BYKdb

Dataset for cluster orphancd of phylum proteobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

717 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A0K9JYB4      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A2D9ABL7      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A062ME93      ------------------------------------------------------------
A0A3A3BFE8      ------------------------------------------------------------
A0A0L0M4Q4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A376QQZ0      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A436B5W5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A3S2FP30      ------------------------------------------------------------
A0A436NMQ4      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ---------------------------------------------------MADQQHSHS
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------------------------------------
A0A2N2INV3      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A2G2GD62      MDSNITKNMEADEESFDIQQALYIIKKYNKSIAFIVVVFIIISGIMAYFKPSMYFSTAVV
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A328C2K5      ------------------------------------------------------------
A0A3D8MRR7      ------------------------------------------------------------
A0A437R5U4      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A2E2T3V8      ------------------------------------------------------------
A0A367UAB4      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ------------------------------------------------------------
A0A154VE85      -------------------------------------------------------MSALA
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A168QTU8      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2T1MXF1      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A435LQD4      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A2W6S588      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          ------------------------------------------------------------
A0A1H7KZF8      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A3D3VHV9      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A447B6K7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
W7Q5J0          -----------------------------------------------------------N
A0A087LTV7      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A2E1D962      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
Z2EKW7          ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A3S1IBR2      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A3S3EAI9      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A3S1P7J5      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A350DWX8      ------------------------------------------------------------
V4J283          ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A166Y9U5      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A0H6V1F7      ------------------------------------------------------------
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A383M853      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A447YBN8      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A3S2K5U0      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A354VPS3      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1E3DAN4      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
E8RBB2          ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A435ZMC2      ------------------------------------------------------------
A0A3S1X1N3      ------------------------------------------------------------
A0A434B8G6      ------------------------------------------------------------
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A1E2ZGQ8      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
A0A2R7TMW6      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1B9Z0F1      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
A0A1E2UHX3      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M5YLE8      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M3RP89      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0P9QIY7      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0P9VVH7      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0Q0FJK6      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0Q0G2J0      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M3LF66      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0P9WIR8      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0P9R9W0      ------------------------------------------------------------
A0A0Q0B9T0      ------------------------------------------------------------
A0A3M6CFI7      ------------------------------------------------------------
A0A0P9JXN0      ------------------------------------------------------------
A0A3M6FIV7      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A3M5DM48      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A0P9NNS0      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A3M4WA51      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4GLF4      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0Q0B3J8      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A0P9PWZ3      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9PS59      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9MPC7      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3CJL0      ----------------------------------------------------MAGPARHH
A0A3M3F6F5      ----------------------------------------------------MAGPARHH
A0A3M3P9B7      ----------------------------------------------------MAGPARHH
A0A0N8QB74      ----------------------------------------------------MAGPARHH
A0A0Q0AUD0      ----------------------------------------------------MAGPARHH
A0A3M5VR55      ----------------------------------------------------MAGPARHH
A0A0Q0FK97      ----------------------------------------------------MAGPARHN
A0A3M3UCT3      ----------------------------------------------------MAGPARHH
A0A3M5XGQ7      ----------------------------------------------------MAGPARHH
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
K0XBA5          ------------------------------------------------------------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2A5PQG0      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A0T9WT26      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A0K9JYB4      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A2D9ABL7      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A062ME93      ------------------------------------------------------------
A0A3A3BFE8      ------------------------------------------------------------
A0A0L0M4Q4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A376QQZ0      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A436B5W5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A3S2FP30      ------------------------------------------------------------
A0A436NMQ4      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      SNPGPVFLPGEASGTGNFVPSLGGSLLTDPVRLFMTAVSYSWLIIACAISGLVMGSVYAS
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------MAEPLGPFDAAPANNNAPAQTQVDWKRIFHIVRNYFWIVLLT
A0A2N2INV3      ------------------MAEPLGPFDAAPASNNAPAQTQVDWKRIFHIVRNYFWIVLLT
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A2G2GD62      QISEKGRSGWNDPVLTALGLGDSQGQNIDSIMSSGYLISKMLENLELGTRYYKEKNYRLV
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A328C2K5      ------------------MSDQYGFQEPRSQSAPEERGESLGALIGRYWVLFRRFYWVLI
A0A3D8MRR7      ------------------MSDQYGFQEPRQSSAPEERGESLGALIGRYWALFRRFYWVLI
A0A437R5U4      ------------------MSDQYGFQEPRQSSAPEERGESLGALIGRYWALFRRFYWVLI
A0A1H7YHK3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A2E2T3V8      -------------------------------MTISDLVGILYRRRGVFAVSFVALLMMAS
A0A367UAB4      -------------------------------MTISDLVGILYRRRGVFAVSFVALLMMAS
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A0J7XGZ1      ---------------------------------------------------------MLP
I4CBA7          ----------------------------------------------MSTYSPHDSEAFEF
A3VE95          ------------------------MTTFDMQAVRSGRSSERSEDIDRVDVRGLLRAIFSR
A0A154VE85      PLQPNPAARAGMAPSPADAPMPLRRGLSRNKPLFAISFLALAGLGLAIVAGLPERYRATA
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A168QTU8      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2T1MXF1      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A435LQD4      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A2W6S588      -----------------------------------MNQEQDGSATQDLAGIVSRFRRHLP
A0A444I5K6      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ----------------------------------MMARKFERSQAGVAEPLLGFDAYAWG
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          --------------------------------MTADFAEKNATGPLLDFGKLTVIARRRI
A0A1H7KZF8      -----------------------MNAPFGRIEAAVAPPPAPLFALDFDRLWVPVRRSLVP
A0A0J5Q9T7      ------------------------------------------------------------
A0A3D3VHV9      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------MGSWAA
A0A3M1D4H3      ------------------------------------------------------------
A0A447B6K7      ----------------------------------------------------------MD
A0A1J5ICP0      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A379B9V4      ----------------------------------------------------MRLKKLDL
A0A1A7QJ97      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
W7Q5J0          TSAEIQILQSRMVLGHAVDRLGQENIIRPVTMPIIGDYVVRQGIQRPDFPIMLPYISDYV
A0A087LTV7      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A351CXR4      --------------------------------------------MLGYNSSLNNTPMYQS
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A2E1D962      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
Z2EKW7          ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A3S1IBR2      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A3S3EAI9      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A3S1P7J5      ------------------------------------------------------------
W7Q8F9          -----------------------------------------------------MVVERDS
A0A3M2BE89      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A350DWX8      ------------------------------------------------------------
V4J283          ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A166Y9U5      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A0H6V1F7      ------------------------------------------------------------
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A383M853      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A447YBN8      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A3S2K5U0      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A354VPS3      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1E3DAN4      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
E8RBB2          ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A435ZMC2      ------------------------------------------------------------
A0A3S1X1N3      ------------------------------------------------------------
A0A434B8G6      ------------------------------------------------------------
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A1E2ZGQ8      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
A0A2R7TMW6      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1B9Z0F1      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
A0A1E2UHX3      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M5YLE8      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M3RP89      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0P9QIY7      RPLSAPPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0P9VVH7      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0Q0FJK6      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0Q0G2J0      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M3LF66      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0P9WIR8      RPLSAPPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0P9R9W0      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSAD
A0A0Q0B9T0      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNSSAD
A0A3M6CFI7      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNSSAD
A0A0P9JXN0      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSAD
A0A3M6FIV7      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSAD
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A3M5DM48      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A0P9NNS0      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A3M4WA51      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4GLF4      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0Q0B3J8      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A0P9PWZ3      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9PS59      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9MPC7      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3CJL0      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M3F6F5      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M3P9B7      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A0N8QB74      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A0Q0AUD0      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M5VR55      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A0Q0FK97      RPLPAARVSLRADLRAALALHRRLASPFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M3UCT3      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M5XGQ7      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
K0XBA5          ------------------------------------------------------------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2A5PQG0      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A0T9WT26      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A0K9JYB4      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A2D9ABL7      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A062ME93      ------------------------------------------------------------
A0A3A3BFE8      ------------------------------------------------------------
A0A0L0M4Q4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A376QQZ0      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A436B5W5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A3S2FP30      ------------------------------------------------------------
A0A436NMQ4      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      LQTKQYRASLQINIDVGRASALREFEVVGESRSFFVTAESTIAASIRTRRLARRVVYELN
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      CGVGVSLAFFVTKKQTPLYRTSCSVVISSQLPSYLGSTVKSNLAETSEDFWYEQRYLATQ
A0A2N2INV3      CGVGVSLAFFVTKKQTPLYRTSCSVVISSQLPSYLGSTVKSNLAETSEDFWYEQRYLATQ
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A2G2GD62      ELYKKSPLVVNVTFMEYNLLEKKLKIRAIDGETYELSYKTKIKINIDYFTRLLFGKQKVY
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A328C2K5      LTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A3D8MRR7      LTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A437R5U4      LTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A1H7YHK3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A2E2T3V8      VAISFFSPVYKSFASVGFVREEPATTQTDFPKAVWPNAAEFVETRMEMIIGNETLSTVMS
A0A367UAB4      VAISFFSPVYKSFASVGFVREEPATTQTDFPKAVWPNAAEFVETRMEMIVGNETLSTVMS
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      -----------------------------------------------------------V
A0A0J7XGZ1      RTYTATSALLLEPREAQPVKVNDRGFVAPADDNLIDTAVQIIRSPTLTLDVVRSLRLDRV
I4CBA7          SSPRHSLTGHVRTIFRKKWLFLGIVALALAGGVVVGLVRSPVYKSSAILRVELGGPSQRG
A3VE95          GPLIGGLAVGCALLLFVVTQFIPSTYTAYSKVMLDAREVRIMSSDEVVSNLSLSDPVIQS
A0A154VE85      QLVFQDRSSGFGGSALLLDRGAIETEAAIVASRDLALRAVESLRLIDDPAFNPALQPSAS
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      -------------------------MALAVAAGLALASAALLVMPVSYSATALLYFDPSP
A0A168QTU8      ------------------------------------------------------------
A0A0L1KFN4      -----MTPQYTAVSTIEISREADQVTNIEGVERETSVADQEFYQTQYGLLRARSLAERVA
A0A3T9EHW9      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2T1MXF1      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A3A0FZC0      -------------------------------------------------------MLEQP
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A435LQD4      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A2W6S588      IGFAIIVLMMVLAYGATKMMTPKYSASAQLSYSPQQALSRDGQPAPPTQTTDAARDAAIE
A0A444I5K6      ------------------------------------------------HELRIVDEFQLV
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A3C1S9Y1      ---------------------------------------------------MPGTEDNMF
A0A353EH49      GEILEVAKLEVPDFLKGNALRLVVEHDSEYTLYDGDEYLLKGRVGQDAVISLKDVKKYNR
A0A1Y1Q9C1      ---------------EGMQVVNFGTVSSASPDMGEQDPFFRTQYEQLKSRKLAAQVIDGL
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          VPMAVAAALCALAVAALYFTSEPTYSASGQIGFERGADELLPGLSERRAEITDAASVETA
A0A1H7KZF8      MAAIVFASLAAALLAFVLIRPSFRADATLRIDAAAQRIVGTEDVAGPVQVADIDRQMETT
A0A0J5Q9T7      ------------------------------------------------------------
A0A3D3VHV9      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      --------------------MHLILIKKYYQTQFEILRSSHIAESVIDELGLANLPEFNS
A0A1Q3MB35      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ----------------GLARLFNKTKNTIQVHKLFISPNMYDDNFITLTVKNDHQYSISG
A0A2G2CXY6      RRYDPYEAGEVAEPWLGLDSFAWGGEELAIFQLEVPPGYLGKTLILTAQDAGTFTLHDQD
A0A3M1D4H3      ------------------------------------------------------------
A0A447B6K7      LQYSVKPKSIPFIGEGIDRIWGEGKGEIHIKHLYIPMRNGENVASFVLTVKNKSTYEIKK
A0A1J5ICP0      ------------------------------------------SYVLKFDGPDSYKIIEDK
A0A0M3GBT1      --------------------------MEDKSSSSDLLDAKSETERLLSRSIAERVVRELQ
B3Q577          --------------------------MEDKSSSSDLLDAKSETERLLSRSIAERVVRELQ
A0A379B9V4      TTQVEPIYPVPILGKLFASATGYSPQITISHFTPLNEAANTLILEIGEQRDSYTLFLEKT
A0A1A7QJ97      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
W7Q5J0          LSSGIPQPSFMQRQPYVWGGENLEVARFVLAEHRRSHVVVVERDSEERYRVMLNEQHIGD
A0A087LTV7      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ----------------------MIGSKKDVWIRSDLTIENLLVDDAAVETEIETTVSEKV
A0A351CXR4      SLTLMVTENMPNMAMVGQGYVDPMSMLSLWSGGTLDTRIIQSRAITTKAAQALNLTEKEF
A0A2N6GLF5      ------------------------------------------------MAEDVIAKLELT
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ----MTPQYTATSRIEIAREQANVTNVEGLKRDSNAPDQEFYLTQYSLLNARSLAERVER
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------MSELDLAADPEF
A0A2M7JRZ7      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A2E1D962      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
Z2EKW7          ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A142W0R3      ------------------------------METDVEGAREKTISNEIAFFNTQYSLLESR
A0A0S4XR18      ------------------MAQNSTKPWEIDGEYKFGQAIKTPYFTFVIKATKDFGLNDTS
A0A2E0GW64      ------------------------------------------------------------
A0A3S1IBR2      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A3S3EAI9      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A3S1P7J5      ------------------------------------------------------------
W7Q8F9          EERYRVMLNEQHIGDGHIGQLHTFLDGEMELLIDEFNAAPGAQFR---------------
A0A3M2BE89      ---------------------------------------LGQPLTLVAQASNHYRLLDEE
A0A257G674      --------------------DILKSRTLLERVAQKLRLIGNPRFY---------------
A0A1I1UM01      -------------------------------------MTNRPKFR---------------
Q44573          ---------------------------------MIHSRDVAAAVMAQLPPPAAPPHVGLR
A0A167IR75      --------------------------------------MTNERYS---------------
A2W025          -----------------------------------MPALEGKKLTLTAGPNGTYSLVDEN
A0A350DWX8      ---------------------------------ATQQAARRRKMI---------------
V4J283          ---------------------------------KISLVAAAGALS---------------
A0A0Q4UFQ5      -------------------------------------MFESGRPI---------------
A0A432EMV7      -----------------------------------KSLIAYLSYV---------------
A0A166Y9U5      ---------------------------------MFDSDEDGPAFQ---------------
A0A318KWA2      ------------------------------------------------------------
A0A1H3KC95      -------------------------------------MNAGPRFR---------------
A0A0B3RZC9      -----------------------------------MNMMDSPKFR---------------
A0A2E9HXF7      --------------------------------------MDSPKFR---------------
A0A2K8U7M6      -----------------------------------MTPLGNSRLV---------------
A0A238KJM1      -------------------------------------MMDDRKFR---------------
A0A3A0FJZ4      -----------------------------------MSDAPAPGFD---------------
W4HJV8          -----------------------------------MNMANRPKFR---------------
A0A0P1GDI0      -------------------------------------MTERRKFR---------------
A0A2R8ATV5      -------------------------------------MSERRKFT---------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      -------------------------------------MVERRKFQ---------------
A0A0W7WHP4      -------------------------------------MTDQRKFR---------------
A0A238J8F6      -----------------------------------MNEMDNRKFR---------------
A0A238JQI6      -----------------------------------MNMMDGPKFR---------------
A0A222E077      -----------------------------------MNMMDSPKFR---------------
A0A239E3Y2      -----------------------------------MNMMDSPKFK---------------
A0A0H6V1F7      ------------------------------------------------------------
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A383M853      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A447YBN8      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A3S2K5U0      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A354VPS3      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1E3DAN4      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
E8RBB2          ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A435ZMC2      ------------------------------------------------------------
A0A3S1X1N3      ------------------------------------------------------------
A0A434B8G6      ------------------------------------------------------------
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A1E2ZGQ8      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
A0A2R7TMW6      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1B9Z0F1      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
A0A1E2UHX3      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      -----------------------------------MNDRGRTSRALAHSGFDNGDYIFIN
A0A2D5LFD8      ----MAAPIKLLVELLEKNMAPSKSPLDIEKKRDHATDQSSGNEGESLEGGASYSEFRQI
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG---------
A0A3M5YLE8      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG---------
A0A3M3RP89      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG---------
A0A0P9QIY7      VVRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARG---------
A0A0P9VVH7      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG---------
A0A0Q0FJK6      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARG---------
A0A0Q0G2J0      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG---------
A0A3M3LF66      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG---------
A0A0P9WIR8      VVRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARG---------
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0Q0D3D2      ---------FQR------------------------------------------------
A0A0P9R9W0      AVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGG---------
A0A0Q0B9T0      AVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGG---------
A0A3M6CFI7      AVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGG---------
A0A0P9JXN0      AVRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDRAQKNRHRRHSGG---------
A0A3M6FIV7      AVRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDRAQKNRHRRHSGG---------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A3M5DM48      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A0P9NNS0      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M6AI26      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M4WA51      ---------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGG---------
A0A3M4A0E8      ---------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGG---------
A0A3M4GLF4      ---------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGG---------
A0A3M4PBZ2      ---------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGG---------
A0A0P9IWP8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0Q0B3J8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M5M873      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRG---------
A0A0P9VHH8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9YV98      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M3G2W8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M6C224      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9PWZ3      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M5K254      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9KZ49      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9PS59      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9V840      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0Q0AIE5      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M2ZQH6      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0N8SQG2      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0W8HFU1      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M5JFB0      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M3TQV3      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M3EF92      ---------MDRQPVFSDRSGLCHSGHAGVSDHRHDSDRAPKNRHRGHPGG---------
A0A3M5J1E2      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDSDRAPKNRHRGHPGG---------
A0A3M5G7H9      ---------MDRQPVFSDLSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M4A376      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0Q0A5T8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9SCD7      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9T4G3      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9VKB0      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0Q0BM35      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M3TPR7      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M3U4Q3      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9UCX7      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9S1F1      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRG---------
A0A0P9QCJ2      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9Q329      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M5GJ64      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A0P9MPC7      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M2XYQ3      ---------MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGS---------
A0A0P9XCE1      ---------MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYTGS---------
A0A3M3EFX7      ---------MDRRPVFSARHGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGS---------
A0A3M5B9D9      ---------MDCRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGS---------
A0A0P9RRZ3      ---------MDSQPVFSDRPGLCHSGHAGLSGHRHDSDRAEKNRHRGYPRG---------
A0A3M2VEK7      ---------MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHARS---------
A0A0N8R9B3      ---------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASENRHRGHAGS---------
A0A0P9VA27      ---------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASKNRHRGHAGS---------
A0A3M4YBJ4      ---------MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS---------
A0A0P9J470      ---------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRAPENRHRGHAGG---------
A0A0Q0EVJ8      ---------MDRRRVFSDRPGLCHSGHAGVSGHRHDSDRAPENRHRGHAGG---------
A0A3M5UI30      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M5YQT8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG---------
A0A3M5F5X1      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRG---------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3CJL0      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASKNRHRGHTGS---------
A0A3M3F6F5      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS---------
A0A3M3P9B7      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS---------
A0A0N8QB74      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS---------
A0A0Q0AUD0      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS---------
A0A3M5VR55      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHARS---------
A0A0Q0FK97      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS---------
A0A3M3UCT3      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVPGYRHDSDRASENRHRGHAGS---------
A0A3M5XGQ7      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVPGYRHDSDRASENRHRGHAGS---------
A0A3M5KZ75      ------------------------------------------MPSHSRCRR---------
A0A3M5L3G5      ------------------------------------------------------------
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
K0XBA5          ------------------------------------------------------------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2A5PQG0      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A0T9WT26      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A0K9JYB4      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A2D9ABL7      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A062ME93      ------------------------------------------------------------
