BYKdb

Dataset for cluster cd of phylum proteobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

32 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E9TE88      ------------------------------------------------------------
E7T801      ------------------------------------------------------------
F4SM97      ------------------------------------------------------------
G5Q4J0      ------------------------------------------------------------
G5LQM6      ------------------------------------------------------------
G5SDT8      ------------------------------------------------------------
F3CAY9      --------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFG
A3K8W7      MNMMDSRKFRRKRKPLTTETPSPQEDASKDMAPVPPL----------ETREERLARRARE
G7EJX6      ------------------MLLSPEEQAAQQMLSLVAVFNAKL--SIEPVRSTQLVKISFE
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
D0D9W0      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
I1AYC5      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
E7T801      ------------------------------------------------------------
F4SM97      ------------------------------------------------------------
G5Q4J0      ------------------------------------------------------------
G5LQM6      ------------------------------------------------------------
G5SDT8      ------------------------------------------------------------
F3CAY9      LTQ--------YAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTI
A3K8W7      EGEGQTRPDPDAARQARAREAARIAAAAARQKAEAESKAQADAQRRAEEQAHDEAEAEAQ
G7EJX6      SSD------------------PKLAALVANTVGEVYIESQMRAKMGITQQASNWLNTRLS
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
D0D9W0      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
I1AYC5      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
E7T801      -------------------------------------MQETFTVSERSKESGMLELTMTG
F4SM97      -------------------------------------MQESFSVTDQGKDTGILTLTLRG
G5Q4J0      -------------------------MSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTG
G5LQM6      ---------------------------------MINNLQNNLTVTETGKDTGVLSLTFTG
G5SDT8      ---------------------------------MINNLQNNLTVTETGKDTGVLSLTFTG
F3CAY9      NRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIED
A3K8W7      RQAEEQARAKAEAEAQRQAEEQAHAEAEAEAQRRAEEQARAEAEAEAQRQA---------
G7EJX6      QLRIQLDTSEQKLQAYREAQKLVDIEGIAGLVTQELEQMSQQLVVARNEKN---------
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
D0D9W0      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
I1AYC5      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
E7T801      DDPQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQ
F4SM97      EDPKHLEQVLDSISDNYLAQNIARQAAQDAKSLEFLNAQLPKIRSDLDLAEDKLNQYRRQ
G5Q4J0      EDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
G5LQM6      EDRDKIRDILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
G5SDT8      EDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
F3CAY9      QDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTS
