DFG4          YG----------------------------------------------------------
M5SZR3          QS----------------------------------------------------------
M5TW92          QS----------------------------------------------------------
A0A0S8FY64      KDYQEDEGDELEMPASVPVAVEDERPDDGPDEEGSAERFEPGTVSFVVRGGQDFSFSFEL
A0A2E3GW02      YN----------------------------------------------------------
A0A1I3DDV4      YG----------------------------------------------------------
A0A2E3GWC6      YA----------------------------------------------------------
F0SLB0          YA----------------------------------------------------------
A0A255R1S0      YV----------------------------------------------------------
A0A0J1B4A0      YV----------------------------------------------------------
A0A1Z8N7H5      YG----------------------------------------------------------
A0A2E2CCW9      YI----------------------------------------------------------
A0A3C0AGX3      YI----------------------------------------------------------
A0A0S8KNX5      AQ----------------------------------------------------------
A0A3D3UVZ8      AQ----------------------------------------------------------
A0A354PDV6      YS----------------------------------------------------------
M5TIT3          YT----------------------------------------------------------
F2AXG2          YT----------------------------------------------------------
M2BB46          YT----------------------------------------------------------
L7CLQ6          YT----------------------------------------------------------
A0A0J1B719      YT----------------------------------------------------------
Q7UF18          YT----------------------------------------------------------
A0A2G1W1E0      YT----------------------------------------------------------
K5E235          YT----------------------------------------------------------
A0A1U7CZ81      YG----------------------------------------------------------
A0A142YNY8      RE----------------------------------------------------------
A0A1U7GLS6      RE----------------------------------------------------------
E8R3W3          YT----------------------------------------------------------
A0A3D2TNK4      YS----------------------------------------------------------
A0A142WSB9      YS----------------------------------------------------------
A0A2S8FKY2      Y-----------------------------------------------------------
A0A432MJP4      YG----------------------------------------------------------
M5UQ35          YV----------------------------------------------------------
A0A3A0DET7      YG----------------------------------------------------------
A0A2A2W9R6      YV----------------------------------------------------------
A0A353FIP5      Y-----------------------------------------------------------
A0A2E1VVJ1      Y-----------------------------------------------------------
A0A3M2AEL0      Y-----------------------------------------------------------
A0A351FYP6      YY----------------------------------------------------------
A0A0S8J591      AE----------------------------------------------------------
M5RT57          RR----------------------------------------------------------
A0A1U9NL64      YS----------------------------------------------------------
A0A1G2YPI3      DD----------------------------------------------------------
A0A2E7ESJ6      YN----------------------------------------------------------
A0A2E9VK20      YD----------------------------------------------------------
A0A3D4PJK1      YD----------------------------------------------------------
A0A142YJ13      PK----------------------------------------------------------
A0A0S8GZ23      YG----------------------------------------------------------
A0A2D5AWU0      RK----------------------------------------------------------
L0DC26          TD----------------------------------------------------------
A0A3L7P4E4      GG----------------------------------------------------------
A0A3L7PEB5      GG----------------------------------------------------------
A0A356KTN1      YG----------------------------------------------------------