A0A3A3BFE8      ------------------------------------------------------------
A0A0L0M4Q4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A376QQZ0      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A436B5W5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A3S2FP30      ------------------------------------------------------------
A0A436NMQ4      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      LTEKPNFYIQPVRFSLVGILKRAITGRAEQPFIPRTYDERERAAINRVLAGMQITTLRRS
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      IEVIKSRNIALLAARRLENVDLHQLLGQPQFAHREPTEEELQRAAGVMRGMIQVIPVPES
A0A2N2INV3      IEVIKSRNIALLAARRLENAELHQLLGQPQFAHREPTEEELQRAAGVMRGMIQVIPVPDS
A0A1Y5DXG5      ------GKVGEEVTNGTFTLTIKELVARAGTEFFVTRKDRLNTILDLQSSIGASEKGKDS
A0A0B8P2H5      ---------MARSENGEFLLFVSQLVGKQGQEYGLGKRSKLDAIQWLNGSLSVSERGKQS
A0A2G2GD62      IEYKGIHKFGEDVISKYFQLKVIKVRELNSLEYFFSYIDNRNMVGYIQNNLSTEQDAKYS
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A328C2K5      TQKEVLGSKWFARRVVEREGLLDAPGFLPASAQQLDEDERMKRAVNTLQSVAVYSLQRDS
A0A3D8MRR7      TQKEVLGSKWFAQRVIEREGLLDAPGFLSPSVQQLDEDERMKRAVNTLQRVAVYSLQRDS
A0A437R5U4      TQKEVLGSKWFAQRVIEREGLLDAPGFLSPSVQQLDEDERMKRAVNTLQRVAVYSLQRDS
A0A1H7YHK3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A2E2T3V8      VLRGQGVSFSQEANVQGNFLRRIFGNDQGFIASDAKVSDEIDKDVEALRRRIDVERIGNS
A0A367UAB4      ILRGQGIIFSQEANARGNFLRRIFGNDQGFIASDAKVSDEIDKDVEALRRRIDVERIGNS
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ILTGKTNQANTLRTADGLWNISIYTQDQLNDVYLIQKQSLPSAVNNILANYSVAEKGKLT
A0A0J7XGZ1      PEFGGDSKSPSAKLTPPLATGTDGHGSTGDREQIATINPAERQAAGRLLTHSYVRRVGVT
I4CBA7          LQGALEFFAEFSIFYETQVQSLKEMAQSGSLSTPDRRGLEDAAKALPRWSDIRITENRGS
A3VE95          EVSVMTSNILIERLILEVGIERLETLYWGEVRGDRDEASRLADLTWAIRQDLNVSRESES
A0A154VE85      FAFGAWLRDHVLAPLGVAPSSGSGRASQGSAVIAPPPAVLAERAVDAYLDRLSVSPADNA
A0A1G0NL95      -------------------------------------------------MTTVREQGKQS
A0A024KA69      RGVLEDGRPGAGDGARVDSAVDLIASEPVLASAARALGLAGERAPDWLGSRVKVQRDGPT
A0A168QTU8      ------------------------------------------------------------
A0A0L1KFN4      AELGLVDRPEFFEMFRFDGADDPAFEIVNGRYPAEGRAQRQREAAKILLDQVSIEPTRLS
A0A3T9EHW9      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2T1MXF1      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      -------------------------------------------------------RGKQS
A0A3C0PZN1      ------------------------------------------------------------
A0A3S1NQ09      ----------YVRPSSSMPGGADFSKLDPAARDALIATSRRDYAILKLQNEIRAERVGRS
A0A443GJ52      -------VIRYFRPNPAV-GTTDVAQLDPATRDAMIASSRRDYAILKLQNEVQAERIGRS
A0A3A0FZC0      EIKSALFDTANQGFFGQLFGGDSESKQESDKLDQLAGYKSTVRQIKVYLSTIEIKPVRRT
A0A1N7JVZ7      -------------------------------MTAERVFRRKNRPHARSEPEAQAQPAASR
A0A091C4A8      ------MTAPAPWKLLLGLAGETDDEELDAAHLAATESVRQTLRINSFLASLSIEPVRNS
A0A435LQD4      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A2W6S588      SQLQIATSLPVAIRALQDPEVAKNPTILARAKAFDPSGKSSDAMAAALLSGVSAARVGTT
A0A444I5K6      DNPFMGPKSSLFSVSTLKSFMNFRSWFADDAAVAPDPEMRRRGAAETVAGNIDVERVGRS
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A3C1S9Y1      SNLREWFKEKRQSWKDQMDSLLSSDKNKGNTVPKSDDPSQDSPLVSAFITRIKVSPIRNS
A0A353EH49      YYDQQYVLAREQEFSPYLKINIEYLKARVGTEFTLEKQHVYKSAEVLNGKLQVSESGKQS
A0A1Y1Q9C1      DLKTRLFERPAPFSVLSSFKVIIKGLIAPLLPAKIETVTEAADYTDLFSQHLYVEPIEKT
A0A3M7LJH0      -----------------------------------------------------------T
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      -----------------------------MRNTPAGREKRSREAARILLENIDIVPDRLS
M2U8P2          VQALRAPEIATAVARTVGPERILRAYMDPDQPIPTERQAATRRAAAFIRGGLSARREGTS
A0A1H7KZF8      LLMARSVPVAEAVMRALKLSADDTFLRQMHADPAPTPGERRQAVLDLLDRKRSAAIIPNS
A0A0J5Q9T7      ------------------------------------------------------------
A0A3D3VHV9      ------------------------------------------------------------
A0A257NG76      --------------------------------------------------------GKKT
A0A1T4TW59      LVGKPSARDQLLTLLRQIDGLDGFLPKPIAPSTDPNSEVAKRAVLKKFKSHFAIEPIRYT
A0A1Q3MB35      --------------------------------MASAAQQRLELATDILLDNVSINPVRGS
A0A1I5YYQ0      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ENIDFDGEIGRLIDKNGIRIQVDSINAEPGTRFLLTYTSRINAINYLRDSLLIADQGKDT
A0A2G2CXY6      GMLLIEGNTLEQIDRDGFKIQVQALVARPGTEFLVTKHRMLNSILAYQEELGASEKGKDS
A0A3M1D4H3      ------------------------------------------------------------
A0A447B6K7      DDVEAEGNVGTTLEVGGISLLVDAITAREGSQFVVNYKTRLKAISDLQDALSISEQGKDT
A0A1J5ICP0      SGALAGKGELNKPFLGPNFSILVEGDHARKGRKMKFSVLTPASAVEGLQGSLAVSPIKNT
A0A0M3GBT1      LNLRPEFNPALREVTFFESIRTNLRGLFDPRKPAEPVRDGIDAVIPEFYRALGVWHEDKS
B3Q577          LNLRPEFNPALREVTFFESIRTNLRGLFDPRKPAEPVRDGIDAVIPEFYRALGVWHEDKS
A0A379B9V4      TEPLLTGKVGEKYDTDLIQFSLSQINAKPKQRFLINKLPELTVISALQEQLSVHEIGKQT
A0A1A7QJ97      --------------------------MNNGRFPAQGRAQRQRVAGEVLLDHVSIEPTRLS
A0A0Q6TS97      ------------------------------------------MAGKILLQHVGVAPVRGS
A0A0Q6UYB4      ------------------------------------------MAGKILLQHVGVAPVRGS
W7Q5J0          GHIGQLHTFLDGEMELLIDEFNAAPGAQFRLAKRNRNGDIRSLGGRLQIAEVGGGRGSST
A0A087LTV7      --------------------------------------------------------MHED
A0A0G9MZA5      ---------------------------------MPENADIEPALAGTLLNNVSITPIINS
H0T8B0          IATVVSRLRLDQNPEFECPDRGLFAIFSPSKTSLPPSEARIRCAVSTVASNLSIVRVGRS
A0A351CXR4      NLPAPATPFADLTNDISQMLLGRKLIDTPQNEQPKLAFANTRQASAFIQAALTVEVESHD
A0A2N6GLF5      KHPEFQPEENKLISFDWKTWLKSYLPQQSGGAELDEAETFYDSVVEYYFERLKVTPVKNS
A0A1W9LJP0      ----MSKNWFAEPLRFWKEKLLSLRNTGKPEDKDKKDEDADAWLVNALIGRIKAEPVRNS
A0A0W1ICB0      RLRLARNPEFFAAHGETPEGEGLLSGLRSGPVSAADLRQRERQAVELLLDNVGISPLRGS
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------MDDSSAASSSEDRAGREKLAVDLLLSHVTISPITRS
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ----------------------------------------------MQETFTVSERSKES
A0A376RML0      ----------------------------------------------MQETFTVSERSKES
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      NSRLREPSGLGAVAGAVAGFLSALLPSQVADSQSGEAEQELEAVTSAVLDRLSARRSGMT
A0A2M7JRZ7      -----------------MTGLFTSSKKNAPSEKEISENKKDTALIDQFLSKLKVEPIRNS
X7F6S5          ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A2E1D962      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A3B8T2U6      ------------KKLVKTAIPLFPDPQEVVLTDTEKQQNRLDFAIAKLQANIDIKPVFHT
Z2EKW7          ------------------------------------------------------------
A0A365PWR2      ----------------------------------MTKEPRLAALLRLQNQLQIDEVEEGS
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------LSSRLSVSETGSGFVGNA
A0A0Q4Q524      --------------------------MVNGRYPAAGRPIRQRTAGQILRDHLDVAPTRLS
A0A0Q4CFJ9      --------------------------MVNGRYPASGRATRQRVAGEILIDHLAIVPTRLS
A0A0Q4FE58      --------------------------MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLS
A0A0Q4JWC8      --------------------------MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLS
A0A0Q4KFL8      --------------------------MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLS
A0A2U9NDY5      ------------MEGQGGKGQSAERQAHPGTEGGRRRKRPQTTAREDQDRRKGGEAGKDA
A0A2J4YQQ6      --------------------------------FTIGYLSRLKAITDLQENLIVADQGKDT
A0A0Q4IGG1      --------------------------MVNGQYKAAGRAERQQLAGKILLDNISINPTRLS
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      -------------AQDGVEVLVAQLAANPGTRFEVVRNPRIVTIQGYQDALDISEQGKES
A0A3C0PWB6      -------------------------------------------ALDYQDRLKVGEAGKDS
V4Q8B7          -------------------MQIAQLDARPGTEFALVRNRPQTTALDYQNRLKVGEAGKDS
A0A0Q8XKK5      -------------------------------MTAVERAKREKAAVQILQSNIAISPIRNS
A0A2E0Q2W0      ------------------------------------------------------------
A0A142W0R3      SLAARTVRAGNLLNDKDFLAQYDLTGGEEGTPNSAQRARMAERAEKILLDAVSIEPVRQS
A0A0S4XR18      ------------------------------YKIIHQSNKNSFIDGFIRPNLNVAQISKQA
A0A2E0GW64      ------------------------------------MLSGQLKVSDQGDQTQKNSYLRET
A0A3S1IBR2      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A3S3EAI9      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A3S1P7J5      ------------------------------------------------------------
W7Q8F9          ------------------------------LAKRNRNGDIRSLGGRLQITEAAGGRGSPT
A0A3M2BE89      GEMLLEGQIGRVAEDHGISLYVSELIARPGTRFDLKKTGWLTAVKTLQKTLKVSEKGKKT
A0A257G674      -----------------------DAMGMRQPAGDLSRGELEDLTLQALEDARDVSMPRNS
A0A1I1UM01      ----------------------RR------------------------------------
Q44573          DRLCHMGLGFLCHASTPVDPQVQR-----------------EHEEDAFLNNLTVTPEPRT
A0A167IR75      ---------------------------------AEGRAERQREAADILLTNVTINPTRLS
A2W025          GTRLLAGRVGESAQGGGVTLLVQKLVARPGTQFTVVRYNDLDAISGFQAGIQVSEQGKQT
A0A350DWX8      ----------------------TG----------------------LISSNLGVSPERGS
V4J283          ----------------------GA--------------------------FTAVEYPNYS
A0A0Q4UFQ5      ----------------------QT---------AAARASRIKAAGNLILARMDVEPERMS
A0A432EMV7      ----------------------SK------------------------------------
A0A166Y9U5      ----------------------LE----NGRFPADGRVARAREAGELLLENVGIEPTRLS
A0A318KWA2      ------------------------------------------------------------
A0A1H3KC95      ----------------------RR---------------------------WPLHDGAED
A0A0B3RZC9      ----------------------RK------RTSATGSAR----------------PVSEP
A0A2E9HXF7      ----------------------RK------RTSATAHP-----------------PAADP
A0A2K8U7M6      ----------------------SV------------------------------------
A0A238KJM1      ----------------------RK------------------------------------
A0A3A0FJZ4      ----------------------LRDAVLCLRRRAGWLALALALGVAGGVAAHRLLPPRYV
W4HJV8          ----------------------RR------HRPAATGWDDGARVPA---------RTTGP
A0A0P1GDI0      ----------------------RK------NRSADAVEDEMPPI-----------APLES
A0A2R8ATV5      ----------------------RK------KTQGAASSAALAPESRPVVSEEERREQIVA
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ----------------------RK------KRPTAETDAP---------------EPAEV
A0A0W7WHP4      ----------------------RK------GKRVR--------------------DAAPT
A0A238J8F6      ----------------------RK------YKSVDATAEQAAEEVLRQEELRAAAAEAKA
A0A238JQI6      ----------------------RK------HRSAAGKPRPAPESV----------PETLP
A0A222E077      ----------------------RK------RTSATAHP-----------------PAAAP
A0A239E3Y2      ----------------------RK------RTSATAPH-----------------PAADA
A0A0H6V1F7      ------------------------------------------------------------
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A383M853      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A447YBN8      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A3S2K5U0      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A354VPS3      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1E3DAN4      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
E8RBB2          ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A435ZMC2      ------------------------------------------------------------
A0A3S1X1N3      ------------------------------------------------------------
A0A434B8G6      ------------------------------------------------------------
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A1E2ZGQ8      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
A0A2R7TMW6      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1B9Z0F1      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
A0A1E2UHX3      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      PRQVVRVLKANK------NFIIMCTLSALLLAFLHQSFLYVPIFVSESKLKVEPKSDSMS
A0A2D5LFD8      IYRRKKLIAIS-------AIAITSAITGQLI-----------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      --QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A3M5YLE8      --QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A3M3RP89      --QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A0P9QIY7      --QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A0P9VVH7      --QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A0Q0FJK6      --QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A0Q0G2J0      --QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A3M3LF66      --QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A0P9WIR8      --QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A3M3KPE5      -------------------MIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A3M4C263      -------------------MIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A3M5AD05      -------------------MIKSRALLGKVVDDLKLNVLQTPDFF---------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0P9R9W0      --QRQTTLSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0Q0B9T0      --QRQTTLSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M6CFI7      --QRQTTLSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9JXN0      --QRQTTLGVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M6FIV7      --QRQTTLGVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M4ENY1      -------------------MIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A3M5EZK7      -------------------MIKSRALLGKVVDDLKLNRLQTPDLF---------------
A0A0P9SPP5      ------MVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M5DM48      ------MVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M3NNF2      ------MVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9NNS0      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M6AI26      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M4WA51      --QRQAIVSVT-------ELIKSRALLGKVVDDLKLSTLQTPDFF---------------
A0A3M4A0E8      --QRQAIVSVT-------ELIKSRALLGKVVDDLKLSTLQTPDFF---------------
A0A3M4GLF4      --QRQAIVSVT-------ELIKSRALLGKVVDDLKLSTLQTPDFF---------------
A0A3M4PBZ2      --QRQAIVSVT-------ELIKSRALLGKVVDDLKLSTLQTPDFF---------------
A0A0P9IWP8      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0Q0B3J8      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M5M873      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDLF---------------
A0A0P9VHH8      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9YV98      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M3G2W8      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M6C224      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9PWZ3      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M5K254      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9KZ49      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9PS59      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9V840      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0Q0AIE5      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M2ZQH6      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0N8SQG2      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0W8HFU1      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M5JFB0      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M3TQV3      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M3EF92      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M5J1E2      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M5G7H9      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M4A376      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0Q0A5T8      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9SCD7      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9T4G3      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9VKB0      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0Q0BM35      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M3TPR7      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M3U4Q3      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9UCX7      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9S1F1      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9QCJ2      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9Q329      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M5GJ64      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A0P9MPC7      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M2XYQ3      --QCQATLGVA-------ELIKSRALLGKVVDDLRLNRLQTPDLF---------------
A0A0P9XCE1      --QCQATLGVA-------ELIKSRALLGKVVDDLKLNRLQTPDLF---------------
A0A3M3EFX7      --QCQATLGVA-------ELIKSRALLGKVVDDLKLNRLQTPDLF---------------
A0A3M5B9D9      --QCQATLGVA-------ELIKSRALLGKVVDDLKLNRLQTPDLF---------------
A0A0P9RRZ3      --QRQATLGVA-------ELIKSRALLGKVVDDLKLSTLQTPDFF---------------
A0A3M2VEK7      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A0N8R9B3      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A0P9VA27      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A3M4YBJ4      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A0P9J470      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A0Q0EVJ8      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A3M5UI30      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M5YQT8      --QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M5F5X1      --QRQAIVSVAXXXXXXXELIKSRALLGKVVDDLKLNTLQTPDLF---------------
A0A3M5R8G1      -----AIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M5V012      -----AIVNVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M3GA16      ---RKAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF---------------
A0A3M3CJL0      --QRQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A3M3F6F5      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A3M3P9B7      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A0N8QB74      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A0Q0AUD0      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A3M5VR55      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A0Q0FK97      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A3M3UCT3      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A3M5XGQ7      --QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A3M5KZ75      --RPXXXTTEI-------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A3M5L3G5      ------------------ELIKSRALLGKVVDDLQLNRLQTPDLF---------------
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
K0XBA5          ------------------------------------------------------------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2A5PQG0      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A0T9WT26      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A0K9JYB4      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A2D9ABL7      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A062ME93      ------------------------------------------------------------
A0A3A3BFE8      ------------EHITKVLNAILVTYGDQNVERRSAESAQTLKFLDEQLPDLKKQ-----
A0A0L0M4Q4      ------------------------------------------------------------
A0A2T4ZJZ6      ----------------------------------------------------KEQ-----
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------QSRLVATGDYAPSILSPWRAAKEAK-----
A0A2G9ZR82      ------------------------------------------------------------
A0A0A8J8L3      ---------DNPILISNILDNISQNYLSQNVARQAAQDAKSLEFLNQQLPKVRAE-----
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ---------------TRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSE-----
D8EEU7          ------------------------------------------------------------
A0A376QQZ0      ------------------------------MVRQKKCSGIRRSYLDEYLPKVKTK-----
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      -------------GKIGLSGAARNQFITEVFRLRSIEASSAVDTLVEQDKRVRYN-----
A0A377N8F8      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ---------------------MGERRSFSRTPRKALSREARQQLISDMLDEEFGT-----
A0A1V5DJV0      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A436B5W5      ------------------------SFIDQRLDQTSETSDLARQFIQEQVLQVKQK-----
A0A3S2AQS7      ------------------------------------------------------------
A0A3S2FP30      ------------------------------------------------------------
A0A436NMQ4      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      PIVRIAFVHNERSYPHVVVNQIARSFIELSVDQKAESANKIRLLLQGQADLVKQQ-----
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      RLVNISAVSTMPLMAKKVADAITEAFIDDNLERRLSSTKSASTWLESQLLSLRKK-----
A0A2N2INV3      RLVNISAVSTNPLMAKKVADAVTEAFIDDNLERRLSSTKSASTWLESQLLSLRKK-----
A0A1Y5DXG5      GIVNLSFQHESPEYSQMVLNEITEIYVRRNVDRNSAEAKKSLDFLAVQLPEIKKQ-----
A0A0B8P2H5      GILSFGFEGENKAQIIDLLNDIANNYFLQNVDRNAAEAENSLEFLQEKLPEIKAE-----
A0A2G2GD62      SNIFVRFDDTVALRAKDIVDGITTAYIQDSVDQKKSSTERSLAFIDKQLDNINKT-----
A0A1M7HC79      ---------------------MAETFLTQNVERQSAEAQQSLEFLQEQSPELRAQ-----
A0A1D3JZN6      ---------------MRTLNEISSLYVRQNVDRTSAEAAQSLAFLNDQLPQVRRD-----
A0A1V6ESG1      ------------------------------------------------------------
A0A328C2K5      RVGLIQVRYEDPELAARIADGISETYVEYIREFQTGGLRQLANWFDDYVSTKREE-----
A0A3D8MRR7      RVGLVQVRFKDPELAASIADGISETYVEYIREFQTGGLRQLANWFDDYVSTKREE-----
A0A437R5U4      RVGLVQVRFKDPELAASIADGISETYVEYIREFQTGGLRQLANWFDDYVSTKREE-----
A0A1H7YHK3      ----------------------MEAYGRRKVDRNSAEVSSQLKFVKDQLLEVRKQ-----
A0A0P1FRV5      ------------------------------------------------------------
A0A3M0ZZ99      -----------------------------------------MEALRGELAAIEGR-----
A0A0H4KZM1      ------------------------------------------------------------
A0A090R136      -----------------------------------------MHFLSDHLPNIKSQ-----
A0A2E2T3V8      TVIQIGVTDDDPERAYQIVSAVAESFVWLRNNELRRGMDNQLTVIQRQLDEARKR-----
A0A367UAB4      TVIQIGVTDDDPERAYQIVSAVAESFVWLRNNELRRGMDNQLTVIQRQLDEARKR-----
A0A377V641      --------------------------MAQNISRQAAQDEKSLEFLNKQLPMVRSD-----
A0A1F2YJ88      GILGLNYQGTDKTHITQVLNAILVSYSQQNIERRSAETAQTLKFLDEQLPELKQQ-----
A0A0J7XGZ1      YLVEITASSEDPDLAARIANALARRYIGLDSAKKQARNAQSAHYVESQAAALRKH-----
I4CBA7          QLINVEASANDPFAAREKLRDYLEQYIRADRERLETLANSLLAKLQNELRQAEER-----
A3VE95          YVFEIQFSAAEPGIAQQIANGIADTYIALQLENRRDSAVQATAWIQEQVNEARAT-----
A0A154VE85      RIVAVDFTAADPDLAAAAANRTAGLYVEDRVAQRAAAARRADEWLGGRLERLREE-----
A0A1G0NL95      GVLQLSVRADSPQAAALAANAVAGAYLQQNVSRRSREAGLTLAFIARQLPQVRAR-----
A0A024KA69      YLVSVRANAPSPIEAASYANAVANSFIHEEVAAKIDGVLADVAALRAQVTVAGEA-----
A0A168QTU8      ------------------------------------------------MPKISAD-----
A0A0L1KFN4      RLVDINFTSPDALFSAQVANAWAENFIEINLERKVQSTSYGRTALQRQLAEYKDR-----
A0A3T9EHW9      ------------------------------------------------------------
A0A377LY04      --------MKIKIKSAKFSTALPATTLSRTSNASRLKRRKAWPSSPDSSRKYAHV-----
A0A2T1MXF1      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A358L616      ----------DPELISQVLDRVMSNYLMQNVERKSAEAQKSLEFLQHQLPQVRGK-----
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      GIVNVTLEDPNPEHAIRVLEEVASRYVDQNVARNAAEATQSLEFLNEQVPAVRKK-----
A0A3C0PZN1      -------------------------------------------FLNEQVPAVRRN-----
A0A3S1NQ09      YVIALGYQATDPALANAITKAYADAYLADQLDASFDATERAAVWLQGRLTELRQS-----
A0A443GJ52      YVISIAYQATDPVLATAVTKAYADAYLADQLDASFDATERAAVWLQGRLTELRES-----
A0A3A0FZC0      SLVTVEATVSDPRLAALIANRHSESYIDWVRQNRIDQQARGLTFLRAQADELREK-----
A0A1N7JVZ7      DDSADAHDSPSPKVFRRQKRSVAPGETQAEPTPEPQQPAPKPQLVHNERPRRSAEQAFPP
A0A091C4A8      RLVRVHFDSPDAAFSQRVVNAVAEAYIASNLERRFDASSYAKTFLEERLEQLRIQ-----
A0A435LQD4      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A2W6S588      ALFSIGYSDGDPLAAARIANVVAGAYLAVQAQQKLGQGSATSNQLKGQVEKLRQQ-----
A0A444I5K6      YVLDVSYTAQSPDLARDIAAAIADVYLVDKLNSKYEATRRAGQWLQERIEELRQQ-----
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A3C1S9Y1      RLVDVTAEAKNPALAARMANEVVKVYIDQNMETKLAAAKDAVRWLTERIEDERKK-----
A0A353EH49      GMLTLAFTSIHQHQVADVLNQIVNSYVDQNLERSAAEARLSLEFLERQLPPLKEQ-----
A0A1Y1Q9C1      HLVKVFYESPDPVLSADIVNALVNAFIKDNISSQSETDTYAKEFLEQEMEKARQR-----
A0A3M7LJH0      GIVELSFTGENPSQIQAILDDISQNYFLQNVQRNSAEAEKSLAFLKGHLPTIKTE-----
A0A316KRG4      ------------------------MTEQPKFQRRKRRGADAPVDTPDHRPSNAQK-----
A0A1E4JHX8      RLVTITFTSPDPKLSARVANAWTANFIESNLERRFEATSYARKFLEERLRQWRER-----
M2U8P2          FVITIASEGPDPEIAAAAVNSVIDIYVGGQVSEKSSQRQREISILRERIAELKTD-----
A0A1H7KZF8      RAASIAFTSPDPQLSALIANSFADHLVRRDVQQRADQSRYARAFLESELANIRTR-----
A0A0J5Q9T7      ------------------------MAERRKFHRRHGPTQDATGTQPAEDLAPISP-----
A0A3D3VHV9      ------LESPRPADAARILDEVSRLYVLQNVQRKSAEAQQSLDFLKEQLPTVRRQ-----
A0A257NG76      GILELTMESTSQDSVLQTLNEIANIYVRQNVEQKSAEAQKTLEFLEKQLPQLKEQ-----
A0A1T4TW59      QLVRIHFDSANPELAAKVANAVGNAYIESNLEARLLATQTASTWLTERLAVLEDS-----
A0A1Q3MB35      RLVDVKFTSPSPKLSAQVADLWVSQFQQAALDRRFLSTADAREFLEGRLAELRGR-----
A0A1I5YYQ0      --------------------------------------MSADRTFRRKNRPVRAR-----
A0A259LUN7      ------------------------------MEEKYNATRKATEWLQLRVSALQEE-----
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      GMLTISLLGSDPDLIKRVIDSISDNYLEQNIARQAAQDAKSLDFLNQQLPKVRTE-----
A0A2G2CXY6      GIISLSMQHESPAQATRILDEVSRLYVLQNVARNSAEAAQSLEFIREQLPVVRQE-----
A0A3M1D4H3      ------------------------------------------------------------
A0A447B6K7      GMLELTLIGANPTLIRNTLDGITQNYLEQNVARQAAQDAKSLDFLNKQLPKVRDE-----
A0A1J5ICP0      ELVTISATAPNPSMAATKVNVIVSEYKSLAVLKDTQNAASALAFIDEQIGILEKS-----
A0A0M3GBT1      DVVQVSFTTNDPQLAAAVPNRVISIYLDERKGSVRSRLDAAEKWIVQRISEQKAR-----
B3Q577          DVVQVSFTTNDPQLAAAVPNRVISIYLDERKGSVRSRLDAAEKWIVQRISEQKAR-----
A0A379B9V4      GIINIAIQGKDKKHIQDIVSSIAESYLLQNVARNSAEASKSLEFLNQQLPDVRQK-----
A0A1A7QJ97      RLVDIRFTSPDPAFSASVANAWAENFIESNLERKLQSTSYGRDALQRQLTDYKQR-----
A0A0Q6TS97      SLVDVRAVTPDPALSQRIAQAWGEDFIASNLERRFEASGYARKFLEGRIEQLREK-----
A0A0Q6UYB4      SLVDVRAVTPDPALSQRIAQAWGEDFIASNLERRFEASGYARKFLEGRIEQLREK-----
W7Q5J0          GVLRLSMTGPDTQEIVRSLDAVADTFLTQNVERQSAQAEQSLVFLEEQTPELRHQ-----
A0A087LTV7      AWDLRGLEGAIRRQWRVVALAVAAGLALASAALLVMPVSYSATALLYFDPSPRGV-----
A0A0G9MZA5      TLVDISFSSPDPQVSARIANAWADAYIAENLDRRFGATRDARSSLEEQLQQYRQR-----
H0T8B0          YIEEITYTSRDPVLAGEVANAIAQAYIEDQLQSYFETSIRTNTWLEKRVAELHKQ-----
A0A351CXR4      GVLDLGFTSPNADLSADVLNVLAETYIDHKRSSKTNRVSEASEWLNAQMTEIKVD-----
A0A2N6GLF5      QLVRVAFEANDRQLAADVANNLANIYIVNDLEARLSMTSKASDWLTQRIEDLGEK-----
A0A1W9LJP0      RLVNVRVEAKDPALAAKIANAVVQAYIDQNLETKLTAAKDAVKWLIDQMDEERKK-----
A0A0W1ICB0      ALVDVSYSSASPQLSRLIASTWVNEFVQQSMDRRLASTADARIYLEGRLQGLRDR-----
A0A2E0UL88      --------------------SYQQTEGIVSLDQESEGLINQLSNFEAQREQAKIE-----
A0A233IKJ2      ---------------------IGNVFMDSHIEDKLQVELKANSWLNNRMGDLREK-----
A0A2T1JE00      -------------------------------------ELKANSWLNNRMGDLREK-----
A0A0T2QIS1      RLVDIGYTSGSADLSATIANTWAQQFVASSLDRRFSSTADARKFLEGRLAELAQR-----
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      GMLELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSE-----
A0A376RML0      GMLELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSE-----
A0A377E5P7      ------MTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSE-----
A0A0P7Y1D0      FMLTIAFTSENAAKAARIANAFADQYLLSQLEAKFDATERANTWLNERLETLREE-----
A0A2M7JRZ7      RLVKVHFDSNYPELSAKVPNTLAVTYIQQSVESRFIATEQVKEWLTKQLEDLKAK-----
X7F6S5          ------------------------MAAGPRFRRR-----KGRAAPAEDDLRPVPP-----
A0A1P8USW9      ----------------------MNMVDRRKFRRKFGRTEAPAPETQPED-PPIEP-----
A0A1G7CFZ2      ----------------------MTMTERRRFRRR----NRPLDDLPDEDISPVEP-----
A0A2E1D962      ------------------------MTERRRFRRR----NRPLDDLPDENISPVEP-----
A0A1I6U4V1      ------------------------MVERRKFSRR----KRAEELPED---PPILP-----
A0A1G8NKI0      ----------------------MTMSERRPFRRR----NRPEDTPPP---APTPR-----
A0A355QPE4      ----------------------MTMSERRPFRRR----NRPEDTPAP---APAPR-----
A0A357RN98      ----------------------MTMSERRPFRRR----NRPEDTPAP---APAPR-----
A0A3B8T2U6      HVVEIEFVSEDPLLAATISDTVANVYIENYLEAKLEMTAKATTWLNTSLAGLKNN-----
Z2EKW7          -------------------------YIDANFEAKLVVTQNAATWLTNNSQKLEER-----
A0A365PWR2      GIFVLSITDADPERAVNILAEVMKAYVAQNIERAAADASSGLEFLTTELPAMRAK-----
A0A2E9H5Z8      -------------------MGQSEEYILKSAEMQQFGAEERKAELENQIQQLLTL-----
A0A2E2BR79      GMLRLTLTGTDREEIRRLLDAISETFLMQNVERQSAQVDQSLAFISEQAPDLRTQ-----
A0A0Q4Q524      RLVEIRFTSPDAAFSARIVNTWSDAFIQTNLERKVQATSYGRNLLQRQLAQQKER-----
A0A0Q4CFJ9      RLVDIRFTSPNPEFSAKIVNTWSDAFIQTNLERKVQATSYGRNLLQRQLAQQKER-----
A0A0Q4FE58      RLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKVEATSYGRNLLQRQLAQQKER-----
A0A0Q4JWC8      RLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKVEATSYGRNLLQRQLAQQKER-----
A0A0Q4KFL8      RLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKVEATSYGRNLLQRQLAQQKER-----
A0A2U9NDY5      GSSDMAREEPDPQLASRVRDESSRRDGNQNSQRSAAEAAQRLDGLRAQRPQVRKE-----
A0A2J4YQQ6      GMLTLSLTGDNPALIERIINSITENYLAQNISRQAAQDAKSLEFLSKQLPQVRSD-----
A0A0Q4IGG1      SLVDISFDSPDPILSTQIVNAWSDSFIQTNLERKVQATSYGRNMLQRQLALQKSR-----
A0A3M1CJM3      ----------------------------------------AAAWLASQAAELKTR-----
A0A2R7SVD4      GIIRLALASADAAEAVKILNKIAALYVDQNVRRTSAEAAQSLAFLQSQLPQVKRD-----
A0A3C0PWB6      GIIYMSLEDPDPQLASRVLDEISRLYVSQNIQRSSAEAAQRLDFLRSQLPQVRKE-----
V4Q8B7          GIIYMSLEDPDPQLANQVLDEISRLYVSQNIQRSSAEAAQRLDFLRSQLPQVRKE-----
A0A0Q8XKK5      ALVDIKYTSGSPELAAQIANTWAQQFIEASMDRRFASTADARKFLESRLADLRTR-----
A0A2E0Q2W0      ------------------------------------------------MAEQRER-----
A0A142W0R3      SLVDVSFSTPSATLSAKLTNLWVQQFVAANLDRRFSATSDARRFLEQRIGSLRRN-----
A0A0S4XR18      SIVKITFEDAIPQRGVDIVNNLVKVYFAQKLDYQREEVEKKLKFVNDQLTITHDN-----
A0A2E0GW64      GVVQASFTWGKPQQAQEILNAIINTTQEKDIQKKSQQAAQALQFINSQLPKVKTD-----
A0A3S1IBR2      --RAAVWLQGRLTELRQSSQAASLAVEKFRAEHGLAANSDGQLMSDKQLSDLNAQ-----
A0A3S1NZ06      ------------------------------AEHGLSASSDGQLMSAKQLADLNAQ-----