A3K8W7      -EEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAE
G7EJX6      -NLQSINRVISEYGNNNLELLGSMPEITSHKVVQDVKREVILVERKVSELSEVYGPKHPK
S9QRP1      ------------MAERRKFQRRKRRLSEDVAPETPIAEPRPEDRIDPAEPRRPEQDLRAD
G8AU96      ----------------MNLRRGV--------------------G----------------
D0D9W0      ------------MTERRRFRRRN--------------------R----------------
Q0FMP0      ----------MTMVERRKFRRRNRNPIDDGPEEPPIEPLESRDR----------------
A3W0H7      ----------------MKLKRHE----------EYMRRRAARRA----------------
I1AYC5      ------------MTDDRKFRRRN----------PLSAEIAAGEQ----------------
F0G6H5      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
E7T801      RDSVDLNLEAKAVLEQIVNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERK
F4SM97      KDSVDLSLEAKSVLDQIVNVDNQLNELTFRESEISQLYTKEHPTYKALMEKRKTLQDEKS
G5Q4J0      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKA
G5LQM6      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKA
G5SDT8      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKA
F3CAY9      ARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQ
A3K8W7      ------------AQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAEAE-A
G7EJX6      ------------IISAKAELATVKTNLNKQIKG---LITGIEKELNRITRTVSALEADLA
S9QRP1      VEPAHRERAQATMRRIADARRASEARLKAQQAHEAEKARAAEAAKAAEEDAARAAEAARE
G8AU96      ----------ELKLRIRDEVGKIQKGL----DADLEVARIREATLLKSIADLQEQQKGIE
D0D9W0      ----------PLDDLPDEDIAPVEP------------------------LGTRAEGLARR
Q0FMP0      ----------RLERRRAEDKAALAEETAHAAEEAARRSAEEQ--------------ARQR
A3W0H7      ----------EMEAEAEEDAAVLHPNLDWPDDEDSVLATVPE------LLNLPEPEPEPE
I1AYC5      ----------AAKLARAEDARRMAAA-----EEQSRIAAAQEAERQHKLTAERQAEAGRR
F0G6H5      --------------------------------------------MAVVAALLLGVLAAGA
Q74BQ8      --------------------------------------------MSRIEQALEKAAMLRG
F0JCB8      --------------------------------------------MSRIEDALKKASEKRD
Q314L3      --------------------------------------------MSRIEQALARARKDKE
B5EA81      --------------------------------------------MSRIEEAMEKAARMRN
C6DZX5      --------------------------------------------MSRIEEAMEKAARMRQ
A1ARV8      --------------------------------------------MSRIEKAMERAAQVRN
I5B296      --------------------------------------------MGKIFKALEKAGNKVT
H8YYB9      --------------------------------------------MERIKQALERARAERA
G7QCG1      --------------------------------------------MSRIEEALGKAAERQA
I2Q341      --------------------------------------------MSRIEEALGKAAERQA
C7LPS3      --------------------------------------------MSRIEEALAKAAGMQS
C0QCJ2      --------------------------------------------MGKIFKALEKSKEIDM
Q39U17      --------------------------------------------MSRIESILEKAAKMRQ
B9M2X6      --------------------------------------------MSRIEEALEKAAKMRG
A5G424      --------------------------------------------MSRIEEALEKAARLRS
E8WSZ5      --------------------------------------------MSRIEMAMEKAARLRE
                                                                        