A0A2E2N5A9      YY----------------------------------------------------------
A0A225EH48      LP----------------------------------------------------------
A0A1G2YQB7      KP----------------------------------------------------------
A0A353P687      KT----------------------------------------------------------
A0A3L7SI46      YG----------------------------------------------------------
D5SZ21          YG----------------------------------------------------------
A0A432MFP3      RS----------------------------------------------------------
A0A257WS34      YG----------------------------------------------------------
A0A2E8FLY0      ED----------------------------------------------------------
A0A3D2U1E1      SG----------------------------------------------------------
A0A1P8WP26      YE----------------------------------------------------------
A0A3L7V1F3      YG----------------------------------------------------------
A0A2E8B0L9      YD----------------------------------------------------------
A0A3M1VCL4      YG----------------------------------------------------------
A0A2E3GWX1      YG----------------------------------------------------------
F0SG60          YG----------------------------------------------------------
A0A2E9VST2      YG----------------------------------------------------------
A0A356A6X2      YG----------------------------------------------------------
A0A2E0SMM6      YG----------------------------------------------------------
A0A356EME5      VE----------------------------------------------------------
A0A355AI52      YG----------------------------------------------------------
A0A354PCQ3      H-----------------------------------------------------------
A0A2E7EGG1      AD----------------------------------------------------------
A0A2E7K7A9      AY----------------------------------------------------------
A0A1N6DAJ8      TR----------------------------------------------------------
A0A2S8G191      RK----------------------------------------------------------
A0A3L7NDH9      YG----------------------------------------------------------
A0A2E0X9P6      AA----------------------------------------------------------
A0A2N1UCJ3      KE----------------------------------------------------------
M5UE94          AY----------------------------------------------------------
A0A2E0X4J3      -G----------------------------------------------------------
A0A1P8WN28      ND----------------------------------------------------------
A0A3B9CTT0      SQ----------------------------------------------------------
A0A2D5NDU9      VQ----------------------------------------------------------
A0A286RGB6      ------------------------------------------------------------
A0A1V5N3W2      HK----------------------------------------------------------
A0A3E0MY27      YG----------------------------------------------------------
A0A286RLF2      ------------------------------------------------------------
A0A286RD13      SR----------------------------------------------------------
A0A3M1QRP3      SA----------------------------------------------------------
A0A2E3RCU8      YG----------------------------------------------------------
A0A3E0MY88      YN----------------------------------------------------------
A0A1C3E6N1      YG----------------------------------------------------------
A0A3B8PNV4      ------------------------------------------------------------
A0A3D1DR40      ------------------------------------------------------------
A0A2E7RYU8      ------------------------------------------------------------
A0A3B8LXG8      ------------------------------------------------------------
F0SI78          YS----------------------------------------------------------
A0A350CI62      YG----------------------------------------------------------
A0A3C1X4W5      YG----------------------------------------------------------
A0A3D3W3A7      YG----------------------------------------------------------
A0A2E7ENQ5      YG----------------------------------------------------------