A0A434DUT4      ------------------------------------------------------------
A0A3S3EAI9      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A3S1P7J5      ------------------------------------------------------------
W7Q8F9          GVLRLTMTGPDPQEIVRSLDAVADTFLTQNVERQSAQAEQSLAFLEEQTPELRSQ-----
A0A3M2BE89      GVFLLTLEDPDADRAVAILNAIANVYLRQNVERKSEEAQKALEFLQGQLPKLKAQ-----
A0A257G674      RLASVSFTSPQPELAARISNTLAAEFIQANLQRRFDSSAYARDFISGQLAEARAK-----
A0A1I1UM01      --------------------------------RRTQPEQEPAEDDLRPIPPLDTR-----
Q44573          QILDINVVDGNPERAAALANAVVTNYQRIALARQTADINRVATWLDNRTAALRQR-----
A0A167IR75      RLVDISMTSPDPAFSAEVANSWAENFITTNLERKVQATSYGRDALQRQLTEYKER-----
A2W025          GVVQISLEGKDPDQTAAIANALAQSYLNQHVVAKQAEATKMLDFLKGEEPRLKAD-----
A0A350DWX8      RLVRITFSSPSAAVSARMANAIAENFIEANLARKFDASLYVREFLEEQIAETKAR-----
V4J283          GILNVGFSAGEPEQAATILNAILDNYQRRNVERKGEEADKTLEFLEKQLPPLKAR-----
A0A0Q4UFQ5      RLVEISFTSPDPELSKRVVDAWSTNFIQSTLERRYSATSYARNFLEERLKQLRIR-----
A0A432EMV7      -------------------------DPQLSADAANAISEAFIEVGLETQLDETRQ---AK
A0A166Y9U5      RLVDISFSSPDAEFSARVANAWAEQFIKMNLERKIQATSYGRDVLQRQLAEYKTR-----
A0A318KWA2      --------------------MDGETPRALGEARVGELAR-------FAEGDIELR---VA
A0A1H3KC95      YREAPLVLGPETRSCDRFAPQEDPPPPSAESDDVPRPRR-------PRLVRKHRK---AV
A0A0B3RZC9      PDPVRPLDETAREAARKRDAAAEQARSEAEARRIAEAAD-------KAKAREKAQEKLRR
A0A2E9HXF7      ASPYAAVKAASQEAARLRVEADERARAEAETQRIAKAAE-------RAKFEEKA----RR
A0A2K8U7M6      -------------------AFDSPNPAEAAAVAQTLAEN-------FVNSGLERR---YE
A0A238KJM1      ------------------------HRSPTETVSVLKSKR-------ESEEEIQAR---LE
A0A3A0FJZ4      GESTLLVESSWVRDGFIDTPVASSLRSQVQTLRHRLTSDRALAGIVAALGDAPLA---AL
W4HJV8          ETSFDVQGTDAAEAGADTDTAFDPVRDGGRSTAKASGET-------PSNRESGPP---DT
A0A0P1GDI0      REERLARRRAEQEAEQARLAAEEAARVEAERLEQARLEE-------QARQEALAR---KA
A0A2R8ATV5      EKRRRAEESRQQRVAMRQAEAEARRQAEAEARRQAEEEEARQQAAAQAKADLQRR---KA
A0A1U7D3R6      -----------------------------MTAERTRSES-------ASDAQEAAR---VA
A0A2D4UVV2      TSAAPPAAAPTHRRKRRRTDAAQTPPTEAVTAERTRSES-------ASDAQEAAR---VA
A0A0W7WHP4      ETDMTPVPPLEPRARRSEDTLPETGGTSARETEEAREAE-------EARAAETQR---AT
A0A238J8F6      AAQKAALEAQRREVAKR--AAAERARQQAEAEQRAREEA-------EKTAAEAKR---LA
A0A238JQI6      ETLPESVPKNLPEIAPE--TAPEPPVPDPEAGARRTAEA-------QARAEEKAR---RK
A0A222E077      ASPYAAVKAASQEAAHLRVEADERARAEAETQRIAKAAE-------RAKFEEKAR---RK
A0A239E3Y2      ASPYAAVKAASQEAARL--------RAEAEAQRIAKAAE-------QAKSEEKAR---RK
A0A0H6V1F7      ------------------------------------------------------------
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A383M853      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A447YBN8      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A3S2K5U0      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A354VPS3      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1E3DAN4      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
E8RBB2          ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A435ZMC2      ------------------------------------------------------------
A0A3S1X1N3      ------------------------------------------------------------
A0A434B8G6      ------------------------------------------------------------
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A1E2ZGQ8      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
A0A2R7TMW6      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1B9Z0F1      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
A0A1E2UHX3      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      ITPLLERFQQNEQLFTRTSAVLEEVQSEPFLNLVVANYLKEGNKISFIVPAERVRGLILF
A0A2D5LFD8      -------------FQRLFHPVYEGTFS-------------------------LLIKDPIN
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A3M5YLE8      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A3M3RP89      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A0P9QIY7      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A0P9VVH7      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A0Q0FJK6      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A0Q0G2J0      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A3M3LF66      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A0P9WIR8      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A3M3KPE5      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A3M4C263      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A3M5AD05      --PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLT
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0Q0D3D2      -------------------------LPKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9R9W0      --PVIGPY-----LYRTFKPLRDGELAEPLFGLTHYAWGGEKIDVFQLEVPEYLLGEKLT
A0A0Q0B9T0      --PVIGPY-----LYRTFKPLRDGELAEPLFGLTHYAWGGEKIDVFQLEVPEYLLGEKLT
A0A3M6CFI7      --PVIGPY-----LYRTFKPLRDGELAEPLFGLTHYAWGGEKIDVFQLEVPEYLLGEKLT
A0A0P9JXN0      --PVIGPY-----LYRTFKPVRDGELAEPLFGLTHYAWGGEKIDVFQLEVPEHLLGEKLT
A0A3M6FIV7      --PVIGPY-----LYRTFKPVRDGELAEPLFGLTHYAWGGEKIDVFQLEVPEHLLGEKLT
A0A3M4ENY1      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5EZK7      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9SPP5      --PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGKKLT
A0A3M5DM48      --PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M3NNF2      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9NNS0      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M6AI26      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M4WA51      --PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M4A0E8      --PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M4GLF4      --PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M4PBZ2      --PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9IWP8      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0Q0B3J8      --SVIGPY-----LYRTFKPVREGELSKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5M873      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9VHH8      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9YV98      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M3G2W8      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M6C224      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9PWZ3      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5K254      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9KZ49      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9PS59      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9V840      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLT
A0A0Q0AIE5      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLT
A0A3M2ZQH6      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLT
A0A0N8SQG2      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0W8HFU1      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5JFB0      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M3TQV3      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M3EF92      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5J1E2      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5G7H9      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M4A376      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0Q0A5T8      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9SCD7      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9T4G3      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9VKB0      --PVIGPY-----LYRTFKPVREGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0Q0BM35      --PVIGPY-----LYRTFKPVREGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M3TPR7      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M3U4Q3      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9UCX7      --PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9S1F1      --PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9QCJ2      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9Q329      --PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5GJ64      --PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9MPC7      --PVIGPY-----LYRTFKPVRDGELSKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M2XYQ3      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPENLLGEKLT
A0A0P9XCE1      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M3EFX7      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5B9D9      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9RRZ3      --PVIGPY-----LYRTFKPARDGELAQPLFGLTHYAWGGEKIELFQLEVPEHLLGEKLT
A0A3M2VEK7      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLT
A0A0N8R9B3      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLT
A0A0P9VA27      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M4YBJ4      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0P9J470      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0Q0EVJ8      --PVIGPY-----LYRTFKPAREGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5UI30      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLT
A0A3M5YQT8      --SVIGPY-----LYRTFKPVREGELSKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5F5X1      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5R8G1      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5V012      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M3GA16      --PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M3CJL0      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M3F6F5      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLT
A0A3M3P9B7      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLT
A0A0N8QB74      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLT
A0A0Q0AUD0      --PVIGAY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLT
A0A3M5VR55      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLT
A0A0Q0FK97      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M3UCT3      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5XGQ7      --PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5KZ75      --PVIGPY-----LYRTFKPAREGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A3M5L3G5      --PVIGPY-----LYRTFKPAREGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
K0XBA5          ------------------------------------------------------------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2A5PQG0      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A0T9WT26      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A0K9JYB4      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A2D9ABL7      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------MDELKARINAEVQSVLAS------------
A0A1F9E324      ------------------------------------------------------------
A0A062ME93      ------------------------------------------------------------
A0A3A3BFE8      ------------------------------LDDAERQFNKFRQQYNTV------------
A0A0L0M4Q4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------MEASIVALNEYKNQKGSV-----NLDIET-
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------LDQAEDKLNVYRKQKDSV------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------LDQAEEKLNVYRQQRDSV------------
D8EEU7          ------------------------------------------------------------
A0A376QQZ0      ------------------------------LDNYENQLNNFRKKNESI-----DLSLEA-
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ----------------------------STVEVTEIGEPARAAPAPVA------------
A0A1V5DJV0      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A436B5W5      ------------------------------LQTSEKELVTYAKDAGIT------------
A0A3S2AQS7      ------------------------------------------------------------
A0A3S2FP30      ------------------------------------------------------------
A0A436NMQ4      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ------------------------------LTSAERELNDYAKSISFT-----DLEEQ--
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------LDEDEKRLYEFKLKNNIL-----AVSLEAR
A0A2N2INV3      ------------------------------LDEDEKRLYDFKLKNNIL-----AVSLEAR
A0A1Y5DXG5      ------------------------------LEVSEALFNDYQKNQKSV-----NISLET-
A0A0B8P2H5      ------------------------------LTANEDALNKYRQDNESV-----DLGLEA-
A0A2G2GD62      ------------------------------LSKSEKVLQGFKQKNNLL-----SLDIKA-
A0A1M7HC79      ------------------------------LADAEERLNQYRVAMDSV-----DLSSES-
A0A1D3JZN6      ------------------------------LEKAESALNSFQTRSKSI-----DISLEA-
A0A1V6ESG1      ------------------------------------------------------------
A0A328C2K5      ------------------------------LDQASSELQKYQRDNNILSHSFEDRREMAA
A0A3D8MRR7      ------------------------------LDESRSELQKYQRDNNILSHTFEDRREMAA
A0A437R5U4      ------------------------------LDESRSELQKYQRDNNILSHTFEDRREMAA
A0A1H7YHK3      ------------------------------VEAAQAAMNAYQTKAKSV-----DITMQT-
A0A0P1FRV5      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------EAEVTAELRRALQQGNLS------------
A0A0H4KZM1      ------------------------------------------------------------
A0A090R136      ------------------------------LTIAEDLLNAYRQENESI-----DLGLEA-
A0A2E2T3V8      ------------------------------LETVEQRHADWEKSSGNIADRERELI----
A0A367UAB4      ------------------------------LETVEQRHADWEKSSGNIADRERELI----
A0A377V641      ------------------------------LDSAEDKLNDFRKRNDSV-----DLSLEA-
A0A1F2YJ88      ------------------------------LDVAEREFNKFRQQYNTV-----DVTKES-
A0A0J7XGZ1      ------------------------------AVADDATLQQYMIRNNLMSAEGATMAE---
I4CBA7          ------------------------------MRKSQEELVNFAREHGMV------------
A3VE95          ------------------------------VEAAEAALAEYRSDALTREGGTYETS----
A0A154VE85      ------------------------------AAAAQQRLDAYRRETGMLEIGGGSIYRDQL
A0A1G0NL95      ------------------------------LETAEDALNRYRLASSSA-----DLEIET-
A0A024KA69      ------------------------------VRAAQQALGLRSGFEERQ------------
A0A168QTU8      ------------------------------LDQAEARLNAYRAQRDSV-----DLSLEA-
A0A0L1KFN4      ------------------------------LDESQRQLVTYASNQEII-----NLPSQSV
A0A3T9EHW9      ------------------------------------------------------------
A0A377LY04      ------------------------------WDDAENKLNAFRQDKDSV-----DLPLEA-
A0A2T1MXF1      -------------------------------DVAENKLNAFRQDKDSV-----DLPLEA-
A0A2X3K9R3      -----------------------------------------------M-----DLPLEA-
A0A1M7BLL7      ------------------------------MPWRATSLWALSGDGAMK------------
A0A358L616      ------------------------------LDEAEDKLNTYRRNNESV-----DMSLEA-
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------LEAAQTALNKYQTGSGSV-----DITAET-
A0A3C0PZN1      ------------------------------LEAAQTALNKYQTGSRSV-----DITAET-
A0A3S1NQ09      ------------------------------SQAASLAVEKFRAEHGLAANSDGQLMSDKQ
A0A443GJ52      ------------------------------SQAAALAVEKFRAEHGLAVN-DGQLISDKK
A0A3A0FZC0      ------------------------------VADLERELADYAEANSIV------------
A0A1N7JVZ7      LASDEPAPHPETSREALLAFAEDLAFPDLTVEDDAPPARSEKPTPEAAPAAWDDTKMEGH
A0A091C4A8      ------------------------------LEDSESRLVEFAQRERIV-----DAIDG--
A0A435LQD4      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A2W6S588      ------------------------------ALEADAAVAAYRLKHNIL-----T------
A0A444I5K6      ------------------------------ALDTDLAVQKFRSEHGLV-----EAGSGTL
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------VETAENALLQYKQEQGII-----TGFSNDA
A0A353EH49      ------------------------------LDAAENAYNKYRVQHGSI-----DLGAET-
A0A1Y1Q9C1      ------------------------------LTLQEAKLIEYAKQNNIL-----EVN----
A0A3M7LJH0      ------------------------------LDSAEDVLNRYRQANDSI-----DLSLEA-
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------LEESERVLVAYASDEKII-----NLPAAGA
M2U8P2          ------------------------------LQDAETQVANYRARTNLV-----DIKDDS-
A0A1H7KZF8      ------------------------------LSESERRANDYARRAAII-----AVPARKN
A0A0J5Q9T7      ------------------------------LETRAER-----------------------
A0A3D3VHV9      ------------------------------LEAAEQALNAYQAKAGSV-----DITLET-
A0A257NG76      ------------------------------LEAATTALNDYRTRHGSI-----DLDLET-
A0A1T4TW59      ------------------------------LEAAEFALTDFLRQEGLI-----ELDDIDE
A0A1Q3MB35      ------------------------------LEDAQRQLVAYAADKQII-----TLANGQD
A0A1I5YYQ0      ------------------------------EEDDMRPVAPLERPKDRV-----PQD----
A0A259LUN7      ------------------------------VEEKERRVETFRAETGLL-----EAQGTTL
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------LNESEDKLNAYRRQKDSV-----DLSLEA-
A0A2G2CXY6      ------------------------------LERYEQALNEYQISTQSV-----DITIET-
A0A3M1D4H3      ------------------------------IQETRARLARARAFQGRE-----SVDQVAA
A0A447B6K7      ------------------------------LDIAESKLNTYRKQKDSV-----DLSMEA-
A0A1J5ICP0      ------------------------------LRSSEGRLMSFKEKEKLV-----SLSDDAR
A0A0M3GBT1      ------------------------------ADTAREAARSYQESMDVI-----SKEDAQ-
B3Q577          ------------------------------ADTAREAARSYQESMDVI-----SKEDAQ-
A0A379B9V4      ------------------------------LSDSENRLNEFRLKNESV-----DLSLEA-
A0A1A7QJ97      ------------------------------LDESQRQLVTYASNQEII-----NLPATSE
A0A0Q6TS97      ------------------------------LEMSERQVVAYAVQQGII-----NLPSSVD
A0A0Q6UYB4      ------------------------------LEMSERQVVAYAVQQGII-----NLPSSVD
W7Q5J0          ------------------------------LTTAEERLNRYRAELDSV-----DLSSEA-
A0A087LTV7      ------------------------------LEDGRPGAGDGARVDSAV-----DLI----
A0A0G9MZA5      ------------------------------LEEAERAVIAYATAQGLV-----SIDVPRE
H0T8B0          ------------------------------VQESLQAVQDFKFQNAII-----LGSQGRL
A0A351CXR4      ------------------------------LKLAENALQDYRTEQGET-----TTR----
A0A2N6GLF5      ------------------------------LKASEIALQSYREREKLI-----EVGGVST
A0A1W9LJP0      ------------------------------VEISENALLNYKEMQGII-----TNFSNDA
A0A0W1ICB0      ------------------------------LEKSERDLVNYAARQGIV-----RLSEIQG
A0A2E0UL88      ------------------------------LQAARRVMEEYESKVASI-----EPTLST-
A0A233IKJ2      ------------------------------LKESEVQLQTFLKSEGLV-----DIQGVES
A0A2T1JE00      ------------------------------LKESEVQLQTFLKSEGLV-----DIQGVES
A0A0T2QIS1      ------------------------------LEESERLAVNYAARNDIV-----LLGRTIT
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------LDQAEEKLNVYRQQRDSV-----DLNLEA-
A0A376RML0      ------------------------------LDQAEEKLNVYRQQRDSV-----DLNLEA-
A0A377E5P7      ------------------------------LDQAEEKLNVYRQQRDSV-----DLNLEA-
A0A0P7Y1D0      ------------------------------VRTDEQAVEMYRAENGLL-----DTGGSTL
A0A2M7JRZ7      ------------------------------VERADEALQAFGSKHDII-----SLEEK--
X7F6S5          ------------------------------LASREERLARRAEDMSAT-----ESR----
A0A1P8USW9      ------------------------------LESRETRLARRKAETEAA-----AAAEEAA
A0A1G7CFZ2      ------------------------------LATRAERLARRETKTSAA-----QAT----
A0A2E1D962      ------------------------------LGTRAERLARRETKTSAV-----QAA----
A0A1I6U4V1      ------------------------------LERREERLARRR-------------A----
A0A1G8NKI0      ------------------------------PDPQAEALAKAQ----AQ-----AEA----
A0A355QPE4      ------------------------------PDPQAEALAKAQAEAEAQ-----AEV----
A0A357RN98      ------------------------------PDPQAEALAKAQAEAEAQ-----AEA----
A0A3B8T2U6      ------------------------------LIKSEQALNAFYEKEKLV-----NIDGVI-
Z2EKW7          ------------------------------LKKSEHALQEFLLKEGLI-----DINGID-
A0A365PWR2      ------------------------------LEQSELALNRFQTQAGSV-----DISLEI-
A0A2E9H5Z8      ------------------------------------------RDDELI-----DFAEGL-
A0A2E2BR79      ------------------------------LSSAEDKLNEYRVKMDSV-----DLDSES-
A0A0Q4Q524      ------------------------------LDESQRQLVAYASQERII-----NLPAQQN
A0A0Q4CFJ9      ------------------------------LDESQRQLVTYASQERII-----NLPAQSN
A0A0Q4FE58      ------------------------------LDESQRQLVGYASQERII-----NLPAQSN
A0A0Q4JWC8      ------------------------------LDESQRQLVGYASQERII-----NLPAQSN
A0A0Q4KFL8      ------------------------------LDESQRQLVGYASQERII-----NLPAQSN
A0A2U9NDY5      ------------------------------LEKAEAALHDYQTSAKAV-----DSSSET-
A0A2J4YQQ6      ------------------------------LDQAEDKLNQYRRQSDSV-----DLSLEA-
A0A0Q4IGG1      ------------------------------LDDSQRQLVAYASAQQII-----NLPAQGA
A0A3M1CJM3      ------------------------------MEQAEYQLYEYKRKQHIL-----SVSLEDR
A0A2R7SVD4      ------------------------------LAKASDALNAYQTHGKTV-----NISLET-
A0A3C0PWB6      ------------------------------LEKAEAALHDYQTSSKSV-----DISIET-
V4Q8B7          ------------------------------LEKAEAALNAYQTSSKSV-----DISIET-
A0A0Q8XKK5      ------------------------------LETSERDLVNYAAEKGIT-----ALGTSKS
A0A2E0Q2W0      ------------------------------LEXSEAALISXANEXGIV-----VLQRGAS
A0A142W0R3      ------------------------------LEDSERELITYAANNDII-----TLETRSD
A0A0S4XR18      ------------------------------LSKSQLEIKDFKQSNTVA-----TIPNSA-
A0A2E0GW64      ------------------------------LNHSEKQLNDYRSQSNIL-----DISAES-
A0A3S1IBR2      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A3S3EAI9      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A3S1P7J5      ------------------------------------------------------------
W7Q8F9          ------------------------------LTAAEERLNSYRAELDSV-----DLSSEA-
A0A3M2BE89      ------------------------------LETSESRLNDYRLQRGSV-----DVGLEA-
A0A257G674      ------------------------------LEKSERELNAYARQAGLI-----RDRNPSN
A0A1I1UM01      ----------------------------------QERLARREAEAEAE-----RQREEA-
Q44573          ------------------------------WLDAVQKANTFDNVHGLT-----NTSEGST
A0A167IR75      ------------------------------LDESQRQLVAYASDQEIV-----NLPSEGG
A2W025          ------------------------------LERAEAALTQYQRTSGSI-----NASDEA-
A0A350DWX8      ------------------------------LEDTERQLVAYAGDQEII-----TLSDAET
V4J283          ------------------------------LEAAESAYNDYLREHGTI-----DITRET-
A0A0Q4UFQ5      ------------------------------IDESERALVNYASQQNIV-----NIPGSTD
A0A432EMV7      QWLLSNLDSL--------------------REKLSQSEARLREYKDKE-----GLVDSES
A0A166Y9U5      ------------------------------LNESQRQLVGYASNQEII-----NLPAAGA
A0A318KWA2      ALEAPAEAEF--------------------TLVKHRRASAIRDLGDRL-----SVAEVGV
A0A1H3KC95      PSAPEERHDV--------------------PSTPRATEPTVANTGDAS-----APPDTGP
A0A0B3RZC9      RAELEELARA--------------------EALRRVMAARARREAEAR-----KAAERA-
A0A2E9HXF7      KAEFEERAQT--------------------EALRRVKAAREQRAADAM-----KAREDA-
A0A2K8U7M6      ASVPARAFLD--------------------ERLRAAQAALADAERRLA-----AYADEH-
A0A238KJM1      A----------------------------------------EREAELR-----RIALERI
A0A3A0FJZ4      PAAGREGALR--------------------KHLELEVVDGASPEAAVV-----RIAFRSP
W4HJV8          TSDEPDRGAL--------------------AESEAPPPASVETGVPAG-----RVNATSL
A0A0P1GDI0      EADARAKAEAEARAAAEERARIEAEAEQRRERARRAREALARQAAEKQ-----RLAEEQA
A0A2R8ATV5      AAAARRRAEE--------------------RRAAEEQARQAAEAAEER-----AQAKAAA
A0A1U7D3R6      A--------A--------------------RRAERAREAMAQRKAEEA-----RLAEEQ-
A0A2D4UVV2      P--------A--------------------RRAERAREAMAQRKAEEA-----RLAEEQ-
A0A0W7WHP4      EEQAKRDAEA--------------------Q-----RAADAKRAADAK-----RAAEEQ-
A0A238J8F6      ALEAQKMAAE--------------------EARQKAFAEERAREAERV-----KAAEQAE
A0A238JQI6      A-EFERIARE--------------------EALRRVAAARARREAEAR-----QKAEAEA
A0A222E077      A-EFEERAQT--------------------EALRRVKAAREQRAADAM-----KAREDA-
A0A239E3Y2      A-EFEERAQV--------------------EALRRVKAAREQRAADAL-----KASEDA-
A0A0H6V1F7      ------------------------------------------------------------
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A383M853      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A447YBN8      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A3S2K5U0      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A354VPS3      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1E3DAN4      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
E8RBB2          ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A435ZMC2      ------------------------------------------------------------
A0A3S1X1N3      ------------------------------------------------------------
A0A434B8G6      ------------------------------------------------------------
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A1E2ZGQ8      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
A0A2R7TMW6      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1B9Z0F1      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
A0A1E2UHX3      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      IKAALKKGAKLEDIQKHRDWIELRGYFRAAIESFANFETGIITIRIRTRHKDTSFNLAHV
A0A2D5LFD8      NSSSSNNSQSANTNFQN---LALNSISNDLPTL-ISV-MRSPLILSPIA-ESFDLSELQL
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      LTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A3M5YLE8      LTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A3M3RP89      LTAGQPGQFSLYDDEHS---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A0P9QIY7      LTAGQPGQFSLYDDERR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A0P9VVH7      LTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A0Q0FJK6      LTAGQPGQFSLYDDERR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A0Q0G2J0      LTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A3M3LF66      LTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A0P9WIR8      LTAGQPGQFSLYDDERR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A3M3KPE5      LTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A3M4C263      LTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A3M5AD05      LTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRT
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0Q0D3D2      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A0P9R9W0      LTAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-TNFSLSRQRT
A0A0Q0B9T0      LTAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-TNFSLSRQRT
A0A3M6CFI7      LTAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-TNFSLSRQRT
A0A0P9JXN0      LTAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-TNFSLSRQRT
A0A3M6FIV7      LTAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-TNFSLSRQRT
A0A3M4ENY1      LTAGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A3M5EZK7      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-QGIKIQVATLQARPG-TDFTVSRQRT
A0A0P9SPP5      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVAALRARPG-TDFSVSRQRT
A0A3M5DM48      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-TDFSVSRQRT
A0A3M3NNF2      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0P9NNS0      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQHT
A0A3M6AI26      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQHT
A0A3M4WA51      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A3M4A0E8      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A3M4GLF4      LTAGKPGQFSLYDNEHN---LLLGGILNRVVEG-NGVKIQVATLRARPG-TDFSVSRQRT
A0A3M4PBZ2      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A0P9IWP8      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A0Q0B3J8      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M5M873      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A0P9VHH8      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A0P9YV98      LIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M3G2W8      LIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M6C224      LIAGKPGQFSLYDNEHK---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0P9PWZ3      LIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M5K254      LIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0P9KZ49      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0P9PS59      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-TDFSVSRQRT
A0A0P9V840      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0Q0AIE5      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M2ZQH6      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0N8SQG2      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0W8HFU1      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M5JFB0      LIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M3TQV3      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A3M3EF92      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A3M5J1E2      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A3M5G7H9      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M4A376      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A0Q0A5T8      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0P9SCD7      LIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0P9T4G3      LIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0P9VKB0      LIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0Q0BM35      LIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M3TPR7      LIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M3U4Q3      LIAGKPGQLSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0P9UCX7      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARHG-TDFSVSRQRT
A0A0P9S1F1      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-TDFSVSRQRT
A0A0P9QCJ2      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A0P9Q329      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-TDFSVSRQRT
A0A3M5GJ64      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-TDFSVSRQRT
A0A0P9MPC7      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M2XYQ3      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A0P9XCE1      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A3M3EFX7      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A3M5B9D9      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-QGIKIQVATLQARPG-TDFTVSRQRT