E9TE88      ------------------------------------------------------------
E7T801      RLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQ
F4SM97      KLNQRVTAMPKTQQEILRLSRDVNSGQAVYMQLLNRQQELNIAKSSAIGNVRIIDNAVSQ
G5Q4J0      KLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQ
G5LQM6      KLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQ
G5SDT8      KLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQ
F3CAY9      GLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTN
A3K8W7      EAQRQAEEQARTDAETEGRRRKLAEARQAAK--LRRAEEARRAAEADADDADDEDEDGTA
G7EJX6      KIRAEYQNITRKETQYNQLKREVETNRSIFNTFLSRSKETEVTSDFTSAAARFTDRAYAP
S9QRP1      A----------EAERKADAARTAAAEQAAEVARQKNAAREAEAAQEAARAAEQADQEAAV
G8AU96      A----------TGIQLRDLERAADAHRTLYRSLAERYEQTMALKNTGALDAHLSA-----
D0D9W0      E----------TKTSAAQATRRAEAERVAEPARPEARRGQTAPR----------------
Q0FMP0      A----------AEEARLQEQREAEAREEARRQTTAKREEIRKRLRVH--DGDKVT-----
A3W0H7      P----------EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP--EPEPEP-----
I1AYC5      A----------AAERQGEVERQGEVERLAEVERRAKAEQQAEAKRRA--EAEQLA-----
F0G6H5      YLMLRQRFVGTVSDPGEIEWTTGLPVIATVPRGESPRLAG-------ADARNRPHASAAS
Q74BQ8      ----------TTDRGQAVAPRQMEDLQPLERAELPPLPAEP------LEGIRHDNPLLAT
F0JCB8      ENRRREPETVPSVEPVAAPVMEAASPVDASLDFSPLQSDCLD--------RARQQRMLVA
Q314L3      HNAEDTPPR-PAGGGGAPSGVPHTPAEDSGGPAGPLPAPRVA-----AARQVRLSPKLVT
B5EA81      -GMEPPPPE-SVREPAGASALPPQTPQPVGSPALPPQPPQIPAVSPQYGRLAPQNPFLVN
C6DZX5      -GMEPPPPG-AAPQSAGNSALPPQTPQPVVSPALPPQPPQISPVSPQYGRLAPQNPFLVN
A1ARV8      --------------SAGVMRQPQETAARSGMVHTAPLPDMV------VNKVMSDDPLLVS
I5B296      A-------------EKESELRDDTALVCDNPDSQVYKQSDEVT----QSGSRRTDSALVT
H8YYB9      A---AQLADVPVLSTQKVIAQEQETKPAGPGVQVSYTETRSLS----LDPEQLRAKR-VL
G7QCG1      G---MPRPEARLFFRQEATLPPP-----------------SQA----IDPARLSEEKLVV
I2Q341      G---MPRPEARLFFRQDAPLPQP-----------------SQA----IDPARLSEEKLVV
C7LPS3      G-------------------LHSKGNRAGVSGIARAPMGESTS----VGGVRLAEETMVV
C0QCJ2      GDSAVVENDSREDDLQDDTAGEENSRGDESPETGAHVQEDPQT----IELPQSLDKSLVT
Q39U17      DKTPG----------ESRVLVEQREVPRAVIEPEVFQPDTRIA----VDNP-----YLVT
B9M2X6      TDGKAAL--------GKVPGSPLAVAHGSVHAYQQPMPNERLK----VKNP-----LVVS
A5G424      S--------------ERSNVTVGKTVATAVHVPPLPSSPAAAK----IENP-----FIVT
E8WSZ5      NGGQTPAQDQAQARPDTATAAAAPRAREAERVPPVVPAGQALS----PQNP-----FLVT
                                                                        

E9TE88      ------------------------------------------------------------
E7T801      -PQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVE-APEQLEEHGISVYATIPMSE
F4SM97      -PKPVKPKKILVLAVGFVLGLIVSLSLVFSRIFLRRGIE-SPEQLEEIGINVYASIPVAE
G5Q4J0      -PGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIE-SPQVLEEHGISVYASIPLSE
G5LQM6      -PGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIE-SPQALEEHGISVYASIPLSE
G5SDT8      -PGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIE-SPQALEEHGISVYASIPLSE