A0A1G3AQE9      YG----------------------------------------------------------
A0A3L7UQT9      YG----------------------------------------------------------
                                                                            

A0A2G2JCA2      ------------------------------------------------------------
A0A286U4B3      -------------------GIIERMKWTKGKEKVENT-----------------------
A0A1G2XVR0      ----------------------EKRKREKREKKEINV-----------------------
A0A1G3B0P0      ----------------------EKRKREKREKKEINV-----------------------
A0A1E3X4X0      ----------------------RKKRRSKG------------------------------
A0A1U9NNE1      -------------------YKASSSPADKNGPTRNRPLLLTSGN----------------
A0A1N6KFT7      -------------------TYGRGDDGLDQITPSTKE------------ITTSVSSSEST
L0DFG4          -------------------TYGR--DEVSPIVSDGKE------------IAAFGPPSKPT
M5SZR3          -------------------RNGTTSKSPNRLTSNNGH--------ANGALVTSTGDVEVN
M5TW92          -------------------RNGTTSKSPSRLTSNNGH--------ANGALVTSTGDVEVN
A0A0S8FY64      EDGQQTVVGRSSAECDIGLPSASVSPQHCRIANSGGRIVVEDLGSANGTFVGYRRVRRAT
A0A2E3GW02      -------------------YGTNYSYHQRRYRYYYEGTDA--------------------
A0A1I3DDV4      -------------------YGYGNRGYGRRVKDNGSAETENGHSLAGSTPAGRK------
A0A2E3GWC6      -------------------RQQPAKPTTPPPILTKQ------------------------
F0SLB0          -------------------RQQSAKPTTPPPILTKQ------------------------
A0A255R1S0      -------------------STYRRYYEADADGQDEDRPIRSARAATSSRVVNGKVNGHAK
A0A0J1B4A0      -------------------ANYRRYYEANDDDDAGSAPRRKRSSSKRTAAASTRSLPIPE
A0A1Z8N7H5      -------------------DDENNDEDEGEIEQQGNRDSYQGISFQSKTFDQSENXQEKL
A0A2E2CCW9      -------------------VPPQAQAKQADVPAKTKITH---------------------
A0A3C0AGX3      -------------------VPPQAQAKQADVPAKTKITH---------------------
A0A0S8KNX5      -------------------SRESARRSRRKLMFSVDGGVDHSSGLETSVAERSADNYSYT
A0A3D3UVZ8      -------------------TRESARVSRRKLMFSMEEGADNTYDSKIPESDKPGEGFSYS
A0A354PDV6      -------------------EVSVPQR-----SLQNGAIPS-----------------YNG
M5TIT3          -------------------RAASSNGRKPRVGESSASAAT-----------------VNG
F2AXG2          -------------------RPSSSTTRQ---AAPKAATIS-----------------SNG
M2BB46          -------------------RPSSSTTRQ---AAPKAATIS-----------------SNG
L7CLQ6          -------------------RPSSSTTRQ---AAPKAATIS-----------------SNG
A0A0J1B719      -------------------RPTSSATRQ---AAPKAATIS-----------------ANG
Q7UF18          -------------------RPSSSTTRQ---AAPKAATIS-----------------SNG
A0A2G1W1E0      -------------------RPSSSTTRQ---SAPKAATIS-----------------SNG
K5E235          -------------------RPSSSTTRQ---AAPKAATIS-----------------SNG
A0A1U7CZ81      -------------------EP-DASPTT--------------------------------
A0A142YNY8      -------------------RPADATSAG--------------------------------
A0A1U7GLS6      -------------------RPAGATPAD--------------------------------
E8R3W3          -------------------YYYQHQRAS-----------------------------EDG
A0A3D2TNK4      -------------------HEEEQDMVDTADTMMTPMPEIVQLPSIASEEHLPSASPQEH
A0A142WSB9      -------------------TAPA----------------------------------TSG
A0A2S8FKY2      ---------------------------------------------------------TNR
A0A432MJP4      -------------------SVDGSGPRTGSVWPSGT---------------------AAG
M5UQ35          -------------------ASYRRYYAASDVADEETPVSSSARLSAAKLRGVSGLPAQEG
A0A3A0DET7      -------------------HQYGYGEYAAIEEA--------------SAP-------DRG
A0A2A2W9R6      -------------------DSYRQYYESEEEDSSPTSKRSQKRINGEAAK-------LNG
A0A353FIP5      -----------------------------------------------YYE-------E-G
A0A2E1VVJ1      -----------------------------------------------SYK-------QEG
A0A3M2AEL0      -----------------------------------------------AYG-------Y-G
A0A351FYP6      -------------------YKSRETEEEPVEDKKDGKEEKLIAQADAAGEDVNP------
A0A0S8J591      -------------------MMEEAGV----------------------------------
M5RT57          -------------------FE---------------------------------------
A0A1U9NL64      -------------------YEEDDKSSAKSA-----------------------------
A0A1G2YPI3      -------------------RKKKKTGDRRPDGVVKDSALDAKAID---------------