A0A0P9RRZ3      LTAGKPGQFSLYDNEHN---LLLGGAVNRVVEG-KGIKIQVATLQARPG-TDFTVSRQRT
A0A3M2VEK7      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A0N8R9B3      LTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A0P9VA27      LTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A3M4YBJ4      LTSGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A0P9J470      LTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A0Q0EVJ8      LTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A3M5UI30      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M5YQT8      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M5F5X1      LTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRT
A0A3M5R8G1      LIAGKPGQLSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M5V012      LIAGKPGQLSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M3GA16      LIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRT
A0A3M3CJL0      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A3M3F6F5      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A3M3P9B7      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A0N8QB74      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A0Q0AUD0      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A3M5VR55      LTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A0Q0FK97      LTAGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-TDFTISRQRT
A0A3M3UCT3      LTAGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A3M5XGQ7      LTAGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A3M5KZ75      LTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A3M5L3G5      LTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRT
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
K0XBA5          ------------------------------------------------------------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2A5PQG0      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A3S4JGG5      --------------------MPEVRSSLDSAED-KLNRFRQANDSVDLS-----------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      -----------------------MRNDLDLAED-KLNEYRRKSDSVDLS-----------
A0A376RY66      ---------------------------MDVAEN-KLNAFRQDKDSVDLP-----------
A0A377K431      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A0T9WT26      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A0K9JYB4      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A2D9ABL7      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A062ME93      ------------------------------------LEKLKIELQQKQAELSAKYTNDHP
A0A3A3BFE8      ---------------------DVTKESELYLTQSITLETKKAELEQKQAEMAAKYTAEHP
A0A0L0M4Q4      ------------------------------------------------------------
A0A2T4ZJZ6      ---------------------------QNTLTGVVEMKTQITLLQQKRDELRQKFTESHP
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      -----------------------------------------REELDSELEIAQLAKRYGP
A0A2G9ZR82      ------------------------------------------------------------
A0A0A8J8L3      ---------------------DLSMEAKTVLDQIVNVDNQLNELTFREAEVSQLYTKEHP
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ---------------------DLNLEAKAVLEQIVNVDNQLNELTFREAEISQLYKKDHP
D8EEU7          -----------------------------------------------------MYKKDHP
A0A376QQZ0      ---------------------------KSALDSALQVEEKLNELTFKEVEIQQLYTRNHP
A0A0P1H2H0      -------------------------------------------MVEQSKKVLRQKRQARR
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ----------------------------------MAVTTQLNGLRFEEAELSKRYTSAHP
A0A380AQW6      -----------------------------MLDTQVQLEGQLNELTFKEAEISKLYTRVHP
A0A3C2DSE7      ----------------------------------------QADRAHARSRVEELSRRYGD
A0A0N0M5F7      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A3E0WKI3      -----------------------------MLNQVVEVEQRLAEMDLERSQLRMSYASQHP
A0A1H3I2J1      ---------------------------RDTLADSFDALDALDAQPLALEDELRSPERDET
A0A1V5DJV0      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A436B5W5      ----------------------VTGDDKSLIGSNIEALNTALATAIQERLDAGRVVDQIE
A0A3S2AQS7      ------------------------------------------------------------
A0A3S2FP30      ---------------------------------------------------------RIE
A0A436NMQ4      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ---------------------------PAILASRLSAVNDALNAAVQDRLELGLIVQQIT
A0A2N3D2J1      ---------------------------------------TAYANARSKRLEAEQRWQQAR
A0A2N2GVE1      IQSTT----------------------GLILSRSNSVETLDGMARELRAKIQQVRRMRTT
A0A2N2INV3      IQSTT----------------------GLILSRSNAVETLDGMARELRAKIQQVRRMRTT
A0A1Y5DXG5      ---------------------------QGVLEQIVELDTKLQELDLERLAMSRKFKRNHP
A0A0B8P2H5      ---------------------------QSTLKVMVELEAQLNELTFKESELAQRFTKQHP
A0A2G2GD62      ---------------------------AMVSKNVEKIGTEISSLSSEESILENLKEYIDE
A0A1M7HC79      ---------------------------QATIQQFIALEQQLNELEFQEAEMAQRFTPRHP
A0A1D3JZN6      ---------------------------KAVLDQVVALDTGISELKLQQAEMDRKFTRQHP
A0A1V6ESG1      -------------------------------MINQTFTDYSAALSKAEQERVKAESQYRE
A0A328C2K5      ---------------------------EGLASVSEQHREVQARLFAEEALLNQLENMESS
A0A3D8MRR7      ---------------------------EGLAAVSTQLRDVQARLFAEEALLNQLETMESR
A0A437R5U4      ---------------------------EGLAAVSTQLRDVQARLFAEEALLNQLETMESR
A0A1H7YHK3      ---------------------------KGLLEQQVAVETSIQQLHMQQAEMDRSFTREHP
A0A0P1FRV5      --------------------------------------------MVEQSKRFRRGMRQRP
A0A3M0ZZ99      ------------------------------------------------------------
A0A0H4KZM1      -----------------------------------------MEKRWTRKKRASREAGGPA
A0A090R136      ---------------------------KSTLDMMVKIESQLNELTFKESEISQRFTKEHP
A0A2E2T3V8      ---------------------------LERIYDLNAELDTAFQEREAARMLFEKRQAVKS
A0A367UAB4      ---------------------------LERIYDLNAELDTAFQEKEAARMLFEKRQAVKS
A0A377V641      ---------------------------KSVLDQIVNVDNQLNELTFRESEISQLYTKEHP
A0A1F2YJ88      ---------------------------ELFLTQSVTLETQKAQLEQQVAEAGAKYTAEHP
A0A0J7XGZ1      ---------------------------QEVSELNRQIADAQAQLAEQRGKLGAAQAQIAR
I4CBA7          --------------------------LLDDEPELESSLLETAGKTFLDIRNERLNLETLT
A3VE95          ---------------------------TQQLGNLSSQLVVARSERVTAEAQYEQLRNLLE
A0A154VE85      TQVNA----------------------QLVAARGSRTEAEARAAQARRLIGQGSNTGTNT
A0A1G0NL95      ---------------------------QGRLTRLLEVDKQITELRQKRDETAQQFAPGHP
A0A024KA69      ------------------------------------------------------------
A0A168QTU8      ---------------------------KSVLDQVVNVENQLNELTFREAEISQLFKKSHP
A0A0L1KFN4      GDGSTT---------------------QERSIVVDNLAALNAALNEATADRIAAEARFRQ
A0A3T9EHW9      --------------------------------------------------------KVHP
A0A377LY04      ---------------------------KSVLDSMVNIDAQLNELTFKEAEISKLYTKRHP
A0A2T1MXF1      ---------------------------KAVLDSMVNIDAQLNELTFKEAEISKLYTKVHP
A0A2X3K9R3      ---------------------------KAVLDSMVNIDAQLNELTFKEAEISKLFTKAHP
A0A1M7BLL7      ----------------------------------------LSRYEAHMRRRAARRDALEN
A0A358L616      ---------------------------KSALDSSVSVQSQLNELTFREAEVSQLFTKDHP
A0A3D5UYX7      -------------------------------ELNAQLILARASLAEAQAKYNRARQLRAQ
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ---------------------------QSVLDRIVDLEKQISEQNLKRTEMERRFTRQHP
A0A3C0PZN1      ---------------------------QSVLDRIVDLEKQISEQNLKRTEMERRFTRQHP
A0A3S1NQ09      LSD------------------------LNAQLIVAQADTARASARYQQYKAIVDSGSENA
A0A443GJ52      LGD------------------------LNGQLIEAQADTARASARYQQYKSIVESGSDNA
A0A3A0FZC0      ------------------------AVNKDENITAQKMSQLNRLLTDATAKRIEAENLYKE
A0A1N7JVZ7      AEADEEKPSVPPTASEPDAPNSSGPGADTRSDAATAPDAPLVLQDTQRADAPEPAPKEAD
A0A091C4A8      ---------------------------SSLSTQSLSELNSTLAAAQDQRIRAEARWKHAE
A0A435LQD4      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      --------------------------------------NTALATAIQERLDAGRMVDQID
A0A2W6S588      ---------------------------DPNATLPDNELSNIGVQLSDARGAAAQAETRSA
A0A444I5K6      ISD------------------------QQLSEINTQLINAQAETAKAEARYARVKSIIDA
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A3C1S9Y1      EKITA----------------------EKLAKLNNQVVEFESKRVETETRYQQALALEKT
A0A353EH49      ---------------------------TGLLTEMSHLGAAILELEQERKELRNLYKPEHS
A0A1Y1Q9C1      ---------------------------NSQSSQERKLDELYSALGEAERARIQAESQMIQ
A0A3M7LJH0      ---------------------------KSTLEVMVKLEAQLNELTFKESEVSQRFTTDHP
A0A316KRG4      -----------------------------------------PDFAGDRASKPEPAAPAPR
A0A1E4JHX8      TRDGPT---------------------VERSIVADDLASLNAELSAAKGEMVRAHSRVTE
M2U8P2          -----------------------------------TAAQQILSQLGAELAQAEAEQAVAE
A0A1H7KZF8      QRTD-----------------------ATLTSDTLDRVNQQLSDAAQRRIRAQADWRAVA
A0A0J5Q9T7      ---------------------------QARRTAERIRANAAQSIVEEQTQRRADAQAKAQ
A0A3D3VHV9      ---------------------------QAVLDQVVELDTSISELQLKRSEMERRFTRQHP
A0A257NG76      ---------------------------QSVLKGVVEIQTQITLLQQKRDELRQKFTESHP
A0A1T4TW59      LAG------------------------TELTNLTIRVSEAKERRVAAEAIYSLLQSSGSS
A0A1Q3MB35      ESGR-----------------------TDTAETLVSNDLKVLNGALADATRARITAESTV
A0A1I5YYQ0      ---------------------------AAPPAALESGEARDKPRTFRRKNPPRRTPEAQR
A0A259LUN7      TE-------------------------QQIAYLTSQRSELQIELDRARARYEAMRRQIDS
A0A2D7AVL1      -------------------------NSSIFSLDGETIVTLNKELATAESERIAAYQKYIE
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ---------------------------KSVLDQIVNVDNQLNELTFKESEISQLYTQEHP
A0A2G2CXY6      ---------------------------QAILDQIVELDTMISELNLRRAEMERRFTREHP
A0A3M1D4H3      TT-------------------------SAANKLVARLQDDLTNLRQKRANELTDKTPEHP
A0A447B6K7      ---------------------------KTVLDQIVNVDNQLNELTFREAEISQLYTKEHP
A0A1J5ICP0      ATL------------------------QQLMNFDTELKQAEGLRKQAEFIAENIMQSDGM
A0A0M3GBT1      ---------------------------DERLKSLIELTGREGKIEETRVEVKAVISTLEA
B3Q577          ---------------------------DERLKSLIELTGREGKIEETRVEVKAVISTLEA
A0A379B9V4      ---------------------------KATLDTIIQIEADLSELSIQESEISRKFTLKHP
A0A1A7QJ97      GA-------------------------QERPIVADNLAALNSALSEAIADRIAAESRFRQ
A0A0Q6TS97      ASTSGAAV-------------------GGRSLLTDDLIALNSALEVATAERIVAESRLNE
A0A0Q6UYB4      ASTSGAAV-------------------GGRSLLTDDLIALNSALEVATAERIVAESRLNE
W7Q5J0          ---------------------------QAAVQRYIDIERRINELEFQEAELAQRYTTSHP
A0A087LTV7      ---------------------------ASEPVLASAARALGLAGEQAPDWLGSRVKVQRE
A0A0G9MZA5      DGDSA---------------------GTASQTLVATELAAFNSALQQATTQRIAAEAALA
H0T8B0          ASEVE-----------------LDKLAKELAKSRAETIQAQAKLEQITHVLVQRSKSQDF
A0A351CXR4      ---------------------------SLESSTENRLVQLSEALQLAKEDYARLAQRYGP
A0A2N6GLF5      LTA------------------------QQLQDLGGQLVMAEQRRATAESSLRQINALKGQ
A0A1W9LJP0      ENITA----------------------EKLAKLNAQVVESESQRVEAETRYRQALAAQNS
A0A0W1ICB0      EDGRT---------------------RTTQTLASSDLEQLNRLLVQATAERAEAESKLSA
A0A2E0UL88      ---------------------------KITETADPMIQQLAREKAQVDLEIQKAEFGRDN
A0A233IKJ2      LASQE----------------------LEELTSQLNKTRDRRVAAETLYLVAQTYSRQDS
A0A2T1JE00      LASQE----------------------LEELTSQLNKTRDRRVAAETLYLVAQTYSRQDS
A0A0T2QIS1      PDG------------------------RTLVDRTLTSSDLEALNTALAQATAERVAAESR
A0A376KYN0      ----------------------------------MNVDNQLNELTFREAEISQLYKKDHP
A0A2X1JB05      ---------------------------KAVLEQIVNVDNQLNELTFREAEISQLYKKDHP
A0A376RML0      ---------------------------KAVLEQIVNVDNQLNELTFREAEISQLYKKDHP
A0A377E5P7      ---------------------------KAVLEQIVNVDNQLNELTFREAEISQLYKKDHP
A0A0P7Y1D0      TE-------------------------QQISDLNAQLAIQRAELSAAESSLRNVQTQLER
A0A2M7JRZ7      ---------------------------ENVTMQRLTELNEVLTKAESERMAKEALYRQTK
X7F6S5          ----------------------------------------SAAAEEARARDGQAAEAERA
A0A1P8USW9      RKAQE----------------------DDARRKAEAKRKAEDARRAAERLEAVQRQRAEA
A0A1G7CFZ2      -------------------------------RRAEAERVAEAARLQQQVEKEARRQREAE
A0A2E1D962      -------------------------------RRA--------------------------
A0A1I6U4V1      -------------------------------------------------DREAEEARAAE
A0A1G8NKI0      -------------------------------------------------QREAEADAEDQ
A0A355QPE4      -------------------------------------------------QREAEAAAEDQ
A0A357RN98      -------------------------------------------------QREAEAAAEDQ
A0A3B8T2U6      ------------------------GLASEELQRYTALFVDAQNNLARVRSIFEQVNGQES
Z2EKW7          -----------------------DIYANELEELNRKLNTAVNKRIEAQTLIQLLKRKSSQ
A0A365PWR2      ---------------------------EGYLNQLVALDSKISALRLQQTELASRFTSEHP
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ---------------------------QSVIAQLIDVEKKLSEVEFQEAEMAQRFTRNHP
A0A0Q4Q524      GDGTT----------------------SERSIVADDLASLNTALSQATAERIAAEARYRE
A0A0Q4CFJ9      ADGST----------------------AERSIVADDLASLNTALSQATAERIAAESRYRE
A0A0Q4FE58      ADGST----------------------SERSIVADDLASLNTALSQATAERIAVEARYRE
A0A0Q4JWC8      ADGST----------------------SERSIVADDLASLNTALSQATAERIAVEARYRE
A0A0Q4KFL8      ADGST----------------------SERSIVADDLASLNTALSQATAERIAVEARYRE
A0A2U9NDY5      ---------------------------KGVRDQSVQRETQLAERARKRVEDDRRYTREHP
A0A2J4YQQ6      ---------------------------KSVLDQIVNVDNQLNELTFRESEISQLYTKEHP
A0A0Q4IGG1      GSGGS--------------------TTVERSIVADDLAALNATLSQATAERIQAQARAQQ
A0A3M1CJM3      QNIIS----------------------QRLQDLNQTLNKVQAERIALEARRQKILDIKEH
A0A2R7SVD4      ---------------------------QSVLGQSVALETRISELKMQQAEMDRKFTSQHP
A0A3C0PWB6      ---------------------------KGVLDQIVQLETQLSELTLKRVDYDRLYTREHP
V4Q8B7          ---------------------------KGVLDQIVALETQISELSLKRVEYDRLYTREHP
A0A0Q8XKK5      ADGRT-----------------------EVERTLVSSDLEALNAALASATADRLAAESRS
A0A2E0Q2W0      GDSEG-----------------------------GGQQTLVETRLSQLNEALAEATARRI
A0A142W0R3      PGTGR-----------------------TIGDRTLVAADVEKISTALSVARDARIAAESQ
A0A0S4XR18      -------------------------------STLLNAMVDIDTQLQQANMKLSVLEGLIR
A0A2E0GW64      ---------------------------KMMLTQLVKSQNDLEALKLEKTQLQQGFTEKHP
A0A3S1IBR2      -------------------------------LIVAQADTARASARYQQYKAIVDSGSENA
A0A3S1NZ06      -------------------------------LIVAQADTARASARYQQYKSIVDSGSENA
A0A434DUT4      ------------------------------------------------------------
A0A3S3EAI9      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A3S1P7J5      ------------------------------------------------------------
W7Q8F9          ---------------------------QAAVQRYIDIERRINELEFQEAEMAQRYTHSHP
A0A3M2BE89      ---------------------------EALLDQSAKLEQQISELKLKKLELRRRFTDNHP
A0A257G674      TIDKG-------------------STSGSVTTASLLQVNTAANQAQATRIAAQQRWNLVS
A0A1I1UM01      ---------------------------RQQAEEDARRQAQEDRLRAEEEARRQAEQDRQR
Q44573          STPLI----------------------ERQIADTSANLSQAEGRLAAAQARADALQDAAA
A0A167IR75      NDGTN---------------------TQERPIVVDNLASLNAALNEATADRIAAEARFRR
A2W025          ---------------------------KVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHP
A0A350DWX8      GAGRS------------------------LVSTSLGTLNEALSEARVDRIAAEERWRQAQ
V4J283          ---------------------------ENVLTSIMEIENELFTLQQERETLRSRFKPTHP
A0A0Q4UFQ5      SNGQT------------------------TGERSLVVDDLANLNRELAQATAERVAAESR
A0A432EMV7      FAAQT---------------------SDKLGELTSELVKAKAKRAEAEVLFKQVKAAEKR
A0A166Y9U5      ADGSS---------------------TQERSIVADDLATLNAALNEAKADRIAAEARFQQ
A0A318KWA2      GRGTSTGMLRLTLTGPDRDEIRRSLDAVAETFLTQNVRRQSAEIEQS-LAFLEEQAPELR
A0A1H3KC95      SREAF----------------------DAQLPKAAGKAEAHPTPPDMEPAPAASPASGAR
A0A0B3RZC9      ---------------------------EAEAALQAEKEAEERRIQAERA-----------
A0A2E9HXF7      ---------------------------ERQESARQHREAEEARSRQEAAAKAAQDAEDHR
A0A2K8U7M6      ------------------------RIIDLDGQRTLLLERLKALGRQETAAFAAQLAAQTE
A0A238KJM1      AARKE-----------------------------REAEKQIATERAQAEAEARKAEDDTK
A0A3A0FJZ4      DRALA-----------------LGVVRASAEQLIAEREAERASQAQATEALLASQLRDLQ
W4HJV8          SSDSD---------------------SDSDSDSDSDSDSDSDSPEEDRSPEQATALAASD
A0A0P1GDI0      KAEAEEKARLAAEAEAQAEAARLAKLAEERAAEAKRKQAELAAQRKA-EAEAAERAEKQR
A0A2R8ATV5      LARQK---------------------AEAIKRAKAEEAEEQARLKAE-AAKRAQAEEAAR
A0A1U7D3R6      --RQA---------------------AAQREAERLRLEQTRAAEEAE-AARRAEDAERAR
A0A2D4UVV2      --RQA---------------------AAQREAERLRLEQTRAAEEAE-AARRAEDAERAR
A0A0W7WHP4      ----------------------------------ARREAEEQARREA-AEHARREEQAQR
A0A238J8F6      KDRQR---------------------VEAE----KRRQAEIEAQRQA-ELAAREKAEAVR
A0A238JQI6      AEKAR---------------------TEAEDAARKAEEARLAEERRK-AEDAARKAEEAR
A0A222E077      ---------------------------ERQESARQHREAEEARSRQEAAAKAAQDAEDHR
A0A239E3Y2      ---------------------------ERQERERQHREAEEARTRQE-ATKAAQDAAEIR
A0A0H6V1F7      ------------------------------------------------------------
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A383M853      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A447YBN8      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A3S2K5U0      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A354VPS3      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1E3DAN4      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
E8RBB2          ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A435ZMC2      ------------------------------------------------------------
A0A3S1X1N3      ------------------------------------------------------------
A0A434B8G6      ------------------------------------------------------------
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A1E2ZGQ8      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
A0A2R7TMW6      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1B9Z0F1      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
A0A1E2UHX3      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      ASEALVDRNFERLKEKVYRLKDFVGRQTSERKKILEDLEQHRVELQRKHEVGNTQEYRRE
A0A2D5LFD8      AGRITI--TPVGEGR--------TGQGAGILNVKLKGKDPDNDK--ILLDQLADVYLEIA
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ---------RLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A3M5YLE8      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A3M3RP89      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A0P9QIY7      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A0P9VVH7      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A0Q0FJK6      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A0Q0G2J0      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A3M3LF66      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A0P9WIR8      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A3M3KPE5      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A3M4C263      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A3M5AD05      FSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQN
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0Q0D3D2      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQEAQRAN--RILDEVSHIYVRQN
A0A0P9R9W0      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILDEVSHLYVRQN
A0A0Q0B9T0      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILDEVSHLYVRQN
A0A3M6CFI7      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILDEVSHLYVRQN
A0A0P9JXN0      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M6FIV7      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M4ENY1      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M5EZK7      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9SPP5      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M5DM48      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M3NNF2      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQN
A0A0P9NNS0      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M6AI26      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M4WA51      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M4A0E8      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M4GLF4      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M4PBZ2      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9IWP8      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQEAQRAN--RILDEVSHIYVRQN
A0A0Q0B3J8      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--QILDEVSHLYVRQN
A0A3M5M873      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9VHH8      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQEAQRAN--RILDEVSHLYVRQN
A0A0P9YV98      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M3G2W8      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M6C224      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9PWZ3      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--QILDEVSHLYVRQN
A0A3M5K254      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--QILDEVSHLYVRQN
A0A0P9KZ49      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9PS59      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9V840      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQN
A0A0Q0AIE5      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQN
A0A3M2ZQH6      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQN
A0A0N8SQG2      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQN
A0A0W8HFU1      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQN
A0A3M5JFB0      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--QILDEVSHLYVRQN
A0A3M3TQV3      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M3EF92      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILDEVSHLYVRQN
A0A3M5J1E2      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILDEVSHLYVRQN
A0A3M5G7H9      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M4A376      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0Q0A5T8      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9SCD7      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9T4G3      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9VKB0      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0Q0BM35      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M3TPR7      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M3U4Q3      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9UCX7      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9S1F1      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9QCJ2      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9Q329      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M5GJ64      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9MPC7      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M2XYQ3      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9XCE1      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M3EFX7      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M5B9D9      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9RRZ3      LSTALLYQNRLKIIE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M2VEK7      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0N8R9B3      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9VA27      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M4YBJ4      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0P9J470      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0Q0EVJ8      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M5UI30      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQN
A0A3M5YQT8      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--QILDEVSHLYVRQN
A0A3M5F5X1      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M5R8G1      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M5V012      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M3GA16      LSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M3CJL0      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M3F6F5      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M3P9B7      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0N8QB74      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0Q0AUD0      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M5VR55      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0Q0FK97      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M3UCT3      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M5XGQ7      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M5KZ75      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A3M5L3G5      LSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQN
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
K0XBA5          ------------------------------------------------------------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2A5PQG0      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A0T9WT26      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A0K9JYB4      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A2D9ABL7      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A1F9E324      -------------------------------MKLSENYKSEYPEMK--------------
A0A062ME93      LIRQIDAQIAEINKKIADLNNRLTQLPETQR-----------------------------
A0A3A3BFE8      AMREINGQLTAVNKQISELNSTLKQLPDIQR-----------------------------
A0A0L0M4Q4      ------------------------------------------------------------
A0A2T4ZJZ6      NVIAVDKQIARLQSQLQSHNQMIKTLPATQQ-----------------------------
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      KHPKMIAAKAAHQARISRMKKEVDIVLNN-------------------------------
A0A2G9ZR82      ----------------THLKNEYAKLYAKYEEMSTT-FHDAYPPVN--------------
A0A0A8J8L3      TYKALMEKQQTLQTEKIKLNKKVSAMPSTQQ-----------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      TYRALLEKRQTLEQERKRLNKRVSAMPSTQQ-----------------------------
D8EEU7          TYRALLEKRQTLEQERKRLNKRVSAMPSTQQ-----------------------------
A0A376QQZ0      AYQSLLDKRQQLLREKEKISKAIQKLPNTQQ-----------------------------
A0A0P1H2H0      AARAARAAEGTQANVMADVEAPAPVKDDAPQATGFLGLSGR-------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      IYRALDEKRKTLLANKAALELKINAMPKTQQ-----------------------------
A0A380AQW6      AYRALLEKRATLEAEKARLGKQVQSLPKTQQ-----------------------------
A0A3C2DSE7      RYPAMQSARSDLNAATASLRQQVEQVVAS-------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A3E0WKI3      NIIALDEQMERLRERRREFDSRIRELPQSQQ-----------------------------
A0A1H3I2J1      EHDTQDHQPELQDEDDAAFDALLAEFEASDDHD---------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A436B5W5      KGRGSSLGPVLESEGLQKLSDKLADLTSQYQQKLGI-LKPGFPEMQ--------------
A0A3S2AQS7      ------------------------------------------------------------
A0A3S2FP30      KGRGSSLGPVLESEGLQKLSEKLADLTSQYQQKLGI-LKPGFPEMQ--------------
A0A436NMQ4      -------------------------LTSQYQQKLGI-LKPGFPEMQ--------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      EGKAPSLSAVLESQAIEGLKQRLATLRADYQDKLSI-YKPDFPEMV--------------
A0A2N3D2J1      GSAIFSLPDVLNNGTIQQLTQRRAQLQAEYQEKGRL-FRSDYPVMV--------------
A0A2N2GVE1      DPTLDPSADFLNKPAIVSLRSRYHSAQEKLKEVQVE-VMERHEEVI--------------
A0A2N2INV3      DPTLDPSADFLNKPTIVSLRSRYHAAQEKLKEVQVE-VMERHEEVI--------------
A0A1Y5DXG5      NYQGIVEQISAVQKQRDALAQKIANLPETQQ-----------------------------
A0A0B8P2H5      AYVAVLEKRKTLEAQKRRLEGQIKQLPKTQR-----------------------------
A0A2G2GD62      NDDLTGLTVQSLETTATNLNELIINYQTALTNRRSM-----LVSVT--------------
A0A1M7HC79      NYKTLQRKKRQLQQERAELNERVNQLPAEQQ-----------------------------
A0A1D3JZN6      AYRALLAKLDELTGKQAQLTKRIEGLPSTQQ-----------------------------
A0A1V6ESG1      MERSPENSAQVLENKTVQTIKEQKAKLEAEYLVNLGTYKPDFPKML--------------
A0A328C2K5      GEDLRALGDLVDSPALKRGLDRESELLERRAELTTR-YLDEYPEVR--------------
A0A3D8MRR7      GDDLRALGDLVDNPALKRGLDRESELLERRAELKTR-YLDAHPEVR--------------
A0A437R5U4      GDDLRALGDLVDNPALKRGLDRESELLERRAELKTR-YLDAHPEVR--------------
A0A1H7YHK3      AYRALMKQIGELESRKAGFNKQVGELPDTQQ-----------------------------
A0A0P1FRV5      AKAPEEAPVDPPVEASVEVPAEVTDAAPVQRRGLLS------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A0H4KZM1      PKPALTGPIHLAPERETPLEPEELTPPETPTTADVR------------------------
A0A090R136      AYIALLDKKSVLISERKKINKQVQDLPKTQR-----------------------------
A0A2E2T3V8      SEELLALPDIAKDDQVRDLQVKYEVLQQNYAELEQR-YQPAHPSMV--------------
A0A367UAB4      SEELLALPDIAKDDQVRDLQVKYEVLQQNYAELEQR-YQPAHPSMV--------------
A0A377V641      TYKALMEKRKTLQDERGKLNKRVATMPETQQ-----------------------------
A0A1F2YJ88      VMQQMNAQLGAINKKIGELNSTLKELPDLQR-----------------------------
A0A0J7XGZ1      GGGGADIGSALASDTIRQLRQQEAQASARLAQLDAR-YGALHPDVV--------------
I4CBA7          LHKQMILPKYIDNEFLSTLKKNSAALKADYVSAASV-LGSGHFQHS--------------
A3VE95          NQGLDALAKAVTSPLLERLNQDKLALERQDAQWGAS-FGPDHPQRV--------------
A0A154VE85      GGGLETAAAVLNADLVRELRLQEAALQRRIAELRVE-YRDDHPRLQ--------------
A0A1G0NL95      RMLALAQQEARLQTAARSLNDWVKKLPETQR-----------------------------
A0A024KA69      ------------------------------------------------------------
A0A168QTU8      TYRALHEKRQTLERERERLNNRVSAMPSTQQ-----------------------------
A0A0L1KFN4      AGGSGSSAEALSNYAINNLRQKRAELESEYRELMVR-FEPGYPQAQ--------------
A0A3T9EHW9      AYRTLLEKRQALEDEKAKLNGRVTAMPKTQQ-----------------------------
A0A377LY04      AYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQ-----------------------------
A0A2T1MXF1      AYRTLLEKRQALEEEKAKLNGRVTAMPKTQQ-----------------------------
A0A2X3K9R3      AYRTLLEKRQALEDEKSKLNGRVTAMPKTQQ-----------------------------
A0A1M7BLL7      PHSHSPDQEDILSPEADEATQEADEAPFALSPEMIAPPLDEKPLVA--------------
A0A358L616      TYRALLEKRKTLEDEQKKLNHKIGQMPQTQQ-----------------------------
A0A3D5UYX7      GGSVESVADVLASGTISGLRQKQAELAREKANLSAK-YGPRHPAIV--------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      NFQALMNQINQLQMQKEELEKQIGTLPSTQQ-----------------------------