F3CAY9      VEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIE-SAEVIESLGMPVYASLPHSR
A3K8W7      -EQADTPVARPAPAMPTLALTPEQRSPAADQTPLPQSTRLQTDTAWR-------DLPVAR
G7EJX6      -NKPSKPNKKLIVVLAFVASFGFAIVMSFVFDALNDTAKTKNDVEGKLAQRMLGLLPHVK
S9QRP1      AHDPEPDADGAAPAAP------------------------TQAEAPVAKNSARGTTTADP
G8AU96      --PALPPIRPAFPQLR------------------------MSLGVGLVGSTALAVALVLL
D0D9W0      ---------------P------------------------AAPAVATRTAQSPTLPQQRG
Q0FMP0      --APATASAP-----V------------------------EAETAPAQAPRSPARKPTPL
A3W0H7      --EPEPEPEPEPEPEP------------------------EPVVASDVAPEPTPAPPPLL
I1AYC5      --EATRRAEAEHQAQA------------------------ERQAGADRQAK-DDASPDMV
F0G6H5      RGGLADPA----------------------------------------------------
Q74BQ8      LNDPHSYV----------------------------------------------------
F0JCB8      MNEPISLA----------------------------------------------------
Q314L3      ATAMQSGL----------------------------------------------------
B5EA81      LHDPHSPA----------------------------------------------------
C6DZX5      LHDPHSPA----------------------------------------------------
A1ARV8      LNDPASPV----------------------------------------------------
I5B296      ASDPHSPV----------------------------------------------------
H8YYB9      LNEVRSPI----------------------------------------------------
G7QCG1      LKSPASPE----------------------------------------------------
I2Q341      LKSPASPE----------------------------------------------------
C7LPS3      INAPLSPM----------------------------------------------------
C0QCJ2      HLKPHSSE----------------------------------------------------
Q39U17      ISEPRSPV----------------------------------------------------
B9M2X6      VTAPQTSV----------------------------------------------------
A5G424      VNDPHTPA----------------------------------------------------
E8WSZ5      ILDPHSQA----------------------------------------------------
                                                                        

E9TE88      ----------------------------------------------------MMQ-----
E7T801      WLDKRTRLRKKNLFSNQQRHRTKN-IPFLAVDNPADSAVEAVRALRTSLHFAMME-----
F4SM97      NSV-----KKASQIKRFKQKAEKEYTTFLFIENPADLAIESIRGLRTSLHFAMME-----
G5Q4J0      WQKARDSVKTIKGIKRYKQ------SQLLAVGNPTDLAIEAIRSLRTSLHFAMMQ-----
G5LQM6      WQKARDSVKTIKGIKRYKQ------SQLLAVGNPTDLAIEAIRSLRTSLHFAMMQ-----
G5SDT8      WQKARDSVKTIKGIKRYKQ------SQLLAVGNPTDLAIEAIRSLRTSLHFAMMQ-----
F3CAY9      QQE-----RLEKRDQDSKD------SRLLSIAAPGELAIESLRSLRTSLHFAMLE-----
A3K8W7      FEL-----SQLNRHRVVTA------DRL-------DPAHATFDVLRTRLMHTLSE-----
G7EJX6      LPK-----NSVFPIHAYLD------ENY-------RRFAESVRTFRTSLLLTQLE-----
S9QRP1      WDALRSISVDERQLDRNRVITAGRHDPA----------HTAFDVLRTRLLQALAE-----
G8AU96      LERLSSGLRTPTQVERATGVPCLGMVPSLPRNEATWNLPLHPDSRRAREIGAFREAIQTV
D0D9W0      WDDLAEFSVDARHLERNRIVTAARQDPA----------HAAFDILRTKLLQGLAD-----
Q0FMP0      WHRLQEFTVNPRHLERHRIITAERQDPA----------HAAFDVLRTRLLQALAE-----
A3W0H7      WPALRRVVLDPKHLAMHRLISATREDPA----------HVAFDVLRTKLLAALRA-----