A0A2E7ESJ6      -------------------SRYGEYSSDAQEQKAISKYYDDESSQTLQHESPYQS-----
A0A2E9VK20      -------------------KKSPYQQTNDIPEFLAPTQAVIPS-----------------
A0A3D4PJK1      -------------------KKSPYQQTNDIPEFLAPTQAVIPS-----------------
A0A142YJ13      ------------------------------------------------------------
A0A0S8GZ23      -------------------RRRGDGNNDKRKRPKPKTLLISGPGSK--------------
A0A2D5AWU0      -------------------VEALEAPLPPRSDAGV-------------------------
L0DC26          -------------------KR---------------------------------------
A0A3L7P4E4      -------------------RASKYYAEAPNKR----------------------------
A0A3L7PEB5      -------------------RASKYYAEAPNKR----------------------------
A0A356KTN1      -------------------GEPKDEES---------------------------------
A0A2E2N5A9      -------------------QYGSGSPS---------------------------------
A0A225EH48      -------------------A----------------------------------------
A0A1G2YQB7      -------------------ATVKELKQ-------------NLPSENTSEKVKQQV-----
A0A353P687      -------------------NVIKDVKQ-------------EPADNIVIPEVK--------
A0A3L7SI46      -------------------HDDRSDTTTEA--------------------TDDEYEVKTP
D5SZ21          -------------------HTDTDGDHDDL----------------LDDHASSHSSYSSR
A0A432MFP3      -------------------DRISDPGGGVSGS----------------------------
A0A257WS34      -------------------YGHDDAIEDPA-------------------LAAMEDDDGYR
A0A2E8FLY0      -------------------EE----LKQAA------------------------------
A0A3D2U1E1      -------------------EESSDGLKQAA------------------------------
A0A1P8WP26      -------------------ENDTHPTDERRQPSHNQADVAVSLSMIGSGPEPEDS--ADK
A0A3L7V1F3      -------------------YGHENEHEEQPER-----DVASGLSALASGKSREADLRERN
A0A2E8B0L9      -------------------DGYGMDEEDED-----------------DIQTSASDSIQPR
A0A3M1VCL4      -------------------YGYAESDDEEH-----------------DGKRRSGRGKRAK
A0A2E3GWX1      -------------------YGHEDPVQDQP-------AAWSDFYDAEPERQKKERKRFSR
F0SG60          -------------------YGHEDPVQDQS-------AAWSDFYDAEPERQKKERKRFSR
A0A2E9VST2      -------------------EGHDDPTHDDE----------EEAIPMTQSNSHRPRKRFSR
A0A356A6X2      -------------------EGHDDPTNEVE----------EEAIPISNNNSQRPRKRFSR
A0A2E0SMM6      -------------------HEDTQAEQ-------------GYGDDGYGDDGYVGDGHADD
A0A356EME5      -------------------E----------------------------------------
A0A355AI52      -------------------YGD------------------EYGLDDDGEYGDEEE-----
A0A354PCQ3      ----------------------------------------DDEFSDDNVSLGKGG-----
A0A2E7EGG1      -------------------QEEVT------------------------------------
A0A2E7K7A9      -------------------F--------------------EKPAPEPAKPAANPAKTEVT
A0A1N6DAJ8      -------------------ESV--------------------------------------
A0A2S8G191      -------------------KQLVHVES---------------------------------
A0A3L7NDH9      -------------------T---PYGDEVEEESIDDAFVTDDALADHEDSNVDDG-----
A0A2E0X9P6      -------------------A---DYGS---------------------------------
A0A2N1UCJ3      ------------------------------------------------------------
M5UE94          -------------------YGEKSAPF---------------------------------
A0A2E0X4J3      -------------------YGYGGYGD-------------PVADEPLPSGRRKKSRVIEP
A0A1P8WN28      -------------------Y---GYGH-------------DDEEDDLDSVDFPPP-----
A0A3B9CTT0      -------------------Y---GYGH-------------DEDDDEYDQM----------
A0A2D5NDU9      -------------------ARQ-PYAFTAAGP--------EVEVTRQPTSGPSRD-----
A0A286RGB6      ----------------------------------------IVEGDSQRQEAPERG-----
A0A1V5N3W2      -------------------HNPPDGKQIDMKQLMLLLRPDEKKKDTSPSEESSKN-----
A0A3E0MY27      -------------------REELSHEV-------------AES-----------------
A0A286RLF2      -----------------------GYSG-------------DYYGQPDESHEEKEV-----
A0A286RD13      -------------------A----------------------------------------
A0A3M1QRP3      -------------------A---RNVY-------------GPATDNDPLDVRVI------
A0A2E3RCU8      -------------------Y---GYGD-------------DDSGSLDEADGTTLN-----
A0A3E0MY88      -------------------Y----GGS-------------DEETHHVEEPLPHAESPELA
A0A1C3E6N1      -------------------HTDTDGDH-------------DDLLDDHASSHSSYS-----