A0A3C0PZN1      NFQALMNQINQLQMQKDQLEKQIDTLPSTQQ-----------------------------
A0A3S1NQ09      FKDAAISSDQPSSSVISALKTRYLTVAKRLQDVEAN-FGPEHPQAV--------------
A0A443GJ52      FRDAAISADQPSNSVISTLKTRYLTVAKRQQDVEAN-FGAEHPQAV--------------
A0A3A0FZC0      AEAALSNPSAGFDDPSTQHMRGELAKLEAEYQQLSAKFTSSYPRMV--------------
A0A1N7JVZ7      PVTPPVAQKPDQTPETHPLPPQAIAPTREPEKPLPTAMPPADTTRD--------------
A0A091C4A8      SASGMGLSAVLGSEIVQALQERRADLQAQYQDKLSI-FKPAFPEMQ--------------
A0A435LQD4      ------------------------------------------------------------
A0A3S1MCW7      --------PVLESAGLQKLSDKLADLTSQYQQKLGI-LKPGFPEMQ--------------
A0A434IGN6      KGRGASLGPVLESEGLQKITDKLADLTSQYQQKLGI-LKPGFPEMQ--------------
A0A2W6S588      ASGSTVISGGVDTTALSTLREQRAEASRDLAGLTSR-YGDRNPQVI--------------
A0A444I5K6      KQTDAIVTDVLDSSISNDLRKKYLEASKLETEIEAR-LGPDHVQAV--------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A3C1S9Y1      PDLLDSIPEVLSNDIIKEIKKMEVNLYNKMSELSKK-YGSNHPQMV--------------
A0A353EH49      VIKALDEKIQLLKIEQRKLEIDADVLPNVQK-----------------------------
A0A1Y1Q9C1      GRKRTNAHAVLNSPVVESLKQNLATLEAEYREKLKL-FKPAFPDMV--------------
A0A3M7LJH0      AYKSLLDKRQVLLGEKERLNQQVQKLPKTQR-----------------------------
A0A316KRG4      KSKIKAIKKHPAPKAAAPVSAKRISADSDSRPEPAR------------------------
A0A1E4JHX8      VGANGAVEEALTNNAITGIRQKRAEVAAEYARLLSQ-FEPEYPEVK--------------
M2U8P2          SRAASPAAAIQSSSLLRELRAREAALSAERADLAGR-YGERHPSLA--------------
A0A1H7KZF8      ARPPLSIPEVIGNAAVQSLVSQSTDVQARLNAAAAR-HGPEHPEVR--------------
A0A0J5Q9T7      APRAAAAAQAVLRAEETQASERLKREATERA-----------------------------
A0A3D3VHV9      SYQALMEQLNQLNSRRNALVDRVGDLPATQQ-----------------------------
A0A257NG76      SVVAIDKQISRLQGQMNSNDKKIEVLPETQQ-----------------------------
A0A1T4TW59      AASLLSVPEISNHPQVRDVKSAEIDAERKVSELAKR-YGPKHDKMI--------------
A0A1Q3MB35      RQTSSASEGSLNNQALNLMRDRRAQYASELASSLAV-FEPEYPQVQ--------------
A0A1I5YYQ0      PAGPPEARPDPADKEPDVPRKTLTEPPVRLEPEMRQ------------------------
A0A259LUN7      GAGVEGVSEVINSALINQLKSQRAEILRRVAELETR-VGDRHPDLI--------------
A0A2D7AVL1      AENSPITLDVLDSPDLKKLREQRFQLDTEYQNKLEI-YRPEYSEMT--------------
A0A3B9KZE9      -----------------------------YQNKLEI-YRPEYSEMT--------------
A0A2U0NMP8      TYKALMEKRKILQDERAKLNKRVSTMPETQQ-----------------------------
A0A2G2CXY6      NYQAMLQQMQQLERQKAALEARVGDLPSTQQ-----------------------------
A0A3M1D4H3      DIQNLDKLIAETEAQLAEALAAQHALDPTVEQ----------------------------
A0A447B6K7      TYKALMEKKQTLQEEKSKLGKRVSSMPATQQ-----------------------------
A0A1J5ICP0      PDKSIVALGASTKSERLNALAQKLSELQSRMITLKINYKEKHPLVV--------------
A0A0M3GBT1      ADSASVAVQNIALPDDITSKQRDLHAQEDDLARLLELYDGNAEAVV--------------
B3Q577          ADSASVAVQNIALPDDITSKQRDLHAQEDDLARLLELYDGNAEAVV--------------
A0A379B9V4      SYVALIDKRNVLNAEKERLNKQLEKLPNTQK-----------------------------
A0A1A7QJ97      AGSAGSTAAALGNTAINNLRQRRAELAADYQQLMVR-FEPGYPAAQ--------------
A0A0Q6TS97      IKRPDASSIALGNDAIASMRQRRADAAAEYAKLMVQ-FRPDYPQAK--------------
A0A0Q6UYB4      IKRPDASSIALGNDAIASMRQRRADAAAEYAKLMVQ-FRPDYPQAK--------------
W7Q5J0          SYQTLLRQKRHLQAEKTQLNNRVNELPTAQQ-----------------------------
A0A087LTV7      GPTYLVSVRANAPSPIEAASYANAVANSFIHEEVAAKIDGVLADVA--------------
A0A0G9MZA5      ARSGANAGSTEASATADALRARRAELQVELAELRSR-FSPSYPPVQ--------------
H0T8B0          DVSSPAVPDALNSPVINGLRDDFLKDKSKEAELSAR-YGTDHQAAV--------------
A0A351CXR4      RHPKMIEAESEIQRTQASLKMGGGQAVSDREKEF--------------------------
A0A2N6GLF5      PVERLASIPAVLSDSLVSSLREAEAEAQRKVSSFSKRYGPKHPKMI--------------
A0A1W9LJP0      PDMLDSISQVLNNPLVQDIKKMEVELYNRMSELSKK-YGAKHPQIT--------------
A0A0W1ICB0      ARAPGATQLGLSNQSLSTLRQRRAEANAAYQELLVQ-FEPEYPQAQ--------------
A0A2E0UL88      ALAARPELEEYSQKSLKDLRARSKELEMRINKLASD---------A--------------
A0A233IKJ2      DLSALASIPEISNHPTIRDVKLAEVQAERKVSELSKRYGDKHPKLK--------------
A0A2T1JE00      DLSALASIPEISNHPTIRDVKLAEVQAERKVSELSKRYGDKHPKLK--------------
A0A0T2QIS1      ARTAGPSELSITNPTIVALRDRRAQAAADYAKLMVQ-FEPGYPAAQ--------------
A0A376KYN0      TYRALLEKRQTLEQERKRLNKRVSAMPSTQQ-----------------------------
A0A2X1JB05      TYRALLEKRQTLEQERKRLNKRVSAMPSTQQ-----------------------------
A0A376RML0      TYRALLEKRQTLEQERKRLNKRVSAMPSTQQ-----------------------------
A0A377E5P7      TYRALLEKRQTLEQERKRLNKRVSAMPSTQQ-----------------------------
A0A0P7Y1D0      GASLDTIGEVLRSETIRALRAQQTDTSRRRSDLTSR-YGPRHPEIL--------------
A0A2M7JRZ7      DKHFDALPSILENKLVMDLKQAYIQLEAQYMKLSET-FKPEYPEMV--------------
X7F6S5          RHAAEAEAETERLRIERDAERARIARELAEAREA--------------------------
A0A1P8USW9      ARRKREAEEQARKQAEDAAREAELRAQQEAAREA--------------------------
A0A1G7CFZ2      RRRTEA------RQAEAAARMAQTTRQTGAEHRV--------------------------
A0A2E1D962      ----EA------RQAEAAGRMAQATRQTGAEHRV--------------------------
A0A1I6U4V1      QRRAEQQRLEDQRLEERRLEEHR-AEMDTARRQL--------------------------
A0A1G8NKI0      RRRAEAAGDQARRQAEAAAQAQADAEAEEQQRQA--------------------------
A0A355QPE4      RRRAEAAGDQARRQAEAAAQAQADAEAEEQRRQA--------------------------
A0A357RN98      RRRAEAAGDQARRQAEAAAQAQADAEAEEQRRQA--------------------------
A0A3B8T2U6      KQDLASLQEVQNHPTVQNVKKQQLNAQSRVSELAKV-YGPRHPKMI--------------
Z2EKW7          NLDSLLSIDEFANQAQIRDLKLSEAQAAKNVSELAQRYGPKHDRMV--------------
A0A365PWR2      AYQTLVNQIESLTLEQQSLARKIGTLPETQQ-----------------------------
A0A2E9H5Z8      ---------KLPGSQVPFLRSRIQESQLNMEAMQASGLGRKHPSME--------------
A0A2E2BR79      AYQALMRQKSFLRNERDRLNARVEKMPAAQQ-----------------------------
A0A0Q4Q524      GGRAGASSEALRNQAINTLRQRRAEFAAEYQKLLIQ-FEPEYPAVK--------------
A0A0Q4CFJ9      GSRAGASSEALRNQAINSLRQRRAEYAAEYQKLLTQ-FEPEYPAAK--------------
A0A0Q4FE58      GGRAGASSEALRNQAINALRQRRAEYAADYQKLLTQ-FEPEYPAAR--------------
A0A0Q4JWC8      GGRAGASSEALRNQAINALRQRRAEYAADYQKLLTQ-FEPEYPAAR--------------
A0A0Q4KFL8      GGRAGASSEALRNQAINALRQRRAEYAADYQKLLTQ-FEPEYPAAR--------------
A0A2U9NDY5      TYRTLMTQMNELQAQKAQLLKKVDALPMTQQ-----------------------------
A0A2J4YQQ6      TYKALMEKRKTLQDERGKLNKRVSSMPETQQ-----------------------------
A0A0Q4IGG1      SGRAGASTEALRNQAINTLRQRRAELAADYQRLMVQ-FEPGYPAAR--------------
A0A3M1CJM3      RLALDAVDKVISNPLIQQLKANYVKLKEEHTELSTK-YLPDHPKMK--------------
A0A2R7SVD4      AYRALMSQIGELTQQQKSLAGKVQDLPATQQ-----------------------------
A0A3C0PWB6      TYRTLMSQMNELQAQKAQLLKKVDALPMTQQ-----------------------------
V4Q8B7          TYRTLITQMNELQAQKAQLLKKVDALPMTQQ-----------------------------
A0A0Q8XKK5      VRQRGASPQALTNPAISSLRQRRAEVASELAKLSVQ-FEPGYPASR--------------
A0A2E0Q2W0      EAEGASRAASVANAGAATIRSRIAXVEATLARLRTT-LGPENSQVE--------------
A0A142W0R3      LSSSVSSTDLSSNAAVSALRQRRAELMADLARLRKI-FGEEYPEIV--------------
A0A0S4XR18      QMKTGNGINFVSIDVLGAPNSSINNIITALQQKNAA-RTALLAEYT--------------
A0A2E0GW64      IVIAINEKIHKQQAALSALESEAKKLPHSDQ-----------------------------
A0A3S1IBR2      FKDAAISSDQPSSSVISALKTRYLTVAKRLQDVEAN-FGPEHPQAV--------------
A0A3S1NZ06      FKDAAISSDQPSSSVIAALKTRYLTVAKRQQDVEAN-FGPQHPQAV--------------
A0A434DUT4      ------------------------------------------------------------
A0A3S3EAI9      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A3S1P7J5      ------------------------------------------------------------
W7Q8F9          SYRTLLRQKRHLQNEKSQLNDRVNELPAAQQ-----------------------------
A0A3M2BE89      VIQSLEDKLGRLQTEQQTLEQRIKALPSTEQ-----------------------------
A0A257G674      RSDPLNSPDVLANPAISQLLSERARVQSELQKQRAN-HLEDYPAVA--------------
A0A1I1UM01      AEAEAQRQAEAERLRVEAETRRRAEEVR--------------------------------
Q44573          RGDARAAVALSQEPILVATANALMQLQSTRQEEAAT-YGPQHPRLR--------------
A0A167IR75      AGGGGSSAEALSNNAINNLRQRRAELNAEYQDLMIR-FEPGYPQAR--------------
A2W025          MVIAAKQQLAELQGEKDKFSNRFRSLPATEV-----------------------------
A0A350DWX8      NAPLTSIPEVMASTTYQTLMQQRIQLESQYEEKAAV-FQDDYPELV--------------
V4J283          KIRSLDGLMATLTGKLRTLEQQTEALPEVQQ-----------------------------
A0A0Q4UFQ5      LNSGGATKEQLDNTANSTLRTKRAELAADYARMLQQ-FDPAYPPAK--------------
A0A432EMV7      GDDYGSLAAVLNNTLIQALKQEQSQLQRKVSELSGR-YLDKHPKMI--------------
A0A166Y9U5      AGNGGSSLEALRNDTINRLRQRRAELAAEYKQLMVR-FEPGYPQAQ--------------
A0A318KWA2      TQLRAAEDSLNEYRAAQHSVDLTSEAQAAIEQFVAL-DSQLNELEF--------------
A0A1H3KC95      RVRLAALPKAELARVLRRVRGQGPAIAAPPQEERP-------------------------
A0A0B3RZC9      -----------------DEERAAEARRKAAEEKAEA-ERLAEEEKR--------------
A0A2E9HXF7      Q--------QVEKRAAEEAARREKAKRDAEARAASA-LRAAETERI--------------
A0A2K8U7M6      ARQAGTDAAATDSPVIQRLQARKAELSADYQQQLKV-FKPGYPKMQ--------------
A0A238KJM1      RLTAEQARLTEEKQVAEAAAA---------------------------------------
A0A3A0FJZ4      AELASQARELDEIELARSGAALGASGDGGEVHTLRS-SALASIQEL--------------
W4HJV8          PSVPTPSAAPENAAPAHDATVPAPNLAYATPDALAS-ETSEEALPA--------------
A0A0P1GDI0      KQAEADRRAQEKAKEAQRQAERAAAQRQAEEAARHK-AKAAAEQQA--------------
A0A2R8ATV5      LQAEAKARAAEDARKQHEAEQAAREEAEAQARAKAL-ADE--------------------
A0A1U7D3R6      L--------ADEARRQQEAEHRAQEQREAEARAAE-------------------------
A0A2D4UVV2      L--------ADEARRQQEAEHRAQEQREAEARAAE-------------------------
A0A0W7WHP4      E--------AQAQRAAEEQAHREAEEQ---------------------------------
A0A238J8F6      R--------AEEARQIAEAEEARQKAEAEEARKKAD-AEKKRLAEE--------------
A0A238JQI6      L--------AEERRKVEDAARKAEEARLAEERRKAE-D----------------------
A0A222E077      Q--------QVEKRAAEEAARREKAKR---------------------------------
A0A239E3Y2      Q--------QAEKRAAKEAARRARAERDAEDR----------------------------
A0A0H6V1F7      ------------------------------------------------------------
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      --------LNEQVPAVRRNLEAAQTALNKYQTGSRSVDITAETQSV--------------
A0A3D2Y902      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A383M853      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A447YBN8      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A3S2K5U0      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A354VPS3      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1E3DAN4      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
E8RBB2          ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A435ZMC2      ------------------------------------------------------------
A0A3S1X1N3      ------------------------------------------------------------
A0A434B8G6      ------------------------------------------------------------
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A1E2ZGQ8      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
A0A2R7TMW6      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1B9Z0F1      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
A0A1E2UHX3      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      VYQRYGDVQSRLTEIERAVEINRHMEKHTESELKKIKENIVNPQLSSSELFLSQNQHRME
A0A2D5LFD8      QRQRQQSLRDGLAFLDQQKPALEAKSTALLTELENFRKQNLLIDAS--------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0P9LE74      ---------------------------------------VRGAD----------------
A0A3M4ZQ14      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A3M5YLE8      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A3M3RP89      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A0P9QIY7      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A0P9VVH7      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A0Q0FJK6      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A0Q0G2J0      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A3M3LF66      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A0P9WIR8      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A3M3KPE5      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A3M4C263      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A3M5AD05      VERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS--------------
A0A0N0FS39      ------------------MPAVRKQLEDAETALNNFQTSARSVDLS--------------
A0A3M6GHH2      ------------------------------------------MDLS--------------
A0A0Q0D3D2      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9R9W0      VERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS--------------
A0A0Q0B9T0      VERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS--------------
A0A3M6CFI7      VERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS--------------
A0A0P9JXN0      VERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS--------------
A0A3M6FIV7      VERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS--------------
A0A3M4ENY1      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M5EZK7      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0P9SPP5      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M5DM48      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M3NNF2      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9NNS0      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M6AI26      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M4WA51      VERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS--------------
A0A3M4A0E8      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M4GLF4      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M4PBZ2      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9IWP8      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0Q0B3J8      VERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS--------------
A0A3M5M873      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9VHH8      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9YV98      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLS--------------
A0A3M3G2W8      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLS--------------
A0A3M6C224      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLS--------------
A0A0P9PWZ3      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M5K254      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9KZ49      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9PS59      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9V840      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0Q0AIE5      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M2ZQH6      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0N8SQG2      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0W8HFU1      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M5JFB0      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M3TQV3      VERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS--------------
A0A3M3EF92      VERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS--------------
A0A3M5J1E2      VERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS--------------
A0A3M5G7H9      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M4A376      VERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS--------------
A0A0Q0A5T8      VERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS--------------
A0A0P9SCD7      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9T4G3      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9VKB0      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0Q0BM35      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M3TPR7      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M3U4Q3      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9UCX7      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9S1F1      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9QCJ2      VERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS--------------
A0A0P9Q329      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M5GJ64      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A0P9MPC7      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M2XYQ3      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0P9XCE1      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M3EFX7      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M5B9D9      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0P9RRZ3      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M2VEK7      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0N8R9B3      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0P9VA27      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M4YBJ4      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0P9J470      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0Q0EVJ8      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M5UI30      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M5YQT8      VERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS--------------
A0A3M5F5X1      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M5R8G1      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M5V012      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M3GA16      VERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS--------------
A0A3M3CJL0      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M3F6F5      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M3P9B7      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0N8QB74      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0Q0AUD0      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M5VR55      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0Q0FK97      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M3UCT3      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M5XGQ7      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M5KZ75      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A3M5L3G5      VERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS--------------
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
K0XBA5          ------------------------------------------------------------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2A5PQG0      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A0T9WT26      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A0K9JYB4      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A2D9ABL7      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A062ME93      ------------------------------------------------------------
A0A3A3BFE8      ------------------------------------------------------------
A0A0L0M4Q4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A376QQZ0      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A436B5W5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A3S2FP30      ------------------------------------------------------------
A0A436NMQ4      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ------------------------------------------------------------
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------------------------------------
A0A2N2INV3      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A2G2GD62      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A328C2K5      ------------------------------------------------------------
A0A3D8MRR7      ------------------------------------------------------------
A0A437R5U4      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A2E2T3V8      ------------------------------------------------------------
A0A367UAB4      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ------------------------------------------------------------
A0A154VE85      ------------------------------------------------------------
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A168QTU8      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2T1MXF1      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A435LQD4      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A2W6S588      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          ------------------------------------------------------------
A0A1H7KZF8      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A3D3VHV9      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A447B6K7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
W7Q5J0          ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A2E1D962      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
Z2EKW7          ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A3S1IBR2      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A3S3EAI9      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A3S1P7J5      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A350DWX8      ------------------------------------------------------------
V4J283          ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A166Y9U5      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A0H6V1F7      ------------------------------------------------------------
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A383M853      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A447YBN8      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A3S2K5U0      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A354VPS3      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1E3DAN4      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
E8RBB2          ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A435ZMC2      ------------------------------------------------------------
A0A3S1X1N3      ------------------------------------------------------------
A0A434B8G6      ------------------------------------------------------------
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A1E2ZGQ8      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
A0A2R7TMW6      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1B9Z0F1      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
A0A1E2UHX3      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      LLQYQKALLENDTSPDSKTRKDEIQSELDTVAQNLQKAIQEADQSGNLTFVS--------
A0A2D5LFD8      --------TEALKIEANLSSTEQSLLSLQNTRRNLEQVRKQVAAGNLNSFDFQGSIISGG
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      -------------------------------------MYTR-------------------
F3FHG4          ---------------------------MKLKRVELERLYTR-------------------
F3GGI0          --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0P9LE74      ----------------------------------------T-------------------
A0A3M4ZQ14      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A3M5YLE8      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A3M3RP89      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A0P9QIY7      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A0P9VVH7      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A0Q0FJK6      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A0Q0G2J0      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A3M3LF66      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A0P9WIR8      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A3M3KPE5      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A3M4C263      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A3M5AD05      --------IETKGVLDQVVSLDATLSELKLKRVELERLYTR-------------------
A0A0N0FS39      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M6GHH2      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0Q0D3D2      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9R9W0      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0Q0B9T0      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M6CFI7      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9JXN0      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M6FIV7      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M4ENY1      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M5EZK7      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0P9SPP5      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M5DM48      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M3NNF2      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9NNS0      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M6AI26      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M4WA51      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M4A0E8      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M4GLF4      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M4PBZ2      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9IWP8      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0Q0B3J8      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M5M873      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9VHH8      --------IETKGVLDQVVSLDSMLSELKLRRLELERLYTR-------------------
A0A0P9YV98      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M3G2W8      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M6C224      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9PWZ3      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M5K254      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9KZ49      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9PS59      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9V840      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0Q0AIE5      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M2ZQH6      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0N8SQG2      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0W8HFU1      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M5JFB0      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M3TQV3      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M3EF92      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M5J1E2      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M5G7H9      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M4A376      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0Q0A5T8      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0P9SCD7      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9T4G3      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9VKB0      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0Q0BM35      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M3TPR7      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M3U4Q3      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9UCX7      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9S1F1      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9QCJ2      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9Q329      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M5GJ64      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A0P9MPC7      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M2XYQ3      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0P9XCE1      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M3EFX7      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M5B9D9      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0P9RRZ3      --------IETKGVLDQVVSLESMLSELKLKRVELERLYTR-------------------
A0A3M2VEK7      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0N8R9B3      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0P9VA27      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M4YBJ4      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0P9J470      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0Q0EVJ8      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M5UI30      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M5YQT8      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M5F5X1      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M5R8G1      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M5V012      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M3GA16      --------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR-------------------
A0A3M3CJL0      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M3F6F5      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M3P9B7      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0N8QB74      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0Q0AUD0      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M5VR55      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0Q0FK97      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M3UCT3      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M5XGQ7      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M5KZ75      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A3M5L3G5      --------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR-------------------
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      -----------------------MLTDWHY------------------------------
A0A454CTF1      ----------------MMVALEAQLNELTFKESEISQKFTQ-------------------
A0A352Q5C1      ------------------------------------------------------------
K0XBA5          ------------------------------------------------------------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      --------MEAKSLLDTMVQLDAQINQLTFSEAEVSKLYTK-------------------
A0A2A5PQG0      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A2X5NHJ9      ------------------MNVDNQLNQLTFREAEVSQLFTK-------------------
A0A3S4JGG5      --------LEAKSVLDTIVGVEAQLNELTFKEAEISKLYTK-------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      -----------------MVGLEKQLNELTFREAELQQLYTR-------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      --------LEAKSVLDQIVNVDNQLNELTFRESEISQLYTK-------------------
A0A376RY66      --------LEAKAVLDSMVNIDAQLNELTFKEAEISKLYTK-------------------
A0A377K431      -----------------MVNIDAQLNELTFKEAEISKLYTK-------------------
A0A352MMI7      -----------------------------FKEAEISKLYTK-------------------