I1AYC5      WSRLPVFSVNARHLDRNRIVTAGRQDPA----------HAAFDVLRTRLLQALSE-----
F0G6H5      --------------------------------------IESLRNFRTTLQ--LSL-----
Q74BQ8      --------------------------------------SEEYRKLKSAIVA-GTS-----
F0JCB8      --------------------------------------AEEFRKLKQSLVR-KTK-----
Q314L3      --------------------------------------SEEYRKLKERLVK-LTK-----
B5EA81      --------------------------------------AEEYRKLKSALVK-MTT-----
C6DZX5      --------------------------------------AEEYRKLKSALVK-MTT-----
A1ARV8      --------------------------------------AEEYRKLKAILVK-MTS-----
I5B296      --------------------------------------SEQFRLLKNNIL--FPE-----
H8YYB9      --------------------------------------VDAYNVLRTRILQRLR------
G7QCG1      --------------------------------------AEEFRKLKEALVKAIRD-----
I2Q341      --------------------------------------AEEFRKLKEALVKAIRD-----
C7LPS3      --------------------------------------AEEYRKLKEALVK-MTK-----
C0QCJ2      --------------------------------------AEQFRILKTTIL--FPK-----
Q39U17      --------------------------------------TEEYRKLKSIILK-LTN-----
B9M2X6      --------------------------------------AEEYRKLKSLLVK-LTN-----
A5G424      --------------------------------------AEEYRKLKSILVK-LTK-----
E8WSZ5      --------------------------------------AEEYRKLKSMLVK-LTD-----
                                                                        

E9TE88      -----------AQNNVLMMTGVSPSIGKTFVCANLAAVISQTNK-RVLLIDCDMRKGYTH
E7T801      -----------TENNILMITGATPDSGKTFVSSTLAAVIAQSDQ-KVLFIDADLRRGYSH
F4SM97      -----------ARNNILMISGASPNAGKTFVSSNLAAIIAQTGK-KVLFIDTDMRKGYTH
G5Q4J0      -----------AQNNVLMLTGVSPSIGKTFVCANLAAVISQTHK-RVLLIDCDMRKGYTH
G5LQM6      -----------AQNNVLMLTGVSPSIGKTFVCANLAAVISQTHK-RVLLIDCDMRKGYTH
G5SDT8      -----------AQNNVLMLTGVSPSIGKTFVCANLAAVISQTHK-RVLLIDCDMRKGYTH
F3CAY9      -----------ARNNVLMISSPTPGAGKSFVSSNLATIIAQTGR-RVLLIDADMRKGYLH
A3K8W7      -----------RGWKRVAVTSPGKGCGKTFTVANLAISLSRQENTRTLVMDFDMRRPSLH
G7EJX6      -----------RDLKVIAVTSSSPGEGKTTTSANLAMSLAQMG--KVLIIDGDLRKPSIA
S9QRP1      -----------HGWTRVAITSPTKDCGKTFTAANLAISLSRQENCRTLLLDCDLRRPSLH
G8AU96      RTMACMPRKRGTPPKVLLVTSSIPKEGKSVLAANLARSLAGL-GLNTLLIDADFRRPSIA
D0D9W0      -----------HGWKRVAITSPTKDCGKTFTAANLAISLSRHQNCRTLLLDCDLRRPSLH
Q0FMP0      -----------RGWTRVAITSPTKDCGKTFTAANLAISLSRQQNCRTMLIDCDLRRPSLH
A3W0H7      -----------NGWHRVAITSPSPDCGKSFVAANLAISLSRQSSVRTVLMDMDLRRPSLA
I1AYC5      -----------NGWRRVAITSPTKDCGKTFTAANLAISLSRHQNCRALLIDCDLRRPTLH
F0G6H5      ---------PDAPNRIVLISGPTTGVGKSYIASNLA-ALAAAASQRVLLIDADLRKGALH
Q74BQ8      ---------VGEFRNTIMITSTLGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTA
F0JCB8      ---------REGFQNTILVTSGTVGEGKSVTAVNLAISLAQEFDHTVLLVDADIRSPSCH
Q314L3      ---------RSGFQNMLMVTSALSREGKSLTSANLAISLAQEFDHTVLLIDADLRGPTCH
B5EA81      ---------GDVFRNCLMVTSSIPSEGKSLTALNLALSLAQELDHTVLLVDADLRRPSVH
C6DZX5      ---------GDVFRNCLMVTSSIPSEGKSLTALNLAISLAQELDHTVLLVDADLRRPSVH