A0A3B8PNV4      -----------------------GYGY-------------EYGGEDEPASSPHRL-----
A0A3D1DR40      -----------------------GYGY-------------EYGGEDEPASSPHRL-----
A0A2E7RYU8      -----------------------GYGY-------------EYGGEDEPASSPHRL-----
A0A3B8LXG8      -----------------------GYGY-------------EYGGEDEPASSPHRL-----
F0SI78          -------------------YHQRRYRY-------------YYEGTDA-------------
A0A350CI62      -------------------Y---GYGH-------------DQEPEEQSGSGGHSG-----
A0A3C1X4W5      -------------------Y---GYGH-------------DQEPDEQSGAGSQPS-----
A0A3D3W3A7      -------------------Y---GYGH-------------DQEPDEQSGAGSQPSLSGYG
A0A2E7ENQ5      -------------------H---GYHE-------------DANVDDDPTTLPIQD---PQ
A0A1G3AQE9      -------------------Y---GYIY-------------KYGADADSKDESELA---EA
A0A3L7UQT9      -------------------Y---GYGY-------------GYGHDD--------A---NA
                                                                            

A0A2G2JCA2      ---------------------------------------------
A0A286U4B3      ---------------------------------------------
A0A1G2XVR0      ---------------------------------------------
A0A1G3B0P0      ---------------------------------------------
A0A1E3X4X0      ---------------------------------------------
A0A1U9NNE1      ---------------------------------------------
A0A1N6KFT7      NGL---------------PQPLLKD--------------------
L0DFG4          NGL---------------PQGILKD--------------------
M5SZR3          -GHGDKHSSNPLE-----ERGNPNS--------------------
M5TW92          -GHGDTHSSNPLE-----ERGNPNS--------------------
A0A0S8FY64      VGPGDVIRISPYTISVEGPTGNRAG--------------------
A0A2E3GW02      ---------------------------------------------
A0A1I3DDV4      ---------------------------------------------
A0A2E3GWC6      ---------------------------------------------
F0SLB0          ---------------------------------------------
A0A255R1S0      HASDVAEAAHPVTLDRK----------------------------
A0A0J1B4A0      AASSNGHVANGSTVNGSSNGHPTT---------------------
A0A1Z8N7H5      PAKFRKTA-------------------------------------
A0A2E2CCW9      ---------------------------------------------
A0A3C0AGX3      ---------------------------------------------
A0A0S8KNX5      QSSESRKDTGRK--RKKPRLSVEDGAD-------KTDDPETPRTS
A0A3D3UVZ8      QSVESRKSVMRKRTRKKPPVSNEDIADADNTDTSETDSENRPTEA
A0A354PDV6      RVGSVITTRASDIGSRD----------------------------
M5TIT3          RASHD----------------------------------------
F2AXG2          RVAE-----------------------------------------
M2BB46          RVAE-----------------------------------------
L7CLQ6          RVAE-----------------------------------------
A0A0J1B719      QPKSK----------------------------------------
Q7UF18          RVAE-----------------------------------------
A0A2G1W1E0      QPKPE----------------------------------------
K5E235          RVAE-----------------------------------------
A0A1U7CZ81      ---------------------------------------------
A0A142YNY8      ---------------------------------------------
A0A1U7GLS6      ---------------------------------------------
E8R3W3          AA-------------------------------------------
A0A3D2TNK4      QSHETPFQTKSANSTTPLKPRRVA---------------------
A0A142WSB9      GAARSKAAAGKLW--------------------------------
A0A2S8FKY2      STSTVEVE-------------------------------------
A0A432MJP4      EGASASWAPASLLRRLRTGGPGPGFGNGGRGVNGNGKLG------
M5UQ35          RPSRIDVFADGPVMEEQSVNGHSHENVKSGGLNGVASTEARLSDR
A0A3A0DET7      RKKSRALVKAATEPAITSQE-------------------------
A0A2A2W9R6      RSARDRLISGKR---------------------------------
A0A353FIP5      RSR------------------------------------------
A0A2E1VVJ1      RSSGSEL--------------------------------------
A0A3M2AEL0      YGDGSK---------------------------------------
A0A351FYP6      ---------------------------------------------
A0A0S8J591      ---------------------------------------------
M5RT57          ---------------------------------------------
A0A1U9NL64      ---------------------------------------------
A0A1G2YPI3      ---------------------------------------------