A0A0T9WT26      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A0K9JYB4      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A2D9ABL7      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A1F9E324      -----------------------------------------RLRNQMETIQKRLTLEGNR
A0A062ME93      ------------------------------------------------------------
A0A3A3BFE8      ------------------------------------------------------------
A0A0L0M4Q4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      -----------------------------------------ALKSNMASISEQIKTEENK
A0A0A8J8L3      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A376QQZ0      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A436B5W5      -----------------------------------------QLQSQIKELQRLYNNGVLA
A0A3S2AQS7      ------------------------------------------------------------
A0A3S2FP30      -----------------------------------------QLQSQIKELQRIYNNGVLA
A0A436NMQ4      -----------------------------------------QLQSQIKELQRIYNNGVLA
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      -----------------------------------------RLAGQIEDTQNQLAKEISI
A0A2N3D2J1      -----------------------------------------QLAAQIAEVNRQIDREAGN
A0A2N2GVE1      -----------------------------------------RQERILDVVRGQLTSELAL
A0A2N2INV3      -----------------------------------------RQERILDVVRGQLTSELAL
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A2G2GD62      -----------------------------------------EFHPEVIKLNEEVFNLRKN
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      -----------------------------------------QTKAQIAELDLRIKAEIAA
A0A328C2K5      -----------------------------------------AVDEQLAVVRQSIDEEIGR
A0A3D8MRR7      -----------------------------------------AVDEQLEVVRRSIEEEIGR
A0A437R5U4      -----------------------------------------AVDEQLEVVRRSIEEEIGR
A0A1H7YHK3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A2E2T3V8      -----------------------------------------RITGEIWSVQQTLAKALER
A0A367UAB4      -----------------------------------------RISGEIWSVQQTLAKALER
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A0J7XGZ1      -----------------------------------------QARDELADVRAQLGAELGR
I4CBA7          -----------------------------------------LAQGKLYAMEKAISEVEQS
A3VE95          -----------------------------------------RIANEIAGVEAEMQTEAER
A0A154VE85      -----------------------------------------EALSESEGLRRTIAGEVEK
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A168QTU8      ------------------------------------------------------------
A0A0L1KFN4      -----------------------------------------SLQSRIDELSRAIEREEAR
A0A3T9EHW9      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2T1MXF1      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A1M7BLL7      -----------------------------------------EADGQLP------------
A0A358L616      ------------------------------------------------------------
A0A3D5UYX7      -----------------------------------------NIEAQQSDIGSQISAEVSR
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A3S1NQ09      -----------------------------------------ALSKEKADISTQIFGELKQ
A0A443GJ52      -----------------------------------------ALAKEKADISAQIFGELKQ
A0A3A0FZC0      -----------------------------------------QLKAQISGLKQSIEGQRRQ
A0A1N7JVZ7      -----------------------------------------AQELDEADEIAAIEATPSI
A0A091C4A8      -----------------------------------------QLQAQIDELDRQIQTEVGN
A0A435LQD4      ----------------------------------------------------LYNNGVLA
A0A3S1MCW7      -----------------------------------------QLQSQIKELQRLYNNGVLT
A0A434IGN6      -----------------------------------------QLQAQIKELQRLYNNGVLT
A0A2W6S588      -----------------------------------------DARQKVADLDTAIGREMAS
A0A444I5K6      -----------------------------------------RLRAEMEEYKRLMFDELNR
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A3C1S9Y1      -----------------------------------------AIQSELAELHQRKATEGKR
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      -----------------------------------------SLQGRIDEVRGQLNREMSS
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      -----------------------------------------ALATQLSQLDRSIASEENR
M2U8P2          -----------------------------------------NIDRQLSDLNERISEEIAR
A0A1H7KZF8      -----------------------------------------QLTAQATALHRELTRLADG
A0A0J5Q9T7      ------------------------------------------------------------
A0A3D3VHV9      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      -----------------------------------------QARAQLDAVRARSRAVIRE
A0A1Q3MB35      -----------------------------------------ALQSQLSELDRNIAREEAR
A0A1I5YYQ0      ------------------------------------------------------------
A0A259LUN7      -----------------------------------------SARNEVADIDRQMMAEMNR
A0A2D7AVL1      -----------------------------------------ELKRRIELTDREIEAERTR
A0A3B9KZE9      -----------------------------------------ELKRRIELTDREIEAERTR
A0A2U0NMP8      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A447B6K7      ------------------------------------------------------------
A0A1J5ICP0      -----------------------------------------EAVEQIKETKKGIMAELSS
A0A0M3GBT1      -----------------------------------------DLRGKIEKSRADLSFATKQ
B3Q577          -----------------------------------------DLRGKIEKSRADLSFATKQ
A0A379B9V4      ------------------------------------------------------------
A0A1A7QJ97      -----------------------------------------AIQQQIDALDSAITREESR
A0A0Q6TS97      -----------------------------------------ALASQIQALDAAIGQEEGR
A0A0Q6UYB4      -----------------------------------------ALASQIQALDAAIGQEEGR
W7Q5J0          ------------------------------------------------------------
A0A087LTV7      -----------------------------------------ALRARVTVAGEAVRAAQQA
A0A0G9MZA5      -----------------------------------------ALQVQIDELERAIREEQAG
H0T8B0          -----------------------------------------QLRERMAARQQAIWDEIGR
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      -----------------------------------------EAQADLTEARLNVQRQIES
A0A1W9LJP0      -----------------------------------------AITSELATLQERKMGEAKR
A0A0W1ICB0      -----------------------------------------AAREKVAALDRAISAEETR
A0A2E0UL88      -----------------------------------------MESGDLTTSPLQLSRDLRR
A0A233IKJ2      -----------------------------------------AAQAELASVKRNLNSELKQ
A0A2T1JE00      -----------------------------------------AAQAELASVKRNLNFELKQ
A0A0T2QIS1      -----------------------------------------ALQEQIASLDSAIAREDAR
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      -----------------------------------------AVEREAADLEEQVNREIQR
A0A2M7JRZ7      -----------------------------------------RLKNQMQSIQRRMDVETNK
X7F6S5          ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A2E1D962      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A3B8T2U6      -----------------------------------------AANAELESIDDSLARQVRA
Z2EKW7          -----------------------------------------QAKAQLASIQERTQQLIRE
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      -----------------------------------------MALIAQNKMQENLETAVTV
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      -----------------------------------------ALKSQIDQLDRSIANEERR
A0A0Q4CFJ9      -----------------------------------------ALKSQIDQLDRSITNEERR
A0A0Q4FE58      -----------------------------------------ALKSQIDQLDRSISNEERR
A0A0Q4JWC8      -----------------------------------------ALKSQIDQLDRSISNEERR
A0A0Q4KFL8      -----------------------------------------ALKSQIDQLDRSISNEERR
A0A2U9NDY5      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A0Q4IGG1      -----------------------------------------AIQTQIDQLDRSISREESR
A0A3M1CJM3      -----------------------------------------VVENKLKLLQRSINREIDN
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      -----------------------------------------ALAEQLQSLDSAISREEAR
A0A2E0Q2W0      -----------------------------------------ASEAELRSLRSALSKESGI
A0A142W0R3      -----------------------------------------AKKEQLAALNQSVSTETQR
A0A0S4XR18      -----------------------------------------PKHPDVIEISEEISALEVS
A0A2E0GW64      ------------------------------------------------------------
A0A3S1IBR2      -----------------------------------------ALSKEKADISTQIFGELKQ
A0A3S1NZ06      -----------------------------------------ALAKEKADISAQIFGELKQ
A0A434DUT4      ------------------------------------------------------------
A0A3S3EAI9      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A3S1P7J5      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A257G674      -----------------------------------------QLRAQVGVIDNQLQSVARS
A0A1I1UM01      ------------------------------------------------------------
Q44573          -----------------------------------------ALDQQIATTRASLEAETQA
A0A167IR75      -----------------------------------------AIQSQIEALDQAIAREESR
A2W025          ------------------------------------------------------------
A0A350DWX8      -----------------------------------------ELRARIDELDAQIRTAATS
V4J283          ------------------------------------------------------------
A0A0Q4UFQ5      -----------------------------------------ALQAQIRSIDAALRGEGSR
A0A432EMV7      -----------------------------------------AAKADLEEAISRVELETAK
A0A166Y9U5      -----------------------------------------AIESQIEELDRAIAGEEAR
A0A318KWA2      -----------------------------------------REAELAQRYTPNHPAYQSL
A0A1H3KC95      ------------------------------------------------------------
A0A0B3RZC9      -----------------------------------------AE-----------------
A0A2E9HXF7      -----------------------------------------AD-----------------
A0A2K8U7M6      -----------------------------------------QLRRALAELERQLRQEATA
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      -----------------------------------------QSQLSRAEAVYTRRHP---
W4HJV8          -----------------------------------------TDLRDAKPDARTAETSGHT
A0A0P1GDI0      -----------------------------------------RMQAEAAQRAEEARRAAHQ
A0A2R8ATV5      ----------------------------------------------RAKIEAEAKAA---
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ----------------------------------------------REARARSAAAV---
A0A238J8F6      -----------------------------------------QAALRAEKEARQRAEA---
A0A238JQI6      ----------------------------------------------AARKAQEARQA---
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ----------------------------------------------AASALRDAEMA---
A0A0H6V1F7      -------------------------------------------MKSASAQLEAVRKNLRA
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      -------------------------------------------MVRLSAAMKGINEKIAQ
A0A2E5YSA4      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      -----------------------------------------LDRIVDLEKQISEQNLKRT
A0A3D2Y902      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      -----------------------------------------------------------M
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A383M853      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A447YBN8      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A3S2K5U0      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A354VPS3      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1E3DAN4      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
E8RBB2          ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A435ZMC2      ------------------------------------------------------------
A0A3S1X1N3      ------------------------------------------------------------
A0A434B8G6      ------------------------------------------------------------
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A1E2ZGQ8      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
A0A2R7TMW6      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1B9Z0F1      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
A0A1E2UHX3      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      -----------------------------------------PQEYYKNL---ENTLVKLK
A0A2D5LFD8      GASTSGTTETAGSSLSGSIGISGIDSXLEEELTTLKEALYEARSIYQPG---SFAMKSLE
A0A0N0XAV4      -------------------------------------------------------MNQLE
A0A0P9QD19      -----------------------------------------EHPTYRSL---MSQMNQLE
F3FHG4          -----------------------------------------EHPTYRSL---MSQMNQLE
F3GGI0          -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9LE74      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M4ZQ14      -----------------------------------------EHPTYRGL---MSQINQLE
A0A3M5YLE8      -----------------------------------------EHPTYRGL---MSQINQLE
A0A3M3RP89      -----------------------------------------EHPTYRGL---MSQINQLE
A0A0P9QIY7      -----------------------------------------EHPTYRGL---MSQINQLE
A0A0P9VVH7      -----------------------------------------EHPTYRGL---MSQINQLE
A0A0Q0FJK6      -----------------------------------------EHPTYRGL---MSQINQLE
A0A0Q0G2J0      -----------------------------------------EHPTYRGL---MSQINQLE
A0A3M3LF66      -----------------------------------------EHPTYRGL---MSQINQLE
A0A0P9WIR8      -----------------------------------------EHPTYRSL---MSQINQLE
A0A3M3KPE5      -----------------------------------------EHPTYRSL---MSQINQLE
A0A3M4C263      -----------------------------------------EHPTYRSL---MSQINQLE
A0A3M5AD05      -----------------------------------------EHPTYRSL---MSQINQLE
A0A0N0FS39      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M6GHH2      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0Q0D3D2      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9R9W0      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0Q0B9T0      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M6CFI7      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9JXN0      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M6FIV7      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M4ENY1      -----------------------------------------EHPTYRSL---MSQMSQLE
A0A3M5EZK7      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9SPP5      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5DM48      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M3NNF2      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9NNS0      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M6AI26      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M4WA51      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M4A0E8      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M4GLF4      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M4PBZ2      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9IWP8      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0Q0B3J8      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5M873      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9VHH8      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9YV98      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M3G2W8      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M6C224      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9PWZ3      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5K254      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9KZ49      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9PS59      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9V840      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0Q0AIE5      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M2ZQH6      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0N8SQG2      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0W8HFU1      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5JFB0      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M3TQV3      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M3EF92      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5J1E2      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5G7H9      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M4A376      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0Q0A5T8      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9SCD7      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9T4G3      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9VKB0      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0Q0BM35      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M3TPR7      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M3U4Q3      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9UCX7      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9S1F1      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9QCJ2      -----------------------------------------EHPTYRSL---MSQLNQLE
A0A0P9Q329      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5GJ64      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9MPC7      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M2XYQ3      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9XCE1      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M3EFX7      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5B9D9      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9RRZ3      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M2VEK7      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0N8R9B3      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0P9VA27      -----------------------------------------EHPTYRSL---MSQMSQLE
A0A3M4YBJ4      -----------------------------------------EHPTYRSL---MSQMSQLE
A0A0P9J470      -----------------------------------------EHPTYRSL---MSQINQLE
A0A0Q0EVJ8      -----------------------------------------EHPTYRSL---MSQINQLE
A0A3M5UI30      -----------------------------------------EHPTYRSL------MNQLE
A0A3M5YQT8      -----------------------------------------EHPTYRSLMSQMSQMNQLE
A0A3M5F5X1      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5R8G1      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5V012      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M3GA16      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M3CJL0      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M3F6F5      -----------------------------------------EHPTYRSL---MSQMSQLE
A0A3M3P9B7      -----------------------------------------EHPTYRSL---MSQMSQLE
A0A0N8QB74      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0Q0AUD0      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5VR55      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A0Q0FK97      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M3UCT3      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5XGQ7      -----------------------------------------EHPTYRSL---MSQMNQLE
A0A3M5KZ75      -----------------------------------------EHPTYRSL---MSQINQLE
A0A3M5L3G5      -----------------------------------------EHPTYRSL---MSQINQLE
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      -------------------------------------------PTYQGL---VEQIAAVK
A0A454CTF1      -----------------------------------------DHPAYKSL---LDKRQTLL
A0A352Q5C1      ------------------------------------------------------------
K0XBA5          ------------------------------------------------------------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      -----------------------------------------EHPTYRAL---LEKRKTLE
A0A2A5PQG0      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A2X5NHJ9      -----------------------------------------DHPTYKAL---LEKRKVLQ
A0A3S4JGG5      -----------------------------------------EHPAYRAL---MEKRATLQ
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      -----------------------------------------QHPAYIAL---LEKRQTLL
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      -----------------------------------------EHPTYKAL---MEKRKTLQ
A0A376RY66      -----------------------------------------VHPAYRTL---LEKRQALE
A0A377K431      -----------------------------------------VHPAYRTL---LEKRQALE
A0A352MMI7      -----------------------------------------AHPAYRTL---LEKRRALE
A0A0T9WT26      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      ----------------------------------------------------------MG
A0A1V4Y2C3      ----------------------------------------------------------MG
A0A2N2KTJ4      ----------------------------------------------------------MG
A0A2N2LQX0      ----------------------------------------------------------MG
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      ----------------------------------------------------------MG
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      --------------------------------------------------MGKFFTALQK
A0A401FQP5      --------------------------------------------MTPTLPKVSQQLYCRG
A0A1W9PMU6      -------------------------------------MKNLLASCQPRSVSLPTLRENPK
A0A1Q6DMW3      ----------------------------------------------------------MG
A0A3A6P8F8      ----------------------------------------------------------MG
A0A1F9NI02      --------------------------------------------------MKISEALEKA
A0A2G2DSM4      ----------------------------------------------------------MG
A0A351Z4H9      ------------------------------------MGXKGVPKDNVFDRQEAQPEQYQE
A0A2N2KML4      ----------------------------------------------------------MG
E1YJF1          ----------------------------------------------MNKKQEYIGWIFMG
A0A1J5EVZ6      ----------------------------------------------------------MG
A0A2G6FCC5      ------------------------------------------------------MGETVG
A0A1F9MR25      ----------------------------------------------------------MG
A0A2G6M7F1      ----------------------------------------------------------MG
A0A1M6N1X5      ----------------MTIAIGTLLGLLLGVGFAFVHNYLFAGIAEAEEIESHAGLTVYA
A0A1G3VVY5      ------------------------------------------------------------
A0A0K9JYB4      -----------------MIAAGTGLGFFIGTFFIFLRRHAMIGVTDPMFVERRLSVPVLG
A0A2N6BZD5      ----------------------------------------------------MARSIRVG
A0A3N5MZ53      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A0C1TRU6      ----------------------------------MSRIEQALEKAAMLRGTTTESGPV--
A0A2Z5SSF4      ----------------------------------MSRIEQALEKAAMLRGTTTDRGPA--
A0A327LYE6      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------NALVTK
A0A239HD34      ----------------------------------MDRLHAAIEKARAEREKALAGQPSRP
A0A0P7ZZE4      ----------------------------------MERLKAALDKARETRAATAASAPATA
A0A369R0Q9      ----------------------------------MERLKAALDKARETRAATAAPAPASG
A5G4N9          ----------------------------------MEAMEPHTEVLEPPMDVLEPHMEVLE
A0A238LBD3      ----------------MNAKYSRRTGRPRLDASERARLLAEIAKLGAPATTELDAQSAAL
A0A0P1FWI8      -------------------MVEQNKRYRRKTRQQPPKSPGFLGPKNLSEADIEAEEKALR
A0A1V1UJT2      ----------------MNLSRHDAYMRRREARRAAEEAGEMPEPVYEESCGESAIEEIAD
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      ----------------MTLKRHEEYMRRRAARRAEMEAEADDEVPQVVDTPEPEA-----
A0A1V0RR48      ------------------------------------------------------------
A0A2D9ABL7      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      ------------VRNQALMAKRQENLIRTRLQQTRAEIMAAQDRSVDFNLLKREVDTNRE
A0A1F9E324      IIAG--------IRSEYESGLRKESLLRAAFEEQKGKAVEMKQKAIQYNILKRESDTNKE
A0A062ME93      ----------------------------------------------LYLQLYRDVKVNTE
A0A3A3BFE8      ----------------------------------------------QYLQLYREVEVKTQ
A0A0L0M4Q4      --------------------------------------------------------MTTQ
A0A2T4ZJZ6      ----------------------------------------------VILELSGDVKVSTN
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      ------------IDKEFERAQWLEKKLQKQFDDLKLQAQAIDSKQSEYRALERNLEADQK
A0A2G9ZR82      IFQS--------IASDYKTALKKLEALKERVELQKKLAMELNERATQYKIMEREVETNKQ
A0A0A8J8L3      ----------------------------------------------EVLRLSRDVESGRA
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ----------------------------------------------EVLRLSRDVEAGRA
D8EEU7          ----------------------------------------------EVLRLSRDVEAGRA
A0A376QQZ0      ----------------------------------------------QIVRLTRDVESEQA
A0A0P1H2H0      ----------------------------------------------SADDIAQEDRALRA
A0A258WKV0      -------------------------------------------------MLDREATALRA
A0A377N8F8      ----------------------------------------------NILRLTRDVQTAQE
A0A380AQW6      ----------------------------------------------EILRLTRDVQVDQQ
A0A3C2DSE7      ------------IERSYQLAVANENSLRASFNDNKEQIQDISRKEFKVRDLQREVEANRA
A0A0N0M5F7      --------------------------MQGEVERLRNATLSEQDRSIRYTILRREVRTNRE
A0A444IY46      --------------------------MEVQAQDQKQKAIELNDKASQYRILLRETETNKS
A0A3E0WKI3      ----------------------------------------------ELLRLRREAEVNSA
A0A1H3I2J1      ---------------------------------------------------DDDLDETVA
A0A1V5DJV0      ------------------------------------MMQQLPVAERELAQLMRHTKVNSE
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A436B5W5      ITDS--------LRLKYQEAQNKETDLKSKLAEMERQQVVFNDKNIKYTILKREVDSNRS
A0A3S2AQS7      ---------------------NKETDLKSKLAEMERQQVVFNDKNIKYTILKREVDSNRS
A0A3S2FP30      ITDS--------LRLKYQEAQNKEADLKSKLAEMERQQVVFNDKNIKYTILKREVDSNRS
A0A436NMQ4      ITDS--------LRLKYQEAQNKEADLKSKLAEMERQQVVFNDKNIKYTILKREVDSNRS
A0A1V4WHZ7      --------MVNAIKNDYAIARAKENSARSAVEGQKAEAQKLSEHSIQYGVFLREVEKNRE
A0A1E5AJN5      ISDS--------FVLRLAQAQQREETLRQELALVTASSREYREKSVEFIILRREVDSKRS
A0A2N3D2J1      VRSA--------IRTEFEVARDQEGALQQEVSALKSTTLDEQRRSIQYNILRREADTNRT
A0A2N2GVE1      SEDA--------LVAEYQLKERNLQESRALMLQAQEEALALAALDIEHSKLLRERNETAK
A0A2N2INV3      SEDA--------LVAEYQLKERNLTESRALMLQAQEEALALAALDIEHSKLLRERNETAK
A0A1Y5DXG5      ----------------------------------------------KLLGLTRDVEVGNE
A0A0B8P2H5      ----------------------------------------------EVLRLTRDVEVNQQ
A0A2G2GD62      IQAT--------VVLGIKTIKTRKEYLRRELKVRQASLTKLPEQERELGELTRNSSVNQE
A0A1M7HC79      ----------------------------------------------EVVRLTRDVEVTQA
A0A1D3JZN6      ----------------------------------------------ELLSLTRDVQVGTE
A0A1V6ESG1      VLAS--------VKSQYDAAKRQEDLVRMRLQETRKEVIQTQDKGVDLSLLKRELDTNRQ
A0A328C2K5      IRSA--------VANRAAVTRRNTESLQDEIERHKAEIAELNQIGFRYTEMRDSTETLRL
A0A3D8MRR7      IRTA--------VANRAAVTRRNTANLQEEIERHKAEIAELNQIGFRYTEMRDSTETLRQ
A0A437R5U4      IRTA--------VANRAAVTRRNTANLQEEIERHKAEIAELNQIGFRYTEMRDSTETLRQ
A0A1H7YHK3      ----------------------------------------------ELLRLTRDLQVSNE
A0A0P1FRV5      ------------------------------------------GSGRSAEEIAREDRALRS
A0A3M0ZZ99      -----------------------------------------AEALARFYELRQEAEIARS
A0A0H4KZM1      ----------------------------------------------SEAERTSEAAPSPE
A0A090R136      ----------------------------------------------EVLRLTRDVEVNQQ
A0A2E2T3V8      SARQ--------IDFGNANAQARYELVLKQLVRWKKELVKKHEALAGQGVLERDVEEAKR
A0A367UAB4      SARQ--------IDFGNANAQARYELVLKQLVRWKKELVKKHEALAGQGVLERDVEEAKR
A0A377V641      ----------------------------------------------EILRLSRDVESGRA
A0A1F2YJ88      ----------------------------------------------RYLQLYREVEVKQQ
A0A0J7XGZ1      IVSG--------LRADVQIAESRLASLLDSRAQAKGSLVQNGSAQVGRLELERRAEASRA
I4CBA7          EIAS-----------SLEAAKKRESAALQAYELAKEAAIRAGSNATRLSILKRAAAADAQ
A3VE95          IIEL--------RRNEVEVARLREQSLADGIQQLEDRLAGMSANSIGRTQLEREAAAARE
A0A154VE85      IGIG--------LANEVEVARARERALQQEVDRLQVLVDDRNDALLSLRALEGDLRSRTQ
A0A1G0NL95      ----------------------------------------------NILRLSREVQVNTQ
A0A024KA69      -----------------------------------------------------ALASAQS
A0A168QTU8      ----------------------------------------------EILRLSRDVESGRT
A0A0L1KFN4      VSAS--------VQAEYQQALAREEALQQRVSALKGDYLDLRRRSIQYNIFQQEVDTNRA
A0A3T9EHW9      ----------------------------------------------EIVRLTRDVESGQQ
A0A377LY04      ----------------------------------------------EIVRLTRDVESGQQ
A0A2T1MXF1      ----------------------------------------------EIVRLTRDVESGQQ
A0A2X3K9R3      ----------------------------------------------EIVRLTRDVESGQQ
A0A1M7BLL7      ---------------------------------------------------EPEPEPDVE
A0A358L616      ----------------------------------------------EILRLTRDVQAGQE
A0A3D5UYX7      IIES--------LANNVSVAKTRVSALRDNLNQIKGETGADNQALIQLRELEREADATRA
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ----------------------------------------------ELLRLTRDVEVSSE
A0A3C0PZN1      ----------------------------------------------ELLRLTRDVEVSSE
A0A3S1NQ09      LTES--------YRNEYEVAQARETALRANVAAAQGKSSVDNQTQVKLRELDQQATALTT
A0A443GJ52      LTES--------YRNEYEVALARETALRANVALAAGKSSIDNQSQVKLRELEQKATALST
A0A3A0FZC0      VVTG--------LKAKMLAAQQEEKNLHEELEQQKSQAFELSKRQVQFNVLNRELTSSRE
A0A1N7JVZ7      SARA---------PEDAGDRARTEPDPLMAQHPEPETSPEAERIAVEAEPSPHVGGEESS
A0A091C4A8      IKAA--------IRGEYESALAQEQMLRAQIDALKDEVLDLRNRSIEYNILRREVDTNRQ
A0A435LQD4      ITDS--------LRLKYQEAQNKETDLKSKLAEMERQQVVFNDKNIKYTILKREVDSNRS
A0A3S1MCW7      ITDS--------LRQKYQEAQNKEADLKSKLAEMEMQQDIFNDKNIKYTILKREVDSNRS
A0A434IGN6      ITDS--------LRQKYQEAQNKEADLRSKLAEMEKQQVIFNDKNIKYTILKREVDSNRS
A0A2W6S588      MSRS--------ARAESAAAAARSASLQASLAQAQSKLAGAVNASVQLAELQRRADNAHT
A0A444I5K6      IAES--------YQSELQVAKSRENSLRDSVTQATGVAATAGETQVELRELERTRDTYKN
A0A3S3UPT3      -----------------PRTMRVLALSLVLGLMLGAGFGGLNEFNERFFRTGEDIRDRAG
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      ----------------------------------------LNEFNERFFRTGEDVRDRVN
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A3C1S9Y1      IVSS--------LRNEYRMAVAKEDSLKKSFEEQKGESLNMNKKAIQYGVLYRQAESSKH
A0A353EH49      ----------------------------------------------DILRLKRDVEMNTI
A0A1Y1Q9C1      LRQSLQTEDATIRQADYISARKLEDDLRAEVESYKGELVDLRDRSIEYNALKREVETSRN