A1ARV8      ---------VHPFKNVLMVTSAIPNEGKSLTSLNLAISLAQEYDHTVLLLDADLRRPSLH
I5B296      ---------KGTPPKTIMVTSASPHEGKSFVAANLAVSIAQSIDEYVLLMDCDLRSPTIH
H8YYB9      ----------ANAWNAVAITSPRPGCGKTLTSINLAISLAREVNQTVLLVDLDLRRPSVI
G7QCG1      ---------PDNFNNIILVTSAHHGEGKSLLVVNLAISLAQEFDHTVLVVDADLRAPTCH
I2Q341      ---------PDGFNNVILVTSAHHGEGKSLLVVNLAISLAQEFDHTVLVVDADLRAPTCH
C7LPS3      ---------RERFDNLIAVTSSTAGEGKSMTAVNLAASLAGEYDHTVLLVDADLRRPAVH
C0QCJ2      ---------TGIPPRTIMVTSTAPGEGKSFVASNIAISIAKSIDEHVLLIDCDLRLPSLH
Q39U17      ---------SGQFKNTIMVTSAVSGEGKTITSINLAVALAQEFDHTVLLVDADLRRPGTS
B9M2X6      ---------GDRFRNTLMVTSAFASEGKSITAINLAVSLAQEFDHTVLLVDADLRKPSIH
A5G424      ---------GEHFQNTLMVTSSVGSEGKSLTALNLAVSLAQEYDHTVLLVDADLRKPSIH
E8WSZ5      ---------GENFKNAVMVTSSVPNEGKSLTALNLAVSLAQGLDHTVLLIDADLRRPSLH
                            : ::.     **:    .:*  ::      .:.:* *:*     

E9TE88      ELLGTN-NVNGLSEILIGQGDITTAA------KPTSIAKFDLIPRGQVPPNPSELLMSER
E7T801      NLFTVSNEHG-LSEYLAGKDELNKVI------QHFGKGGFDVITRGQVPPNPSELLMRDR
F4SM97      KLFNKNNENG-LSDVLSGKIAFEKAI------KQIDTCGFDYISRGSVPPNPAELLMHRR
G5Q4J0      ELLGTNNVDG-LSDILAGKGEIASCA------KPTAIANFDLIPRGQVPPNPSELLMSER
G5LQM6      ELLGTNNVDG-LSDILAGKGEIASCA------KPTAIANFDLIPRGQVPPNPSELLMSER
G5SDT8      ELLGTNNVDG-LSDILAGKGEIASCA------KPTAIANFDLIPRGQVPPNPSELLMSER
F3CAY9      RLFGLQPKHG-LSDTLAARLRCTEVI------HQTRVRHLDFMSCGFAAPNPSELLMHDN
A3K8W7      RVLGVDSPGP-IGDVLRGKLAPEDHLIRLGENDFNAGHNIAFGLNTVTEAYASELLQDPR
G7EJX6      KRFDIPVFHPGLSNLIVGTEELTECV------HIDEQSGVAIMPSGQIPGNPLELLSNIR
S9QRP1      RVLGVEPPGA-MGDMLRGVVPPEQHMLRMGPNTIHAGHNIAFGFNTESEPYASELLQDPR
G8AU96      KLLGYQPHGS-VADLLDGRVGIDDLIHQETTNLGVLGNAVG-------TPDAHDRISSQA
D0D9W0      KIMGFRDPGF-MGDMLRGLLPPERHLVRMGENAIHAGHNIACGFNGAVEPYASELLQTPR
Q0FMP0      KVLGVKNPGS-MGDVLRGLVPPEDHLIRMGENEIHAGRNIAFGFNGTVEPYASELLQSPQ
A3W0H7      HTLGQPDPGR-MAGFLSGDLPLERFLACPEDNPLHIGQTLAMGLNDRAEPYAAEILHAPE
I1AYC5      KVMGADNPGS-MGDVLRGRLSAEEHFQRMGDNDIHAGPNVAFGFNGVVEPYASELLQSPE
F0G6H5      DHFRYS-RAPGLSDVVMGTHRLDEAL------KRDVRPGLDFLSMGSIVADPGEVLLQPA
Q74BQ8      QYLGIP-GERGLSEYLSVGAHLPELL------VRTGIGRLSILPAGKPAANPVELLSSQR
F0JCB8      ELLCME-NGYGLSDCLVDGSPIGKGL------VKTGIGKLSFLSAGSPVPNVGELLASKR
Q314L3      ELLGVA-RTPGLTDCLLDGTDVGEAL------VPTGLGRLSFLPAGRAVPNPGELFASTM
B5EA81      RYLNVE-QGVGLSELLTGEAQVGETI------IPTGIGKLSIIRAGRAIENPAELFTSQR
C6DZX5      RYLNVE-QGVGLSELLTGEAQVSETI------VPTGIGKLSIIRAGRAIENPAELFTSQR
A1ARV8      RYLNIE-RNVGLADCLTRGVDLGEAI------IPTGIGKLSVVTAGCAVSNPAELLSSAR
I5B296      TSFGYSGKEQGLSDYLAKNIPLSSVL------KKSSVNKLTILPAGQIPPNPSELLSSDQ
H8YYB9      RYFTDA-DLPGVSDYLLEQRELAEIL------VNPGIERLVLLPGHSSFTNSSEMLSTPR
G7QCG1      RYLEVA-PERGLSDCLLDGLDVGQAL------INTGIGKLVLLPAGKAVKNPMELLSSNS
I2Q341      RYLEVA-PERGLSDCLLEGLDVGPAL------INTGIGKLVLLPAGKAVKNPMELLSSNS
C7LPS3      KYLGLG-SCKGLSDCMREGLDVGELL------VKTGIGKLSVLPAGTPTPNPVELFSSDA
C0QCJ2      TRFGFS-DIPGLSEYLRAGKSLGSIL------RKTAIDKLSLLPAGKPPANPSELISSEQ
Q39U17      SYLGIR-AEVGLSDCLYGKVDVKDAL------VKTGIGKLVVLPAGSRVENPVELLSSGR