A0A2E7ESJ6      ---------------------------------------------
A0A2E9VK20      ---------------------------------------------
A0A3D4PJK1      ---------------------------------------------
A0A142YJ13      ---------------------------------------------
A0A0S8GZ23      ---------------------------------------------
A0A2D5AWU0      ---------------------------------------------
L0DC26          ---------------------------------------------
A0A3L7P4E4      ---------------------------------------------
A0A3L7PEB5      ---------------------------------------------
A0A356KTN1      ---------------------------------------------
A0A2E2N5A9      ---------------------------------------------
A0A225EH48      ---------------------------------------------
A0A1G2YQB7      ---------------------------------------------
A0A353P687      ---------------------------------------------
A0A3L7SI46      MAA------------------------------------------
D5SZ21          TAA------------------------------------------
A0A432MFP3      ---------------------------------------------
A0A257WS34      IAA------------------------------------------
A0A2E8FLY0      ---------------------------------------------
A0A3D2U1E1      ---------------------------------------------
A0A1P8WP26      KAA------------------------------------------
A0A3L7V1F3      RAA------------------------------------------
A0A2E8B0L9      RAA------------------------------------------
A0A3M1VCL4      KAA------------------------------------------
A0A2E3GWX1      KAA------------------------------------------
F0SG60          KAA------------------------------------------
A0A2E9VST2      DESSDRYAA------------------------------------
A0A356A6X2      DQSSDRYAA------------------------------------
A0A2E0SMM6      GYRHAPATLEYANYDQQYESGYEDDDYEANPYHAA----------
A0A356EME5      ---------------------------------------------
A0A355AI52      ---------------------------EENYMRAA----------
A0A354PCQ3      ---------------------------------------------
A0A2E7EGG1      ---------------------------------------------
A0A2E7K7A9      S--------------------------------------------
A0A1N6DAJ8      ---------------------------------------------
A0A2S8G191      ---------------------------------------------
A0A3L7NDH9      ---SDPGVEDRVLPMNPRSGTSSRSRGASNPRAVA----------
A0A2E0X9P6      -------------------------------GEAF----------
A0A2N1UCJ3      ---------------------------------------------
M5UE94          -----------------------------DLQSVS----------
A0A2E0X4J3      VAAETE---------------------------------------
A0A1P8WN28      --------------------------PSSDLGKVA----------
A0A3B9CTT0      ----------------------------TDGELAA----------
A0A2D5NDU9      -------------------SSAADDGHADERPSAD----------
A0A286RGB6      ---------------------------------------------
A0A1V5N3W2      ---------------------------------------------
A0A3E0MY27      ---------------------------------------------
A0A286RLF2      ----------------PEITESISTPERTVPRRVA----------
A0A286RD13      ---------------------------------AE----------
A0A3M1QRP3      ---------------------------------------------
A0A2E3RCU8      --AEDNYADINFQMRPLDQKVSEIENASIHFRKSA----------
A0A3E0MY88      APGSVSFELDSTAPWPPQTQQQVVHDGTTVPRKVA----------
A0A1C3E6N1      ------------------------------SRTAA----------
A0A3B8PNV4      ---------------------------------AA----------
A0A3D1DR40      ---------------------------------AA----------
A0A2E7RYU8      ---------------------------------AA----------
A0A3B8LXG8      ---------------------------------AA----------
F0SI78          ---------------------------------------------
A0A350CI62      -SPEQPVAAGHSVSAGLYSISVGGSRSSGDSSRAA----------
A0A3C1X4W5      ---------------------------------------------
A0A3D3W3A7      MTSGQSATAGQSVSAGLYSISVGGSRGSGDSSRAA----------
A0A2E7ENQ5      V------------------FQRPADDASEPRRRAA----------
A0A1G3AQE9      AAIGKDAAGAQGNGVSRWKEADPPPGLVP--RRVA----------
A0A3L7UQT9      AAESEHEAG----------DEEPASDEVQPLRRAA----------
                                                             

© 1998-2019