A0A3M7LJH0      ----------------------------------------------EILRMTRDVQVNQQ
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      IRTS--------LQQSYQASVARVGDLEGRVSNLKSSFLDLRRRSIQYNIYQREADTNRQ
M2U8P2          ERDA--------ARREAQTASRRTASIRSSLNDAQSELLEGNNASVRLAELERNAEAARA
A0A1H7KZF8      IKAG--------LHTPLDSATRDEAELASRFARLQTSRLSEQDNNVALAILQREADTNRN
A0A0J5Q9T7      ---------------------------------------------------EAERVTRDE
A0A3D3VHV9      ----------------------------------------------ELLRLSRDVKVSTE
A0A257NG76      ----------------------------------------------VILRLARDVKVNTE
A0A1T4TW59      LGIG--IG----IQKELDNAIKQEAALVADLENKKGDYQNITGKRAQYDALKRDVDSNRQ
A0A1Q3MB35      VRQA--------AQTTYQEALARENSLNREVAALKRRMLDERRDSIQYAIYQREVDTTRE
A0A1I5YYQ0      ------------------------------------------DAPTDAAPEETPPPMAEA
A0A259LUN7      IAAN--------LESELRVAESQINSIQGQIGQSSSQLRGNNINLVRLRELERDAETSRV
A0A2D7AVL1      IVDA--------LETSFRAAEAKEASLRERIGELKTKLIELRTQSVXYGILERQVETNRS
A0A3B9KZE9      IVDA--------LETSFRAAEAKEASLRERIGELKTKLIELRTQSVQYGILERQVETNRS
A0A2U0NMP8      ----------------------------------------------EVLRLSRDVESGRA
A0A2G2CXY6      ----------------------------------------------ELLRLKRDVAVTTE
A0A3M1D4H3      ------------YEAQLAGLVKKGAEIDASIQRTTEQFSTYPDKMRHMSQLELAAEAAEN
A0A447B6K7      ----------------------------------------------EVLRLSRDVESGRA
A0A1J5ICP0      IIAS---------------LKVNERSIKGNISSYEKRINALPAAEKRLAELTRGAEVQQS
A0A0M3GBT1      YLQT--------MRAKLAALDHEAAAVQSILDVAHEKRARDALVQTELTRLQRISDKEQT
B3Q577          YLQT--------MRAKLAALDHEAAAVQSILDVAHEKRARDALVQTELTRLQRISDKEQT
A0A379B9V4      ----------------------------------------------EMIRFTRDLEVNQH
A0A1A7QJ97      VSGS--------VQAEYRQAVQRESALEMRVNSLKDEYLDLRRRSIQYNIFEQEVDTNQA
A0A0Q6TS97      VRVS--------LQQAYDSSQTRERALTARVEGLKDGLADLRRRSIQYNIYQRDADTNRE
A0A0Q6UYB4      VRVS--------LQQAYDSSQTRERALTARVEGLKDGLADLRRRSIQYNIYQRDADTNRE
W7Q5J0          ----------------------------------------------EVLRLTRDVEVTQA
A0A087LTV7      LALR------------------------------------------SGFEERQALASAQS
A0A0G9MZA5      AQSGSQSR----LRANYNEALAAEQRLQAQVNRLQANYTDQRQDSVEYNILQREVDTNRE
H0T8B0          LAEG--------YKSQVQIAKAHEDELNKKLDEVFQQSAATRQLQAKLRELESTAKVYQS
A0A351CXR4      ----------------------------------------------ELARLEKDVENART
A0A2N6GLF5      VIKG--------VEKEYQVARENEQSIKRSLGSAKGEMQQINRKSQELRVLEREVEANRQ
A0A1W9LJP0      VVSS--------LRNEYNLALAREQSLKQALNRQKTESLDMNKKAIRYGVLQRDAESSRN
A0A0W1ICB0      VRGA--------YSADYNAAVQRETDLRARVDRLLGRLDTENRSSIQYNIYQREVDTNRE
A0A2E0UL88      SIVT--------QQIEIEALKAKIISLDETIQDFSKKFEDIPEQSIEFARLERERLSNEK
A0A233IKJ2      LLNG--------INNELQAAKQAESSLHRELEKRKSEFQSLSVKNARYSELKREVQTNRE
A0A2T1JE00      LLNG--------INNELQAAKQAESSLHRELEKRKSEFQSLSVKNARYSELKREVQTNRE
A0A0T2QIS1      IVNS--------RTAEFRNVATRESDLRRRVADLKAQLNTQQRASIQYNIYQREADTNRQ
A0A376KYN0      ----------------------------------------------EVLRLSRDVEAGRA
A0A2X1JB05      ----------------------------------------------EVLRLSRDVEAGRA
A0A376RML0      ----------------------------------------------EVLRLSRDVEAGRA
A0A377E5P7      ----------------------------------------------EVLRLSRDVEAGRA
A0A0P7Y1D0      IVAG--------LETEVNVARQRVGSLQSTLSGVRDELVTNNRALVQLRELEREAEASRT
A0A2M7JRZ7      IIAG--------IKNDYESNLRRESLIRQAFEQQKAKVMEMKEQGIQYNILKREADTNKE
X7F6S5          ----------------------------------------------ERARAAEAE-----
A0A1P8USW9      ----------------------------------------------ESARAAEKARQEDE
A0A1G7CFZ2      ----------------------------------------------ETGRVSTEP-----
A0A2E1D962      ----------------------------------------------ETGRVSTEP-----
A0A1I6U4V1      ----------------------------------------------AAARPRAAA-----
A0A1G8NKI0      ----------------------------------------------EAAARTRAQ-----
A0A355QPE4      ----------------------------------------------EAAARTRAK-----
A0A357RN98      ----------------------------------------------EAAARTRAK-----
A0A3B8T2U6      LVDG--------IYQEYQAAESKVNSLKVEVESAKQNYRKLSNLENQHLALQREVEINNQ
Z2EKW7          ISFS--------KQQDLLAAKAQEDMLREELDRKKSDFQSLGSQKARYEQLKREVESNKD
A0A365PWR2      ----------------------------------------------ELVRLSRDVKVNNE
A0A2E9H5Z8      LRDL--------LKTQLRLVNGQLVKIKERVEERRFDAVDKALQSQDYVEAKQDYETAKA
A0A2E2BR79      ----------------------------------------------EVVRLTRDVEVTQA
A0A0Q4Q524      VSGS--------LETDYRGAVERERALQARVEQLKSSYLDLRRRSIQYNIYQQEVDTNRA
A0A0Q4CFJ9      VSGS--------IETDYRGAVERERALQARVEQLKSSYLDLRRRSIQYNIFQQEVDTNRA
A0A0Q4FE58      VSGS--------LETEYRGAVERERALKARVEQLKGSYLDLRRRSIQYNIFQQEVDTNRA
A0A0Q4JWC8      VSGS--------LETEYRGAVERERALKARVEQLKGSYLDLRRRSIQYNIFQQEVDTNRA
A0A0Q4KFL8      VSGS--------LETEYRGAVERERALKARVEQLKGSYLDLRRRSIQYNIFQQEVDTNRA
A0A2U9NDY5      ----------------------------------------------ELLRRKRDMEVTTQ
A0A2J4YQQ6      ----------------------------------------------EILRLSRDVESGRA
A0A0Q4IGG1      VTGS--------IQAEYREALQREGALQARVNQLKSSYLDNRRRSIQYNIYQQEVDTNRA
A0A3M1CJM3      VLES--------LEAEYQVKLDSEKRLRRELERVKAEAQELNKKEIEYNRLKRVADNYAA
A0A2R7SVD4      ----------------------------------------------ELLNLTRDVEVASQ
A0A3C0PWB6      ----------------------------------------------ELLRLKRDMEVTTQ
V4Q8B7          ----------------------------------------------ELLRLQRDMEVTTQ
A0A0Q8XKK5      VDSS--------RSTEYREAQMREEGLRRQVETLRLQLGKQSRDSIQYNIYQREADTNRQ
A0A2E0Q2W0      TGAA--------SDAQLRGARQVEAELQARFDRAKAEYLAQQNQGVQYGILDREVNTNRQ
A0A142W0R3      SRAL--------NQESYASALKREKELQAELDRLTGKYRDQQRRSIEYAILQREVDTNRQ
A0A0S4XR18      LRGS--------IKSLYNSVQKQKNDLETTKKSYEYSLGGMPSSELGLMNLSRNFEVNQK
A0A2E0GW64      ----------------------------------------------KALSLMREVKVKET
A0A3S1IBR2      LTES--------YRNEYEVAQARETALRANVAAAQGKSSVDNQTQVKLRELDQQATALTT
A0A3S1NZ06      LTES--------YRNEYEVALARETALRANVAAAQGKSSIDNQSQVQLRDLDQKATALTT
A0A434DUT4      -----------------------------NVALAAGKSSIDNQTQVQLRELEQKATALST
A0A3S3EAI9      ------------------------------------------------------------
A0A3S1FD32      --------------------------------AAQGKSSVDNQTQVKLRELDQQATALTT
A0A3S1P7J5      ----------------------------------------------------------TT
W7Q8F9          ----------------------------------------------EVLRLTRDVEVTQA
A0A3M2BE89      ----------------------------------------------EVLRLMRDVKVQTE
A0A257G674      IRAS--------VKQQFDAAVETEQNLKQQVAELKGSSLEEQDRLVQYNLLAREADTSRT
A0A1I1UM01      ----------------------------------------------LREETEARQQAEED
Q44573          ALST--------IREDQISARAEVQRLNENLDLLRQKAGGQSAPQAEYRTLDQEAQSARA
A0A167IR75      VSGS--------VRAEYQQAEAREQALRQRVNALTDEYLDVRRRSIQYNIYQQEVDTNRA
A2W025          ----------------------------------------------KAVQLQRDAKVAED
A0A350DWX8      IRDG--------IRAQYQIALNQERALQNQVNGLKGEVLDLGDRSVQYNILVRELDTSRQ
V4J283          ----------------------------------------------TVLRLSRDVEVNSS
A0A0Q4UFQ5      VDAV--------LRATYQASLSREQQLTSQVNKLTGRVLDFRRRSIQYNILQREVDTNRQ
A0A432EMV7      VVDG--------IKRDYEAARAQEKEIKRFIREQKSEMRAFSGKSSDLTELEREVQANKD
A0A166Y9U5      VSNS--------VRNEYRQALAREQALENRVNSLKGDFLDLRRRSIQYNIYQQEVDTNRA
A0A318KWA2      LRQK--------RHLEAERAALNARVDD------------------LPEAQQEVVRRTRD
A0A1H3KC95      ---------------EYPPRASPTPGERPSAAGARGPVTAAEPQHPQPADAPPATTPAAA
A0A0B3RZC9      ----------------------------------------------QVRLAEARAAEDAA
A0A2E9HXF7      ----------------------------------------------EVREAEQRKADAEA
A0A2K8U7M6      IGSA--------ARAAAAARAHQEARLAERGDEVRAQLRDLQVFGGGYRVLEREVADHQE
A0A238KJM1      ----------------------------------------------ELAEIEAKTRADAD
A0A3A0FJZ4      SVKQ--------LRAELARRRAQLVAPAATAAGVAAVSDEPSARYRSLLRAYDTNVQSYA
W4HJV8          PTSA--------TETNIPHATPDAPAETSEDETSSEGLSGPDLSRSAADATARRTPADVA
A0A0P1GDI0      ADID--------LARESERVRREKAERLAAKQVAQAEADRLAAEQAAQAEADRLAAEQAA
A0A2R8ATV5      ---------------EQTRQSQVARARTLKEEKAKALLVAAEKAEQDAAAEEDALNEAKE
A0A1U7D3R6      ----------------------------------------------AARKAEQLRLAEAA
A0A2D4UVV2      ----------------------------------------------AARKAEQLRLAEAA
A0A0W7WHP4      ---------------EALRRAEA-----------------------ERQAAAARKAELEE
A0A238J8F6      ---------------EKRAQEREAARKAEEQARREKARLEEARKEKERLAAEKAAAEQAK
A0A238JQI6      ---------------EERRKAEDAARKAQE----------------ARLAEERRKAEDAA
A0A222E077      --------------------------------------------------------DAEA
A0A239E3Y2      ---------------KAKRLADEHQRAAEAEAK-------------RLAEAAQRKADAEA
A0A0H6V1F7      ELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKREVQTNRELF--
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      ------------------------------------------------------------
A0A0B8PTA8      ----------------------------------------------MTRDVEVNQQIY--
A0A0B8QF75      ----------------------------------------------------MNQQIY--
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      EVKKILQSVETEYRVALAEEKSIREAMEEKKREALYLNEKQIGYNSLKRDTDTSRSLY--
A0A2E5YSA4      --------------------------------------MGSRSGCRFAREFQSGDEIESM
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      EMERRFTRQHPNFQALMNQINQLQMQKDQLEKQIDTLPSTQQELLRLTRDVEVSSETY--
A0A3D2Y902      ---------------------------------------TQQELLRLTRDVEVSSETY--
A0A318DSU0      ----------------MSQIGQLQAQKGDIDKQVGDLPDTQQELLRLTRDVEVTNATY--
A0A1W1ZH10      -------------------------------------------------------TQY--
A0A1W2FF24      -------------------------------------------------------TQY--
A0A1V1PDB4      ----------------------------------MELNQKSIQYGVLQREAESARHMY--
A0A2M7C324      QVADVVSGFEREYEMARANESALAGSVAEAKQSIQGSNRKEYELSALERDVKTNQELY--
A0A3B7DTA4      ---------------------------------------------MLKRVAETNRSSY--
A0A432ZK62      -----MVACLGLDLCWFDRRLSLRLVIKQINAQVSTLLETQQEVLRLARDVEVSQEIY--
A0A1V5EEP4      ------------------------------------------MGKLYKALEKAEKERI--
A0A1V5EF48      ------------------------------------------MGKLYKALEKAEKERS--
A0A0S6X1X6      ----------------------------------MDEQNSGVQYNLLKRVADTNRSLY--
A0A383M853      ---------------------------------------MQQEILRLTRDVQVDQQVY--
A0A1H5YYQ4      --------------------------------------MTQRPKFTRKKRAGAQSLPEIE
A0A1X4NLK2      -----------------------------------MTEQPKFQRRKRRGANTAAEQAQ--
A0A1X4NWB5      -----------------------------------MTEQPKFQRRKRREEASADVQPK--
A0A1M5UQ38      -----------------------------------MTEQPKFQRRKRRGAVDDVPTPT--
A0A327YI48      ---------------------------------------MTDDRKFRRRNPLSAEIAA--
A0A1B1PNL6      --------------MVERRRFRRRKRSEETPEDPPILPLERREERLARRRADRDAEEA--
A0A2U8H9H9      --------------MVERRKFQRRKRVDETPEDPPIFPLERRADRLARREAEREAEDA--
A0A1X6YIC0      --------------------------------------MADRPKFRRRRGRTPERTED--
A0A1I5E9E9      ------------------------------------MKLSRYEAYMRRRAARRDALEN--
A0A1X6Z7N7      ------------------------------------MKLSRYEAYMRRRAARRDALES--
A0A2E1DQ13      -------------------MAGDPAMKQAPEAAAEDVTLSRHEAYMRRRAARQAEAPE--
A0A1H8C800      ------------------------------------MKLQRHDAYMRRREARHTAEEA--
A0A2N3EZ05      -------------------------MRQAPEAEAEDATLSRHEAYMRRRAARLEAEAA--
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ----------------------------------------------------------LG
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ----------------MQLLNRQQELNIAKSSAIGNVRIIDDAITQPKPVKPKKVLVVII
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      --------------------------------------------TQPNPVKPKKVIILLV
A0A447YBN8      -------------------------------------------------------MVVLI
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A3S2K5U0      --------------------------------------------------------LVLG
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------MVLNLLIGLALG
A0A354VPS3      ------------------------------------------------------------
A0A1I3XJ27      -------------------------------------------------MSGSEASAQKT
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1E3DAN4      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
E8RBB2          ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A435ZMC2      ------------------------------------------------------------
A0A3S1X1N3      ---------------------------LLMGAGFGGLNEFNERFFRTGEDVRDRVNLKFL
A0A434B8G6      -------------------------------------------FFRTGEDVRDRVNLKFL
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ----------------------------------------------------MSSNSRDT
A0A1H9C241      --------------------------------------------------MAEHVVRRRG
A0A2E3FCR1      --------------------------------------------------MVNYVLRRNR
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A1E2ZGQ8      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
A0A2R7TMW6      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------MRSALC
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1B9Z0F1      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
A0A1E2UHX3      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      EESRKLETEKSTLNARLKADKSEISKIPHILQEFEALQRQISVSSDLYLGLQQKLQEIEI
A0A2D5LFD8      QKKAAL--------------EPLLLASQLRALDTALQVNSNQINSTKLEL---KNLIQNF
A0A0N0XAV4      EQKKAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYSLMLNKSQEQDI
A0A0P9QD19      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
F3FHG4          QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
F3GGI0          QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9LE74      EQKKAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYSLMLNKSQEQDI
A0A3M4ZQ14      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A3M5YLE8      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A3M3RP89      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A0P9QIY7      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A0P9VVH7      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A0Q0FJK6      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A0Q0G2J0      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A3M3LF66      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A0P9WIR8      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A3M3KPE5      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A3M4C263      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A3M5AD05      QQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKSQEQDI
A0A0N0FS39      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M6GHH2      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0Q0D3D2      QQKQGL--------------LKKIDALPMTQQEL---------------LMLNKSQEQDI
A0A0P9R9W0      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0Q0B9T0      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M6CFI7      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9JXN0      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M6FIV7      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M4ENY1      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5EZK7      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9SPP5      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5DM48      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3NNF2      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9NNS0      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M6AI26      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M4WA51      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M4A0E8      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M4GLF4      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M4PBZ2      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9IWP8      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0Q0B3J8      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5M873      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9VHH8      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9YV98      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3G2W8      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M6C224      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9PWZ3      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5K254      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9KZ49      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9PS59      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9V840      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0Q0AIE5      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M2ZQH6      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0N8SQG2      QQKQGL--------------LKKIDALPMTQQELLRMTRDMQVISQTYTLMLNKSQEQDI
A0A0W8HFU1      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5JFB0      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3TQV3      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3EF92      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5J1E2      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5G7H9      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M4A376      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0Q0A5T8      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9SCD7      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9T4G3      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9VKB0      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0Q0BM35      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3TPR7      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3U4Q3      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9UCX7      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9S1F1      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9QCJ2      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9Q329      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5GJ64      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9MPC7      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M2XYQ3      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9XCE1      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3EFX7      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5B9D9      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9RRZ3      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M2VEK7      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0N8R9B3      QQRLGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9VA27      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M4YBJ4      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0P9J470      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0Q0EVJ8      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5UI30      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5YQT8      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5F5X1      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5R8G1      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5V012      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3GA16      QQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3CJL0      QQRKGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3F6F5      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3P9B7      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0N8QB74      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0Q0AUD0      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5VR55      QQRLGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0Q0FK97      QQRLGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M3UCT3      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5XGQ7      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5KZ75      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A3M5L3G5      QQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDI
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ---------------------------------------------------------QDI
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      EQRKAL--------------VGEVGNLPETQQELLRLKRDVEVSNQIYTLLLGKTQELDI
A0A454CTF1      QEKARL--------------NRQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNI
A0A352Q5C1      ------------------------------------------------------------
K0XBA5          ------------------------------------------------------------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      EEKNNL--------------KKKINNLPETQQEVLRLTRDVQVGQDVYLQLLNKEQELSI
A0A2A5PQG0      ------------------------------------------------------------
A0A2J4QEC3      ---------------------------------------------AVYMQLLNRQQELSI
A0A2X5NHJ9      QEKAKL--------------NQQVSGMPATQQEVLRLSRNVESGQAVYMQLLNRQQELNI
A0A3S4JGG5      QEKDKL--------------NKRVSGMPKTQQEILRLTRDVQAGQEIYMQLLNKQQELGI
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      NTKNAI--------------NKSIKRLPKTQQEILRLTRDVQVDQEIFVQLLNKQQELSV
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      DEKAKL--------------NKRVSAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNI
A0A376RY66      DEKAKL--------------NGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKI
A0A377K431      DEKAKL--------------NGRVTAMPKPSRKLCVLTRDVESGQQVYMQLLNKEQELKI
A0A352MMI7      DEKDRL--------------SGRVSAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKI
A0A0T9WT26      --------------------------MPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKI
A0A379TA56      --------------------------MPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKI
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ---MAHSDKTASSIKNIEYTQTKILPVSADKLRANR--------------------IVAH
A0A1V8MBH1      -------MKASEESLVINYTQTKTHEINHELLRERR--------------------VVSL
A0A1V6FYJ1      ------------------------------------------------------------
A0A0A6PQ76      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3P6L543      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A3N5FRH4      KMYEALQKAEKERIPEQKRE--PVKAVFDNS-----------------------------
A0A1V4Y2C3      KMYEALQKVEREKFGEPTDK--TLKTTPDEL-----------------------------
A0A2N2KTJ4      KMFDVLQKLEREKTADQKKEEPAIVSDPDNQ-----------------------------
A0A2N2LQX0      KMFDVLQKLEREKNIDQKKEQPAIVTDPDDQ-----------------------------
A0A0A6RK76      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      KIADALDKARREPARKMDQLRPSGETGSREQKQARV--------------------QHEV
A0A1W9WUD9      ---------MKTGNIRVIDKAEIPTVPISPNKKRMV--------------------LISM
A0A1W1ZQK0      SKTPIHERDKKDKVRLVSTQSQKKVEKKTSASLLNP--------------------VAPT
A0A401FQP5      QRVKLFRRKQKSDKRPIPRKHGGFTFDSDPSNGEAT--------------------SGKA
A0A1W9PMU6      RAETAILSSSTVSKTRIIDEALLPTRPIKPKRVLII--------------------IVGF
A0A1Q6DMW3      KVFDALSKSGADNKPVE-----RKSPASVKSEGENV--------------------PSGE
A0A3A6P8F8      KVAEALSKAGADIKRVTEGIDGNNQGNTALSEGKND--------------------KAGK
A0A1F9NI02      GYGEDLEKRAEEGPEKE-----FDHDRIAVSQTRAG--------------------QEEE
A0A2G2DSM4      KFSTTLAKGEQQDSTTQ-----KNDSDWLSPENVEN--------------------RDKE
A0A351Z4H9      SERATYKDAPKD-----------------NIFDKQK--------------------VQPS
A0A2N2KML4      KMYDALQKVERE-----------------KF-TEQR--------------------DEAP
E1YJF1          KMFEALQKAEDE-----------------NVRTPQA--------------------ETVE
A0A1J5EVZ6      KIHTALSKAGAE-----------------EPTTRQM--------------------EETP
A0A2G6FCC5      KVLRALSKAAES-----------------DKSQMLS--------------------DEST
A0A1F9MR25      KFFNVLAKAKKN-----------------EAIEQEI--------------------SQSR
A0A2G6M7F1      KVYKILNRAEQNRNFQGKEKAEATSSGDHQAADAVT--------------------SKLL
A0A1M6N1X5      TIPESRYQQQLNKERNTHP-----------------------------------------
A0A1G3VVY5      --MGKMFDALQKAEKERYRESERVSYKGVPKDNVFD--------------------RQEA
A0A0K9JYB4      EVLFSRSQQMLDHEISMSPVSRAPLWFAGKKDERSE--------------------PKAL
A0A2N6BZD5      KVFKALNKGASTDEADLPWDADSSHEPLAGDSSLPE--------------------AEPA
A0A3N5MZ53      ---------LASAQARVIESAVPPQVPYKPKRARIV--------------------AISV
A0A355TB56      ----SEQQDMQLPDTRIIARADVPVVPAFPQTWLFV--------------------LVGL
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      --MPDISTDMASTDDDDVARPPGPEDAASTQTSPEP--------------------PRAR
A0A3N5Z7F8      IKEQRITEKIQPVNVWVIDAAETPEYPAKPRKKLNI--------------------LLGI
A0A239HD34      LSPPPLPTGATQDPLLGPAAAPQTPFPVSPPTDPAP--------------------AVGR
A0A0P7ZZE4      ARANPAAKPAPRGNGHASADAGAARRPQAAGSEPA------------------------P
A0A369R0Q9      ARPEPAANPARRGAGQAGAVAGAVRGPQAAGSGAAP--------------------STGP
A5G4N9          PHMEVLEPHDESSTGERLVLKPRVHHLKKTPPTEKH--------------------IRLP
A0A238LBD3      RAALSESVEPPADEPEAAQDAVTPTDREATAAAPIE--------------------QPKA
A0A0P1FWI8      EAFLWFDPDEVTQQD-------------YDTSEPLS--------------------EAAT
A0A1V1UJT2      EFALPLDPGMRADPEEALAVTPESQDVPEPEPEPEP--------------------EPEP
A0A0L6CVX1      ------------------------------------------------------------
A0A0A0HJJ4      -----------PAQDEIAQEETALAAPPESLELSEP--------------------EPEP
A0A1V0RR48      ----------------------------------------------------------MA
A0A2D9ABL7      --------------------------------------------------------MAPV
A0A1S7S3I8      -------MENAKAGTSAATPGGEHATLDES-----G--------------------QVSF
A0A354EI73      ------------------------------------------------------------
A0A1D2RNR5      LYNGL-LQQVKEVGVAGGVETNNIQVVDKA-EVPLF--------------------PYKP
A0A1F9E324      LYRGL-LQRMKEAGVSAGITASNIQVVDQA-EPPTR--------------------PYRP
A0A062ME93      LYTSL-LNSYQQLKIANAGEIGNVRIIDTA-VEPVK--------------------PIKP
A0A3A3BFE8      LYTAL-LNSYQQLRIAKAGEIGNVRIVDTA-IEPVE--------------------PIKP
A0A0L0M4Q4      LYTSV-LTNTQQLEVAAASTPPGMAVVDWA-VAPEK--------------------QSWP
A0A2T4ZJZ6      LYSTL-LNNAQTLRVAKAGTVGDVRIIDHA-VLPNN--------------------AIKP
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      LYDTF-LTRFKETNISSGNNTPNARIIDEA-RVPGG--------------------HYWP
A0A2G9ZR82      IYNSL-LERSKEIESMVGVSASNIHIVDRA-DLPVL--------------------PFKP
A0A0A8J8L3      VYLQL-LNRQQELNIAKSSAIGNVRIIDTA-ITEHK--------------------PVKP
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      VYLQL-LNRQQELSISKSSAIGNVRIIDPA-VTQPQ--------------------PVKP
D8EEU7          VYLQL-LNRQQELSISKSSAIGNVRIIDPA-VTQPQ--------------------PVKP
A0A376QQZ0      IYNQL-VAKQQELSVLNSGITADVRIIDSA-ESQPN--------------------AVAP
A0A0P1H2H0      AFPQWDGDEMQDAASDTTEMDAPHSHNDEA-LPDEP--------------------AAEP
A0A258WKV0      QLSSL-LARYNEISAAANLNSGTSTKLDAA-RVPGG--------------------PVSP
A0A377N8F8      MHSLL-ISKQREMEIKKVSTVGNVHIIDPA-QTLPS--------------------PVGP
A0A380AQW6      VYMQL-MNKQQELSISKAGTVGNIRIIDEA-ETGLR--------------------PVQP
A0A3C2DSE7      LYDTF-MTRLQETTATSDLSSTNARIVDEA-IPPAQ--------------------ASEP
A0A0N0M5F7      LYDGL-LQRFKEVSAAAGVSANNISIVDLA-STPVR--------------------PVAP
A0A444IY46      IYETL-LQRAKEIEATLGAAVTNITLVDRS-RVPLY--------------------PSSP
A0A3E0WKI3      LYTAM-LNNAQELRVVRAGMVGNVRVVDEA-ITGHR--------------------PVRP
A0A1H3I2J1      LTPPYELEASEALALEESYRAPSEPAQQAAPVSEPE--------------------PEPE
A0A1V5DJV0      LYTFL-LQKREEARIAKTSTINNINIIDPA-ITPLT--------------------PVKP
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      ---------------------------------PTA--------------------PYSP
A0A436B5W5      QYDSL-IAKLNEVGVSSELKTQSAAIVDFA-SLPTA--------------------PYSP
A0A3S2AQS7      QYDSL-IAKLNEVGVSSELKTQSAAIVDFA-SLPTA--------------------PYSP
A0A3S2FP30      QYDSL-IAKLNEVGVSSELKTQSAAIVDFA-SLPTA--------------------PYSP
A0A436NMQ4      QYDSL-IAKLNEVGVSSELKTQSAAIVDFA-SLPTA--------------------PYSP
A0A1V4WHZ7      LYENL-LKRLKETSVEHEFGATNIKIIDSA-TAPIH--------------------PAKP
A0A1E5AJN5      QFEAL-IEKLNNIGVGAELRSENVAVLDYA-VRTPD--------------------FFSP
A0A2N3D2J1      LYDAL-LQRFKEISTIAGSQSNNITIVDPA-VVPGS--------------------PTSP
A0A2N2GVE1      LYELV-LSRLKETGLAEELKTNNIRLLDAA-QIPLA--------------------PFKP
A0A2N2INV3      LYELV-LSRLKETGLAEELKTNNIRLLDAA-QVPLA--------------------PFKP
A0A1Y5DXG5      IYMML-LGKVQELDIVRAGTVGNVRIIDVAEVNTTK--------------------PVKP
A0A0B8P2H5      IYLQL-LNKSQELAIVKASTVGNVRILDGA-ESYSA--------------------PVKP
A0A2G2GD62      IYSFL-LKRRVETAILNSSTLSQARLMDPA-TLPMR--------------------PYAP
A0A1M7HC79      IYVNV-LNKAQELKLARAGTVGNVRIIDEA-LVGSG--------------------PIEP
A0A1D3JZN6      IYTQL-LNRSQELDVMRAGTVGNVRLIDSADANISK--------------------PVEP
A0A1V6ESG1      IYDNL-LQRLKEVGVTSGVAANNISVVDEA-KAPLF--------------------PFKP
A0A328C2K5      HYESV-LGRTNELDLNALYESEIIQVLENA-DVPSS--------------------PISP
A0A3D8MRR7      HYETV-LGRTNELDLNALYESEIIQILENA-DVPGA--------------------PISP
A0A437R5U4      HYETV-LGRTNELDLNALYESEIIQILENA-DVPGA--------------------PISP
A0A1H7YHK3      LYTAL-LNQAQQLDVARAGTVGNVRIIDPAAVDVTS--------------------PVKP
A0A0P1FRV5      AFPFLDLDDVEADASELAEEVAPVAVPEPLILNPES--------------------EVTP
A0A3M0ZZ99      QYAAL-LARQRQLEAQAPIQLADARIVSEA-LAPGT--------------------PSFP
A0A0H4KZM1      AKPRA-PAKDARPAVAPPEPAPAPAVEAPEPDQPTE--------------------PAPP
A0A090R136      IYIQL-LNKVQELNIMKASTVGNVRVLDEA-QIYPN--------------------AVKP
A0A2E2T3V8      TVELL-GAREQEILSSIAELKPDTLLLQLP-SVPLY--------------------PEFP
A0A367UAB4      TVELL-GAREQELLSSIAELKPDTLLLQLP-SVPLY--------------------PEFP
A0A377V641      VYMQL-LNRQQELNIAKSSAIGNVRIIDSA-VTQHK--------------------PVKP
A0A1F2YJ88      LYTAL-LNSYQQLRIAKAGEIGNVRIVDTA-IEPVE--------------------PIKP
A0A0J7XGZ1      IYSAY-LTRAKETAQAGELPNADASIATLA-RPPGG--------------------PSSP
I4CBA7          VYLTL-TQKIKQMALFSRLAPHTLGIEGPP-TLPTK--------------------PVFP
A3VE95          NYEAL-LARLGAASGQENLQRPEARVIERA-TFPAV--------------------PSAP
A0A154VE85      LYEVM-LARFNEAKLQDERLVGPEARVISAAVPPAE--------------------PLFP
A0A1G0NL95      LYTSL-LDSLQEQRVEQGGSLGTARIVDSS-IPPAA--------------------PAGP
A0A024KA69      HYRML-LDRLTRLEAEAFLQVPSARIAAVA-SPPVA--------------------PSSP
A0A168QTU8      IYLQL-LTRQQELNISRSSAVGNVRIIDEA-VTLPD--------------------PIKP
A0A0L1KFN4      LYDGL-LQRFKEIGVAAGVGVNNVAIVDTA-AVPEL--------------------PSSP