B9M2X6      KYFGFE-PKLGLTDCLTRGIDVGETL------IKTGIGKLSILPYGKKVENPGELFSSSK
A5G424      QYIGLD-PKVGLAECLLDGVDVGEAI------VNTGIGKLSVLLHGKTIRNPAELFSSLR
E8WSZ5      DYLEIE-PGAGLSDILKGEADIGETI------VQTGIGKLAVIRSGSQVENPVELFSSQK
              :        :   :                       .             : :    

E9TE88      FAELVNWASKNY--DLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSR
E7T801      MRQLLEWANDHY--DLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQR
F4SM97      LNELLIWANSQY--DIVILDTPPILAVTDAAIIGQYVGTTLLVVRFEQNTVKEIEVSFKR
G5Q4J0      FGELIAWASSRY--DLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSR
G5LQM6      FGELIAWASSRY--DLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSR
G5SDT8      FGELIAWASSRY--DLVLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSR
F3CAY9      FNKMLAELSPLY--DLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRR
A3K8W7      TRVTLDRIEEELRPDVVLFDLPPALSYDDVIAFQPLFDGVLLVVGGGLTTEREVKE-VER
G7EJX6      FSELLELLKAKY--DHIIIDTPPTQAVSDALVIAQSADSVIYVVKSDVTRIKPIKAGIER
S9QRP1      TAATLDDLQTRFAPDVMLFDLPPALFYDDVIAFRPLFDGVLMVVGGGITT-EREVREVER
G8AU96      MSDLIQWARHNY--DVVVIDSAPVMLFSDALALSFLADSVIYVVRWQHTPLDTVTAGFNK
D0D9W0      TAETLRQVETMLQPDVVLFDLPPALYFDDVMAFRPLFDGVLLVIGGGLTT-DKEVREVER
Q0FMP0      SRTALRHIEDEFAPDVMLFDLPPALYYDDVMAFRGQFDGVILVIGGGITT-EKEIRETQR
A3W0H7      TGEVLQDMYRRLAPDVVIFDMPPALYYDDVLGFRPQFDGVLIVVGGGRTT-ARHLRDLKA
I1AYC5      TAQTLETIERRLAPDVILFDLPPALFSDDVIAFRPLFDGVLLVVGGGLTT-DKEIREVER
F0G6H5      LAELIERLSSQY--RMIVIDGSPLLPVTDGLALGRLAGIVFLVARSGVTTLTEIDESVRR
Q74BQ8      MKDLLDEIRHRYPDRYVIIDAPPALPFAEVRSLSNLVDSIVFVVREGQSSLANIDEAISA
F0JCB8      MAESLAEMKNRYADRYIIIDSPPVLPFAESRNLSRLADGVVLVIKEGQASQADLRDTIEA
Q314L3      MQDLLLQMKHRYTDRYLIIDTPPVLPFSETRSLSRVVDGVVMVVRENVATMEDLRESLEA
B5EA81      GKALLTELKLRYPDRYIILDTPPVLPFAEARSLAHLVDGVLFVVMERLVSQANLKDALES
C6DZX5      GKALLTELKLRYPDRYIILDTPPVLPFAEARSLAHLVDGVLFVVMERLVSQANLKDALES
A1ARV8      MKTFVEEIKHRYTDRYIIFDTPPLLPFAETRSLAHLVDGVVFVVKEQTATKDNVSDAIEA
I5B296      MRRLLHEVKLRYNDRYIIIDTSPPYITSETNAIARFVDGIILVIRHGKTRIKEVLDILDI
H8YYB9      MVRLVTELKTRYPDRIVLFDMPPLLAGDDVLAFSPYIDAIMLVVEAGGTTRDDLRRAWNL
G7QCG1      MRRLMTEIKQRYRDRIILVDTPPVLLFAETRSLADVADGAVLVVREGKTSLEDVQESLTL
I2Q341      MRRLMTEIKQRYRDRIILVDTPPVLLFAETRSLADVADGAVLVVREGKTSLEDVQESLTL
C7LPS3      MRSLFREMKIRYGDRYIIVDTPPVLPFAETRSIASIVDGVILVVKEGMPSLEQIEEAIDA
C0QCJ2      MRRLLQEVKGRYEDRYIIIDSPPPYLTAEANALARQVDGIIIVVKAGKTKRSDVQDLIDT
Q39U17      MQSFIAEIKNRYPDRYIIIDTPPLLSFAETYSLANMVDGVVFVVKEGGATMSNVKDALGH
B9M2X6      MKSLIAEIKSRYPDRYIIIDTPPVLLFAETRTISTIVDGIVFVVKEGAASVKEVNDALTA
A5G424      MKELVKELKHRYPDRYIIIDTPPVLPFAETRSISTLIDGIVFVVKEGAASLNDVSDAIAA
E8WSZ5      MRALVDELKRRYPDRYLIFDTPPVLPFAESRALANIVDGTIFVVRERLATQAEIKEAYDH
                .           ::.* .*     :   .    .  . *                 

E9TE88      FEQNGIPVKGVILNSI--FRRASAYQDYGYYEYEYKSDAK--------------------
E7T801      LEQAGVNIKGAILNGV-IKR-ASTAYSYGYNYYGYSYSEKE-------------------
F4SM97      FEQSGVTVKGCILNGV-IKK-ASSYYGYGYNHYGYNYGEDK-------------------
G5Q4J0      FDQNGIQVKGVILNSI-FRR-ATGYQDYGYYEYEYQSDSK--------------------
G5LQM6      FDQNGIQVKGVILNSI-FRR-ATGYQDYGYYEYEYQSDSK--------------------
G5SDT8      FDQNGIQVKGVILNSI-FRR-ATGYQDYGYYEYEYQSDSK--------------------
F3CAY9      LGQNGILIKGAIFNAV-VRKATTSDYDYAAYGYNYHPAPR--------------------
A3K8W7      RLGTETPLLGMILNKA-E---GVDVERYAY------------------------------
G7EJX6      LFESKAHVAGIVLNQV-DMSKSNDEHSYGYYDYHDYSQKPEQPTA---------------
S9QRP1      RLGDSTPLLGTVLNRA-E---DTQIRKYSY------------------------------
G8AU96      LKSVDSAVGGVVLSRV-V---ASKHVKYGHKDDAYYYALHAPARH---------------
D0D9W0      LLGKNTPLLGMVLNKA-E---GTSLDKYTY------------------------------
Q0FMP0      RLGDDVPLLGTVLNKA-E---GSKIRQYTY------------------------------
A3W0H7      RFGTDTPLLGVVMNRA-E---GESIAKYGY------------------------------
I1AYC5      RLGENTPLLGTVLNRA-E---GTQLSKYSY------------------------------
F0G6H5      LQDVQVDVRGVILNDF---------ARGPGHGYGYGNAETHQAASGYAGMMAHRPAGAGG
Q74BQ8      LNRKK--ILGIVFNEASAVGISS--------KYGYGYGYGGYGPSAEPAEARSTAEKTGK
F0JCB8      LQGSN--ILGAVYTQASRMHRSLNADAYMKYKYYHYAS----------------------
Q314L3      LEGAT--MLGVVYNNARSGGGRRG-------RYGYGYGYGGY--GSGA------------
B5EA81      LKACP--ILGMVYNAA-AVDDKDG-------RYSYYRS------ADNA------------
C6DZX5      LKACP--ILGMVYNAA-TVDHNDG-------RYSYYRS------ADNA------------
A1ARV8      LKGAD--LLGIVYNDT-TITQNVE-------RYYSYRSYAAVSPGESA------------
I5B296      YGREK--VLGVVTNFS-KKTI--------GYGYGYHKSGYGYGYHQQR------------
H8YYB9      LGGKR--ILGVVLNKA-DGDSSGD-----GYY----------------------------
G7QCG1      L-NNK--VLGLVYNAT-DYVKPCS-----SYYSSYYAACND-------------------
I2Q341      L-NNK--VLGLVYNAT-DYVKPCS-----SYYSSYYAACND-------------------
C7LPS3      LD-QK--VLGIVYNGA-HLQS--------RSSYYYAE-----------------------
C0QCJ2      YGKEK--ILGVVKNFA-------------DARHGFKKYEYK-------------------
Q39U17      LKKEK--VYGVVYNNV-GINRFDENYRYRNYYAYYKDNGAQ-------------------
B9M2X6      LDKSN--LLGIVYNET-VNENLNGHY---HDYYQHKQYAW--------------------
A5G424      LKGTN--LLGIVYNEA-SIDGFNDRY---NYYYRYDAEKW--------------------
E8WSZ5      LKGSG--VLGVVYNAA-DAAAGDESL---SYYKHYQKTPAA-------------------
                   : * : .                                              

E9TE88      -----------
E7T801      -----------
F4SM97      -----------
G5Q4J0      -----------
G5LQM6      -----------
G5SDT8      -----------
F3CAY9      -----------
A3K8W7      -----------
G7EJX6      -----------
S9QRP1      -----------
G8AU96      -----------
D0D9W0      -----------
Q0FMP0      -----------
A3W0H7      -----------
I1AYC5      -----------
F0G6H5      KGDR-------
Q74BQ8      LSRILGKRGSK
F0JCB8      -----------
Q314L3      -----------
B5EA81      -----------
C6DZX5      -----------
A1ARV8      -----------
I5B296      -----------
H8YYB9      -----------
G7QCG1      -----------
I2Q341      -----------
C7LPS3      -----------
C0QCJ2      -----------
Q39U17      -----------
B9M2X6      -----------
A5G424      -----------
E8WSZ5      -----------
                       

© 1998-2019