A0A3T9EHW9      VYMQL-LNKEQELKITEASTVGDVRIVDPA-ITQPG--------------------VLKP
A0A377LY04      VYMQL-LNKQQELKITEASTVGDVRIVDPA-ITQPG--------------------VLKP
A0A2T1MXF1      VYMQL-LNKEQELKITEASTVGDVRIVDPA-ITQPG--------------------VLKP
A0A2X3K9R3      VYMQL-LNKQQELKITEASTVGDVRIVDPA-IAQPG--------------------VLKP
A0A1M7BLL7      DAPNV-ADAAEDESEVIVVPVPEVAVVNGPVEQAPE--------------------DAVD
A0A358L616      IYMQL-LNRQQELSISKASTVGDVRIIDHA-ETASK--------------------PVAP
A0A3D5UYX7      VYEAF-LNRFKETTGQQGLQTPDTRIISQA-VVPQA--------------------ASYP
A0A2N1WQN5      -------NKTQELDIIRAGTVGNVRIIDHAAADLEN--------------------PVKP
A0A352G2C2      TYSML-LNKTQELDIIRAGTVGNVRIIDHAAADLEN--------------------PVKP
A0A3C0PZN1      TYSML-LNKTQELDIIRAGTVGNVRIIDHAAADLEN--------------------PVKP
A0A3S1NQ09      LYQTF-LGRYEEAAQQQSFPVGKIRIISDA-SMPMT--------------------ASSP
A0A443GJ52      LYQTF-LGRYEEASQQQSFPVGKIRVISDA-TLPQS--------------------AATP
A0A3A0FZC0      LLQNV-LRQIKETSLAVESNASNVSIVDYA-VTPIE--------------------PSFP
A0A1N7JVZ7      DIENL-FADEPTTESVEPDHHLGDRIEDGPVAPRTD--------------------PVDA
A0A091C4A8      QYDAL-LQRYKEIGVAGGVGTNNISIVDPA-ELPIS--------------------KYKP
A0A435LQD4      QYDSL-IAKLNEVGVSSELKTQSAAIVDFA-SLPTA--------------------PYSP
A0A3S1MCW7      QYDSL-ITKLNEVGVSSELKSQSAAIVDFA-AQPGS--------------------PYSP
A0A434IGN6      QYDNL-IAKLNEVGVSSELKSQNAAIVDFA-TQPGS--------------------PYSP
A0A2W6S588      LYTNL-LTASGQQNANSALIQPDAQMVTPA-VVPLA--------------------PTSP
A0A444I5K6      LYQSF-LTRYQEAIQQQSFPITAARIITTA-ETPTK--------------------PSAP
A0A3S3UPT3      LKFLG-YLPTIGGGRAKDSKADDLPADGKV-A-SLS--------------------SAER
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      ----------------------------------LS--------------------AAEK
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      LKFLG-YLPTIGGKLGKEEKPGETQVDAKT-TQSLS--------------------SAEK
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      -----------------------TQVDAKT-TQSLS--------------------SAEK
A0A3S2C404      -----------------EEKSGETQVDAKT-AQSLS--------------------AAEK
A0A435F6C0      ---------------------GETQVDAKT-AQSLS--------------------AAEK
A0A3C1S9Y1      MYELL-IKRFKETSLTEEMKTGNIRVIDRA-EIPNT--------------------PVSP
A0A353EH49      LYSKL-LNTTQELKVAQAGDIGYVRVVDYA-FMPEE--------------------PFKP
A0A1Y1Q9C1      LYDGL-LQRMKEVSVASNVTSSNIRVVDAA-APDNE--------------------IFRP
A0A3M7LJH0      IYIQL-LNKVQELNIIKAGTVGNVRILDSA-ATYAK--------------------AVKP
A0A316KRG4      ---------------------------DHDTPVPGQ--------------------PVKP
A0A1E4JHX8      LYDAL-LQRYKEIGVAGGVGTNNVSVVDVA-RIPER--------------------PSRP
M2U8P2          LYESF-LSRLRENVAAAGTEQTNAYPLSRA-SAPRV--------------------PASP
A0A1H7KZF8      QYDAL-LARLNQLNAEAGVQVSNLSILDRA-VPPDR--------------------AYFP
A0A0J5Q9T7      AVRVK-AERLKQLASERRAHMVAEASRKRVEVAPPD--------------------PGAP
A0A3D3VHV9      IYTAM-LNTSQELDVVRAGTVGNVRIIDDAVVDTSQ--------------------PVKP
A0A257NG76      LYTAL-LNNTQTLRVSKAGTVGNVRIIDYA-VLPTE--------------------PIKP
A0A1T4TW59      LYEMF-LNRQKETTATSDFESLNARFTDKA-KSPQD--------------------PFRP
A0A1Q3MB35      LYQGL-LQRYKEIGV-AGVGANNVTVVDRA-VVPLE--------------------PSSP
A0A1I5YYQ0      QEPAA-LMRADEPKDGPATAPAMAPPAERT-ATPVT--------------------PSLS
A0A259LUN7      MLEEF-LARSKQTREQDSLITADSSVLSAA-SVPRA--------------------PAAP
A0A2D7AVL1      QYDAL-LTRLKELTTAEGIGASQASVVDRA-IAPTH--------------------PFQP
A0A3B9KZE9      QYDAL-LTRLKELTTAEGIGASQASVVDRA-IAPTH--------------------PFQP
A0A2U0NMP8      VYMQL-LNRQQELNIAKSSAIGNVRIIDNA-VTQPK--------------------PVKP
A0A2G2CXY6      IYTAL-LNSSQELDVLRAGTVGNVRIIDEAAANVEE--------------------TVKP
A0A3M1D4H3      VYKSL-QEQNYQVGVAESMLVSDMQLVEPA-VAPER--------------------HYSP
A0A447B6K7      VYLQL-LNRQQELNIAKSSAIGNVRVIDNA-VTDPE--------------------PVKP
A0A1J5ICP0      AYSSL-LRNKQEFEIMKAGEIGNVWVVDSA--ASAK--------------------IIKP
A0A0M3GBT1      ALEKL-EDQRRDLADKAKLPGAELEVLSPA-SVPLA--------------------AQGR
B3Q577          ALEKL-EDQRRDLADKAKLPGAELEVLSPA-SVPLA--------------------AQGR
A0A379B9V4      IYIQL-LNKMQELDVVKASTIGNVRILDHA-QVFPN--------------------PVAP
A0A1A7QJ97      LYDGL-LQRFEEIGIAGGVGVNNIAIVDLA-DVPQI--------------------PSSP
A0A0Q6TS97      LYNAL-LQRYKEIGVAGGAENNNVAIVDPA-RLPDR--------------------PASP
A0A0Q6UYB4      LYNAL-LQRYKEIGVAGGAENNNVAIVDPA-RLPDR--------------------PASP
W7Q5J0          IYVNV-LNKVQELQVAKAGTIGNVRIIDRA--EIRG--------------------MVAP
A0A087LTV7      HYRML-LDRLTRLEAEAFLQVPSARIAAAA-SPPVA--------------------PSSP
A0A0G9MZA5      IYAGL-LQRYREIGV-VGVGESNVLVVDPA-QVPGG--------------------PYTP
H0T8B0          NYATF-LARFTQTAQQQPVPANSSRIVHEA--GPGF--------------------RIAP
A0A351CXR4      LHDMF-LRRYQEANVSTDTGMVDVQIIEAA-LPANG--------------------PIWA
A0A2N6GLF5      LYSQF-LEKMKEAKETTGLERVRARVSDPA-VPAVK--------------------PIKP
A0A1W9LJP0      MYELL-VKRFKEASLTEEMKTGNIRIIDRA-EVPKA--------------------PVSP
A0A0W1ICB0      LYDGL-LQRYKEIGV-AGVGTNNISVVDDA-VNPVK--------------------PSSP
A0A2E0UL88      LFMIL-DERYQEARINEQTTMGNVDVVDDA-TPPGR--------------------PISP
A0A233IKJ2      LFDLF-LSRQKETSASSDFNATIARFTDFA-NPPLA--------------------PSKP
A0A2T1JE00      LFDLF-LSRQKETSASSDFNATIARFTDFA-NPPLA--------------------PSKP
A0A0T2QIS1      LYDSL-LQRYKEIGV-AGVSISNIAIVDGA-QVPDS--------------------PTSP
A0A376KYN0      VYLQL-LNRQQELSISKSSAIGNVRIIDPA-VTQPQ--------------------PVKP
A0A2X1JB05      VYLQL-LNRQQELSISKSSAIGNVRIIDPA-VTQPQ--------------------PVKP
A0A376RML0      VYLQL-LNRQQELSISKSSAIGNVRIIDPA-VTQPQ--------------------PVKP
A0A377E5P7      VYLQL-LNRQQELSISKSSAIGNVRIIDPA-VTQPQ--------------------PVKP
A0A0P7Y1D0      LFESF-LNRFRQTSEQNDLATADARIVARA-PVPVT--------------------PSSP
A0A2M7JRZ7      LYKGL-LQRMKEAGVSAGLTVSNIQVVYQA-EIPTG--------------------SYKP
X7F6S5          -----------------RPLLLRAAEPARE-PAP-A--------------------PEAP
A0A1P8USW9      TRRAA-IAERREERRKAREDALRRAQEDTE-TVPAA--------------------AAAP
A0A1G7CFZ2      ----------------ARPEARRGQTAPRP-AAPAV--------------------ATRT
A0A2E1D962      ----------------ARAEARRGQTAPRP-AAPAV--------------------ATRT
A0A1I6U4V1      ----------------AVAAPVNASAAPAH-PAP-E--------------------TAPA
A0A1G8NKI0      ----------------AAAEARAAREAENA-RAQ-V--------------------EADA
A0A355QPE4      ----------------AAAEARAAREAENA-RAQ-V--------------------EADA
A0A357RN98      ----------------AAAEARAAREAENA-RAQ-V--------------------EADA
A0A3B8T2U6      LYSSF-FTRLKETNEIGGFERANARILDAA-KPALV--------------------PFKP
Z2EKW7          LYEAF-LNREKETSATSDYKNVTARFTDKA-IIPLF--------------------PVAP
A0A365PWR2      IYLLM-LNRAQELEVMRNGIAGNVHVLDQPVADTIS--------------------PAWP
A0A2E9H5Z8      MLSQM-KLTNSARRIALKIPKNPITILEDP-KLAKD--------------------PVYP
A0A2E2BR79      IYVNL-LNRSQELNLAKAGTIGNVRIIDSA-QVSPS--------------------PIAP
A0A0Q4Q524      LYEGL-LQRFKEIGVAGGVGVNNVSVVDQA-DVPQK--------------------PSSP
A0A0Q4CFJ9      LYEGL-LQRFKEIGVAGGVGVNNVAVVDQA-DVPQH--------------------PSSP
A0A0Q4FE58      LYEGL-LQRFKEIGVAGGVGVNNISIVDQA-DIPQK--------------------PSSP
A0A0Q4JWC8      LYEGL-LQRFKEIGVAGGVGVNNISIVDQA-DIPQK--------------------PSSP
A0A0Q4KFL8      LYEGL-LQRFKEIGVAGGVGVNNISIVDQA-DIPQK--------------------PSSP
A0A2U9NDY5      TYTLL-MNQAQEQDILRAGTIGNVRIIDNAYSMIEK--------------------PSKP
A0A2J4YQQ6      VYMQL-LNRQQELNIAKSSAIGNVRIIDSA-VTQPK--------------------PVKP
A0A0Q4IGG1      LYDGL-LQRYKEIGVAGNIGVNNISVVDAA-NVPQR--------------------PSSP
A0A3M1CJM3      LYQHI-LKRQKEATLAAHQETNNVYKLDSA-VEPLR--------------------PVYP
A0A2R7SVD4      IYTQL-LNKSQELDIVRAGAVGNVRLVDTADVDLSS--------------------PVKP
A0A3C0PWB6      TYTLL-MNQAQEQDVLRAGTIGNVRIIDNAYSMTEK--------------------PSKP
V4Q8B7          TYTLL-MNQAQEQDILRAGTIGNVRIIDNAYSMIEK--------------------PSKP
A0A0Q8XKK5      LYDGL-LQRYKEIGV-AGVGANNIALVDVA-KVPDR--------------------QSSP
A0A2E0Q2W0      LYDAL-LQRYKELDVVGG-GRNNIALVERA-EQPGG--------------------PYSP
A0A142W0R3      LYDGL-LQRYKEIG-AAGVGTNNIAVVDTA-TPSPG--------------------PSSP
A0A0S4XR18      MYSYL-LEKKAEFEIMNAATISKNRILDNA-IVYPQ--------------------PIKP
A0A2E0GW64      LYSNL-LSKIQELSVLRAGTTGDVRILDYA-TLPLS--------------------PLPT
A0A3S1IBR2      LYQTF-LGRYEEAAQQQSFPVGKIRIISDA-SMPMA--------------------ASSP
A0A3S1NZ06      LYQTF-LGRYEEAAQQQSFPVGKIRIISDA-STPLA--------------------ASSP
A0A434DUT4      LYQTF-LGRYEEASQQQSFPVGKIRVISDA-TLPQS--------------------AATP
A0A3S3EAI9      ---------YEEASQQQSFPVGKIRVISDA-TLPQS--------------------AATP
A0A3S1FD32      LYQTF-LGRYEEAAQQQSFPVGKIRIISDA-SMPMA--------------------ASSP
A0A3S1P7J5      LYQTF-LGRYEEAAQQQSFPVGKIRIISDA-SMPMT--------------------ASSP
W7Q8F9          IYINV-LNKVQELQVAKAGTIGNIRIIDRA--EIRG--------------------MVAP
A0A3M2BE89      LYTLL-LNKTQELEVARAGTIGNVRVLDYA-VRPDR--------------------PVKP
A0A257G674      VYEGL-LQRYKELNAAAGINASNIAIIDSA-IPPIR--------------------PSSP
A0A1I1UM01      RQRAR-ARADQVAHGDAGPDGADEQRTDRR-PHIER--------------------APVP
Q44573          VYETF-LEHAKEVVDRAALLQPPISVVSHA-SPPDV--------------------PSFP
A0A167IR75      LYDGL-LQRFQELGVAAGVGVNNIAIVDTA-NVPER--------------------PSSP
A2W025          IYVLL-LNRVQELSVQKAGTGGNIHLIDSA-LRPGA--------------------PVKP
A0A350DWX8      LYDGL-LQRYKEIGVTGGVTSNNISLVDRA-TPPGG--------------------PSSP
V4J283          LYSRL-INAMQELRIAKAGTVGNARIIDYA-LPPTF--------------------PSAP
A0A0Q4UFQ5      LYDAL-LQRYKEIGVAGGVGVNNIAVVDDA-ELPVA--------------------PDRP
A0A432EMV7      LYDAF-LKRLKELDVSGFNSKTRVHIIDKA-VAPEE--------------------VYKP
A0A166Y9U5      LYDGL-LQRFKEIGVAAGVGVNNISIVDTA-NAPEK--------------------PSSP
A0A318KWA2      VEVTQ-AIYVNVLNRLQELQVARAGTIGNV-RIIDD--------------------AEVG
A0A1H3KC95      DDDPG-DASGSARDADAMPALPRQEAPETP-PAAQE--------------------LARP
A0A0B3RZC9      RRAEE-ERLARE-RAEATETV-PPLALTGM-VPVTE--------------------QPAS
A0A2E9HXF7      RDADA-RRTEEDARRKAQPPA-PVLPLTDM-IPVTR--------------------RAEP
A0A2K8U7M6      RHDAL-LARMKSLESAAGPGINPIAIVDRA-QVPRA--------------------PYRP
A0A238KJM1      RRAEA-ANRAEVREATRLAEELPETQADEL-PLAEE--------------------SRPT
A0A3A0FJZ4      RLLGR-QIEAAMGRRLEQSGAALELRVLRE-PFVTP--------------------FPSP
W4HJV8          REVRG-KTYAPGKTSGTRPSLPDTSASCSV-NAVTP--------------------TDPT
A0A0P1GDI0      QAKAE-QAKADRARKTETERRAQEARARAA-LRHDL--------------------TPEP
A0A2R8ATV5      RLIAA-RRRLKIAALTRKKLEAELQRTEAA-ISETE--------------------AEEP
A0A1U7D3R6      REAEI-ARATEKANRDAEAAASEARQIDEA-RQALR--------------------AQRA
A0A2D4UVV2      REAEI-ARATEKANRDAEAAASEARQIDEA-RQALR--------------------AQRA
A0A0W7WHP4      RAAEE-ARLAEEARLKELDARRRALAEARS-IAARR--------------------GADP
A0A238J8F6      REAEA-QRKAQEERAAAEAQR-QAQEQARQ-EQERL--------------------AAEK
A0A238JQI6      RKAQE-ARLADERRKAEAARKSETAAAATA-APYRL--------------------TGED
A0A222E077      RDADA-RRTEEDARRKA-QPPAPVLPLTDM-IPVTR--------------------RAEP
A0A239E3Y2      RDAEV-RRVEEDARRKAQQAPAPVLPLTDM-IPVTR--------------------RAEP
A0A0H6V1F7      ---DLFLARQKETSASGDFNTTIARFTDQASAPLT---------------------PSKP
A0A0H6F257      ------------------------------------------------------------
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      ------------------------------------------------------------
A0A2M9DPX7      --MSKIIDAMKKAKMELDGNKKGGKICKTPDSPIS---------------------EAVP
A0A0B8PTA8      ---LQLLNKSQELAIVKASTVGNVRILDGAESYSA---------------------PVKP
A0A0B8QF75      ---LQLLNKSQELAIVKASTVGNVRILDGAESYSA---------------------PVKP
A0A1C2JGD0      ---MFLLEKQKEAAISRASTITKNRILDTALVHSV---------------------PVSP
A0A259LQ70      --------------MAGGVGSSQVSIVDRAIVPPL---------------------PFEP
A0A3N5PM86      ---ESLLKRVKEAGLTEGLEATNIVVVDPARVPDH---------------------PVKP
A0A2E5YSA4      GEIAEALRRADGANPIGQKERSAENLPRATPGPRD-------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ---SMLLNKTQELDIIRAGTVGNVRIIDHAAADLEN--------------------PVKP
A0A3D2Y902      ---SMLLNKTQELDIIRAGTVGNVRIIDHAAADLEN--------------------PVKP
A0A318DSU0      ---TSLLNQAQQLDIARAGTVGNVRVIDKAAVDISK--------------------PAKP
A0A1W1ZH10      ---QTLLQRLRELDTKAQLQLADSRVVNAALVPAQ---------------------PSFP
A0A1W2FF24      ---QTLLQRLRELDTKAQLQLADSRVVNAALVPAQ---------------------PSFP
A0A1V1PDB4      ---ELLIKRFKETSLTEDMKTGNVRVVDPAEVPKS---------------------PIRP
A0A2M7C324      ---DVFMGELKGTAAVSGMQTVVARVVDPAIVNDT---------------------PIKP
A0A3B7DTA4      ---DALLERYNQLTATAGASANNVSVVDVAEVPSE---------------------PTSP
A0A432ZK62      ---VQLLNRMQELNVLKAGTVGNVRILDEAVTNPI---------------------PVAP
A0A1V5EEP4      ----------------------GGQALKVPKEEPL---------------------PEIP
A0A1V5EF48      ----------------------QAKGVEAVQEETI---------------------AQSP
A0A0S6X1X6      ---DTLLARFNQLNAASGAVSNNITVVDYAEVPTT---------------------PSSP
A0A383M853      ---MQLMNKQQELSISKAGTVGNVRIIDEAETAIR---------------------PIQP
A0A1H5YYQ4      PAVPAPQIDDTERKQAEIRARQAEEAAAAAKARAA---------------------EEEA
A0A1X4NLK2      ---PVAVNAPDSRVAELEALLAEKEALLQRQAELE---------------------AERL
A0A1X4NWB5      ---RTPERNDTPTLDEIDALIAEKEALLRQRAELE---------------------ALRK
A0A1M5UQ38      ---PKAPKKATPPRKDINALLAEKEALLQRKAALK---------------------AEVA
A0A327YI48      ---G------EQAAKLARAEDARRMAAAEEQSRIA---------------------AAQE
A0A1B1PNL6      ---R------AAAQVRVRRQAEEAEREQAERERAA---------------------QEQA
A0A2U8H9H9      ---R------T--------EQGRADQMRTDQIRVA---------------------QIQT
A0A1X6YIC0      ---DDLRPVPPLETRAERLERREAERRTDDRREFD---------------------RGET
A0A1I5E9E9      ---A---QSDTPVQEDIPIPDAEAATPEADEAPLA---------------------LN-P
A0A1X6Z7N7      ---P---HSHSPDQVDALSLDAEAATQEADEAPFA---------------------LR-P
A0A2E1DQ13      ---T------------------GDAAPADPEAALE---------------------PV-L
A0A1H8C800      ---GDVAETSLEERGDERAFPLDPEMRAEPEEAFA---------------------VT-P
A0A2N3EZ05      ---A------------------PDETEPEPEAALE---------------------KG-L
A0A445MZQ4      ------MGKLSDALDRHQSERAVKTLMFRPETDHGL--------------------GTV-
A0A0M9E0E3      TALAFTFEILDNTLKNPEDIREYL------------------------------------
A0A351B422      ------MSFIDKALERAQAARQKDKPKVEE------------------------------
F2NEE9          ------MSFIDKALERAQAARQKDKPKVEE------------------------------
A0A377ZC40      ------------------------MPNNLK------------------------------
A0A378BPJ7      GLVLGFMISVGLVLIRVFLRRGIESPEQLE------------------------------
A0A377ZDN3      ------MASISIVLLRMLLRRGIESPEQLE------------------------------
A0A2J5PAJ7      GFILGGMVSIGLVLLRVFLRQGIESPEQLE------------------------------
A0A447YBN8      GLVFGIFVSAGIVFGRMFLRRGIESPEVLE------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------MERIQSTLEKLEREIALVAYRDNG------------------------------
A0A3N5RNY4      ------MNSTEQVSVKRIKIDAAVVLPDRPRSKIPD--------------------HFAL
A0A2N2G716      ------MSRRTQTQKVAAVDDKPEVVQESASAMT--------------------------
A0A1M7Y300      ------MGNIADALKKAGVELPDHAPVEVRRDDE--------------------------
A0A3S2K5U0      FFVGGAGAVLRELFASGFMAKKQIEEE---------------------------------
A0A2N6BEI9      ------MSRLEKAVEEALKRKGGVS--VASTEDEEG--------------------TPLN
A0A0D5N3E9      ------MSRIEQALEKAAMLRGT----TDRGPAVAP--------------------RQME
A0A318CT66      ------MSKLEKAMERAKQARGIETSPAGAATIPTP--------------------VNKG
A0A3N5P205      ------MSRLEKALKRAKQDR----DDKGASVVET-------------------------
A0A1H4B8T3      ------MSRIEEALKKVSSQRTR----VNQNKSTLR--------------------NKVD
A0A1E7IQC3      ------MSRIQDALNKAASRRKSPV--ESAAEINHA--------------------AAQK
A0A1M6KEN5      ------MSRIEEALKKAASQRSTPSGEEEGNATSSA--------------------LKKV
A0A3N9VAW3      ------MSRIEEALEKAAQLRNN----KRGFDVPGK--------------------ISAP
A0A1G0M8Q7      ------MSRIEMAMEKAARLREE----GKGAQPAAP--------------------EQPN
A0A353MI14      ------MSRIEMAMEKAARLREE----GKGAQPAAP--------------------EQPN
A0A399I453      ------MSRIEKALEKAAQLRNT----TTTVV----------------------------
A0A1G0LDK7      ------MSRIEEALEKAEKLRSA----MFPVSEEKK--------------------SPRE
A0A353QLL3      ------MSRIDQAIEKAARLREQ----RSPEKAHKE--------------------PPAG
A0A354EF47      ----MAVGKVSRALNKAESGFTPDDSPLLTSDNEDA--------------------VSVS
A0A1E7H876      ----------MSGQPAAEPVRKKTIKHQTL------------------------------
A0A2G6MSP7      LVSGIGAAFIAEFFDNTIKNPDEMADRFGI------------------------------
A0A354VPS3      -------EQLDEAIADPSEVEHRLGLPLLG------------------------------
A0A1I3XJ27      PEGPGVLDRIQTAMQKAREEHSPVRLPERS------------------------------
A0A1I7DCG1      ------MEHIHAALQKAKQQRGSDPANDQT------------------------------
A0A3A3H6D9      ------MEHIHAALQKAKQQRGSDPANDQT------------------------------
A0A0Q6VA36      ---------MEQTVVSAQNP-AAHRDGDRM------------------------------
A0A1B2EQN1      ------MEQIHDVLLNSENE-TSVTFAESR------------------------------
A0A1V4M8I1      ------MGKIADALKKAGKEQVPIRHDRGVKPVYQD--------------------RILS
B7RS54          --------MVPEAGHKGAPTMQEINTVADA------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A1Q8QQ99      ------MGRIEEALEKAVRRIVPDTPPPPLRADDNT--------------------PSTP
A0A1I0R9R6      ------MEKLQAAIEKARRQRDGKPRARRSQERSSK--------------------PPAS
A0A443K010      ------MEKLQIAIEKARASRLAQRGVTSHEDSAPE--------------------APVV
A0A212AR83      ------MERLQAAIEKARAQREETR--PDTPPPPAF--------------------AAQG
A0A2E2P4I0      ------MDRLQQAISKARKEREASGDVATSPAQSPR--------------------GVTA
A0A2U2CM86      ------MDRLQMALEKARAKREQAG--APGPETRPF--------------------GDGS
A0A238IZI1      ------MEKLQAALAKARAQRDGEPISRGGRPELSA--------------------RAKS
A0A316GHM6      ------MEKLQAALARAREKREGGTDRPLRTTDVTA--------------------RNRA
A0A1X7ACC1      ------MDRLQQAIQKARVERASRQQEPPDRTAPEP--------------------QPIP
A0A2N3BVE7      ------MEKLEAALNKAREMRQTALGAPQGPGGRPA--------------------PGAA
A0A2S5JE21      ------MEKLEAALAKARQMRQQAMGTRRPVTPGEA--------------------DKSR
A0A2R8BKZ2      ------MEKLEAALAKAREMRKSALGPPDGTGDRVA--------------------MPRG
A0A2S8S361      ------MEKLEAALAKAREMRKSAVGGGDVVRSRTV--------------------AAAA
A0A1E3DAN4      -------------------MVPVTEQPASAPASAQA--------------------PQEP
A0A238KUF6      ------MERLQAAIKQAREMREGTAGRRVRAAQGGF--------------------QSAS
A0A095CTW3      ----------------------------------MV--------------------RPLQ
A0A2E3UGD6      ------MEKLQAALEQARRQRTESASERGPAKAALV--------------------RPLQ
A0A285D390      ------MEKLQKALQKARESREGQALDARPAVTAAR--------------------APVS
A0A2T0RFH0      ------MEKLQAALAKAREKRESLGVDTTRGVKSHR--------------------ASTD
A0A3D5ZY44      ------------------------------------------------------------
Q44570          ---KLGIGLIAVALAAGAVRCCCAITSRRALPRSSA--------------------CAAI
A0A432HIS7      ------MGKIYDALEKSQQYTPNKSSSIDRAHLEAV--------------------EDTD
A0A127AL56      ------MGKIHDALEKAERERYLI-NRSLPKSTPKR--------------------ESGV
A0A1E7JCL5      ------MGKFFEALRKSETTKRQTSARLLPKNVVNI--------------------SPQT
A0A2N2H8D2      ------MGKISEALERHNKENSV--KKSTVPPMFVS--------------------ETLS
A0A2N2KC63      ------MGKISEALERHNKENSV--KKSTPPPMFVS--------------------ETLS
A0A3A4ZYW4      ------MGKISEALERHNKENSV--KKSGSPSMFVS--------------------QTLS
A0A1V4MCJ4      ------MGKISDALDKYQSEKK---EYFYRKSSLSD--------------------QPIR
A0A1V4S7E4      ------MGKIFNALERHKKESSIMTEYLVNKHS-----------------------EGLI
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------MFGSKNTTTAPNDAGAQGAPAGPRPLEQTH--------------------ARQP
A0A1W9M7R6      ----------------------------------MP--------------------LRTP
A0A1M5YLH5      ------MGKLADVLEKAGYGTEGTEKQKPSQSEQPK--------------------NRS-
E8RBB2          ------MGKVFNALKRV----DASEDTVPSAAEQVA--------------------LESQ
A0A3A4S038      ------MGKVFDALEKSNQKI------SIEPLASDE--------------------RKNQ
A0A1F9N669      ------MGKMFEALEKSKNVIADNVGQTKRSLSGDD--------------------QIQR
A0A1F9PFA7      ------MGKMFEALEKSKNVIADNVGQTKRSLSGDD--------------------QIQR
A0A1H2EN09      ------MGKIYNAFKKKESEVFDSV--------MDD--------------------GTEP
K0NP00          ------MGKIYSAFEKKRSEERGLI--------TDL--------------------ETEY
A0A1G5C236      ------MGHFSKALEKRDSERGDKPVVSTPDKVKNE--------------------VPAD
A0A2V2BX84      ------------------------------------------------------------
A0A3S1WTQ1      -----IGGKLGKEEKPGETQVDAKTTQSLS------------------------------
A0A435ZMC2      ---PTIGGKLGKEEKPGETQVDAKTTQSLS------------------------------
A0A3S1X1N3      GYLPTIGGKLGKEEKPGETQVDAKTTQSLS------------------------------
A0A434B8G6      GYLPTIGGKLGKDEKPSETQVDAKTTQSLS------------------------------
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ------MSRIDRAIEIAADIQARRVPESAG------------------------------
A0A2K2H9Q8      ------MSRIDRAIEIAADIQARRVPESAG------------------------------
A0A1F9EUS2      ------MSRIYRALEKAEEEKRQKVREEPS------------------------------
A0A1I6ENM4      ------MEKLQKALSKARQDR------AAQGAAPRR--------------------AAPD
A8LNM8          ------MEKLQAALDKARERREGSVPPSGLSSQRPS--------------------QRAP
A0A2M8J3R9      ------MDRLQQAISKARTQREDVETGAYRDPGAAR--------------------TAPR
A0A1I6X762      -----MTDRLQQAIKKARSERESRVGAS-RPQMPQS--------------------VSSR
A0A0P1EFX8      ------MEKLQKAIEKARSQRRKRAPAQLAVAADKA--------------------IQEE
A0A2G5KB39      ------MERLQAAINKARAQRKT------GVAATEH--------------------VQSK
A0A257F1F4      ------MDRLSEAISKARAAR------GDSPAQAQS--------------------LPAV
A0A2N3CNV1      ------MERLQEALARAREQRRHSERATPGQADAAT--------------------PEKE
A0A2D5J8T8      ------MERLQTAIQKARMQRAGSGPEQYAPAHAPS--------------------ARAG
A0A2E3P9W6      ------MERLQDAIHKARAQRSGSAR----PAHRPS--------------------GPA-
A0A1G9FY29      ------MDRLQTAIEKAREQRAEVLKQRPTNGPLTD--------------------VGFL
A0A2G2B1P9      ------MERLEAALEKARQDR------QTAQIAAVA--------------------DVEV
A0A258GCD5      ------MEKLEAALAKAREMR------KAALGAPET--------------------VREH
A0A2D9YR88      ------MERLQAAIERAREQR-------DTRGATAR--------------------PQPR
A0A443INY4      ------MEKLQIAIEKARASR------LAQRGLTID--------------------VEES
A0A372IH36      GPDGGLSDRDRQRRALERRLREALMQPAEADDAAPA--------------------PDDA
A0A1H9C241      QKRLGREDKTK---LLERVARYSDEIEKQEKAVRAA--------------------MVSS
A0A2E3FCR1      RKEIEQEKPTERPVLMERVAQQAAQTDAQEDAVREA--------------------L---
A0A3E0H727      ------MVALQEVLLNLDNPLYRAYVSHPSQWLASI--------------------AGNV
A0A1G8QZS5      ------MERIQAALKKAREERSQPKSSEPPEQVQTH--------------------ERKP
A0A1V4QMH7      ------MGFIDKALEKAKTVKPTTEESQIHPVPKVT--------------------PVES
A0A1F9BJF7      ------MSFIDKALEKAKALHKKEDKRVISSRPEKV--------------------PADT
F2NDF5          ------MSFIEKAVELAKSSRRQEEGSHRSELEKLL--------------------EQQP
A0A1I3TTC3      ------MDRLHAAIAQARKAREAVLAGAGPAMEAEA--------------------HAPA
A0A1H3IZW6      ------MDRIQAAIARARTAREAVLAGHTAPGPQPA--------------------AQPA
A0A0M6YG59      ------MDRIQAAIARARTERDALLAGH-------R--------------------PEPS
A0A1H7G8B0      ------MDRLQAAIAQARAARQAVLSTQ-------A--------------------GVPA
A0A059IPK4      ------MERLEAAMAKARAARKATKDGEAPDHRPRQ--------------------A---
A0A1H2Y469      ------MERIQAAIQKARESRQDQDEPEKAKGGTSP--------------------ALAF
A0A1E7HSL6      ------MGKISSAIEKSNRENWSTSINKKS------------------------------
W9VVY5          ------MDRARAERQAAL---SGSAAPQRQ---DKI--------------------ATVS
A0A1E2URD3      ------MEKIKDALDKAK---KIQSSSRNI---KGQ--------------------NIIS
A0A2T6MY81      ------MEKLKKALDRAR---DQKNATVTE---NRH--------------------KKTV
A0A1E2ZGQ8      ------MEKIKQALERAR---DLRTSMKRS---DNS--------------------HIAS
A0A2T6NBQ8      ------MEKIKQALERAR---DAKTSTQHR---GNY--------------------QKVV
A0A421K431      ------MEKIKQALDRAR---DNRISKTSL---DKD--------------------RVVM
A0A2G2I5M1      ------MDRIQKALDKAKAKHSEQAIIDVP---STN--------------------EENA
A0A2G2M6F0      ------MDRIQKALDKAKARHSEQAAVGLS---DAK--------------------KEKT
A0A1W9J9F8      ------MEKIKDALAKAKIENTESKSQFKA---ETK--------------------ASST
A0A2S5LFJ9      ------MEKIKDALAKAKIENTESKSQFKA---ETK--------------------ASST
A0A2D8R8F8      ------MEKFDNIITRLR---EQQNAPRRQ---HVP--------------------MDI-
A0A010SNS0      ------MEIIKPDTENSE---QQPSSSLVT---MPK--------------------AMTV
A0A0C2I782      ------MEIIKPDTEDSE---QQPSTSLVT---VPK--------------------AMTE
A0A2N8BYF5      ------MEIIKPDTENSE---QQPSSSLVT---MPK--------------------AMTV
A0A2W7MAV4      ------MEMFNPDTEKTE---QQTSS---------K--------------------AMTP
W6VFG3          ------MEMFNPDTEKTE---QQTSS---------K--------------------AMTP
A0A1P8ENT1      ------MEIINSDTEKAE---QQTSS---------K--------------------AMTP
A0A2N7XRV4      ------MEIINSDTEKAE---QQTSS---------K--------------------AMTP
A0A0Q6QPG8      ------MEIFNPDTENAE---QQTSS---------K--------------------AMTP
A0A059L434      ------MEMFNPDTEKAE---QQTSS---------K--------------------AMTP
A0A0F4UWN2      ------MEMFNPDTEKAE---QQTSS---------K--------------------AMTP
A0A0F4SWA7      ------MEISNPDTENAE---QQTSS---------K--------------------AMTP
A0A423J219      ------MEIINSDTEKAE---QQTSS---------K--------------------AMTP
A0A1H1DBA0      ------MEIIKPASDKGE---PQASSSLVT---TSS--------------------GQPA
A0A2R7TMW6      ------MEIIKPASDKGE---SQASSSLVT---TSS--------------------GQPA
A0A0K1QRZ4      ------MEIIKPDTENTE---PKNSS---------K--------------------AMTP
A0A1H5J974      ------MEIIKPDTENTE---PKNSS---------K--------------------AMTA
J2TAD5          ------MEINKPDTEGDV---QQSSSALVT---TPK--------------------AMTA
J3H699          ------MEFNKTDTEDDE---KQSSSALVA---TPK--------------------AMTA
A0A1G0KSD0      ------MERIKEAIERAK---RERVSVPPP---PQD--------------------AKAD
A0A1D2S760      ------MERIKQALEKAR---QQSAGAAPH---PAH--------------------PSAP
A0A258TN88      ------MERIKQAVEKAR---RLQQGANAS---S--------------------------
A0A1M5GH86      ------MGKIYEALERAKKSPKRETGPR--------------------------------
A0A1W1XQZ5      ------MGKIYEALERAKRSPKQDVPSP--------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------MGKLFDALEKARQDHR--------------------------------------
A0A0F2R2U0      ------MGKIFDALEKS-----NTQAAKSV------------------------------
A0A2G6CSG7      ------MGKIHDALEKAERSKELKVVPDIK------------------------------
A0A2G6NB59      ------MGKIHDALEKAERSKELKVVPDIK------------------------------
A0A1W9U045      ------MGKIFDALEKA-NKENNVSASTEK------------------------------
A0A1F9L9G4      ------MGKIFEALEKS-KHIRSSDTVENQ------------------------------
A0A328FD76      ------MGKIFRALEKAGNKLTPGEKSASS------------------------------
A0A348UX90      ------MGKIFKALEKAGNNVTPEKESELR------------------------------
A0A357Z0N5      ------MGKIFKALEKAGNNVTAEKESELR------------------------------
A0A2M7JX59      PMRGFVMSRVFRALEKAEEEKKQKEKEKPS------------------------------
A0A0W1DLQ3      ------MADADPTTLNSRDTLRLADLPVFTP-----------------------------
A0A246JVD8      ------MADAELTTAINPEFVTLASLTEFTP-----------------------------
A0A2N3BB54      ------MAEADPPPSNDIKMLTLDALPVFTP-----------------------------
A0A0A7PGL6      ------MADADLPLSRDQKLLTLSGLASFTP-----------------------------
A0A1H6G7A3      ------MADADMPLSRDQQLLTLSALASFAP-----------------------------
A0A3A4XVN3      -------MRMKIEKAVDKMKMQWRKADKTE------------------------------
A0A1E7JEV6      -------MYLRKSVEKVKKMPNIAKQSNLS------------------------------
A0A2N2KDY5      -------MNLKNYFPRTKKV--EPREANAS------------------------------
A0A3N5YUD9      -------MSLKQALEKAKKMRSETPAHSGP------------------------------
A0A352B502      ------MSKIEEALEKATRERQGGGHEAGG------------------------------
A0A2K8WHP8      ------MPPLSLTPEQRSHPAPAPGPAPAP------------------------------
A0A410V446      ------MDSIKHAVELARSAEQGARIVQPH------------------------------
A0A0R3KGJ5      ------MDSIKQAVELARAAD-VHHPGTLS------------------------------
A0A0R3N604      ------MDSIKQAVELARAAE-VHRPGALS------------------------------
A0A1N6JQ20      ------MDSIKQAVELARATENMPRQGERA------------------------------
A0A1B1UCM8      ------MDSIKQAVELARAAEVVHRPGVLS------------------------------
A0A1B9Z0F1      ------MDSIKQAVELARAAEAVSRPGALS------------------------------
A0A1M5TI07      ------MDSIKQAIDLARATEGGARRA--A------------------------------
A3X191          ------MDSIRQAVERARAAESTLRNDASG------------------------------
A0A1H4RKV5      ------MDSIKQAVELARAAESAPRNDTGL------------------------------
A0A160UA87      ------MDSIKQAVELARSGDRLAHQE--F------------------------------
A0A1Q5SFV5      ------MESIKQAVELARSGDSLAQQE--L------------------------------
A0A1J5N774      ------MSRIEEALKKATQLRGREEQRQDR------------------------------
A0A2C8F781      ------MSRIEEALKKASQMRNSTR----R------------------------------
A0A2E3R6G0      ------MSRIEEALKKASQMRNSTR----R------------------------------
A0A1F8XMK2      ------MSRIEEAIEKALRMRES---GAAV------------------------------
A0A3M8EMP2      ------MSRIEEILEKATRLREKGPAPGTE------------------------------
A0A2J6J6K6      ------MSRIEQALEKSSKLRERQGEVHPP------------------------------
A0A1G6EKK9      ------MSRIEQALEKAAKMRLG---VTEN------------------------------
A0A0A8WSG4      ------MSRIEKALEKASQLRQR-------------------------------------
S7TK97          ------MSRIEEALSKAAGMKPA---VDGP------------------------------
S7UE93          ------MSRIEEALAKAANLNTN---SGPG------------------------------
A0A3D5BR56      ------MSRIEDAMAKAAGLHSS---SSKG------------------------------
A0A2N2IB15      ------MSRIEDALAKAAGMQAG---FYSK------------------------------
A0A1I3PSR2      ------MSRIEEALAKAAGMQSG---LHSK------------------------------
A0A1I4GEK4      ------MSRIEEALAKAAGMQSG---LHSK------------------------------
A0A2T5R3J5      ------MSRIEKALEKAVQMRQE---KAPE------------------------------
A0A1W7QPT7      ------MSRIEEAMEKAARMRQGMDQSPPA------------------------------
A0A0M4D373      ------MSRIEKALEKASLLREN---QALE------------------------------
A0A1L3GKM9      ------MSRIEKAIEKANQLRQG---APAD------------------------------
A0A430DNP0      ------MAEPPLAPSSPKLALNLVVALALG---------------------------LIL
A0A3A0FQ32      ------MGKVYEALQRAEAERGRRGAGAVP------------------------------
A0A1E7HFN0      ------MSMIKKALQRARKD----------------------------------------
A0A1E4UZA0      ------MERIKQAIEKAKKQ---ASSGFIA------------------------------
A0A1H9KL56      ------MERIKQAIEKAKKQ---ASSGFIA------------------------------
A0A1A9KEF8      ------MDRNTPAHDDSQQ----QS---PP------------------------------
A0A0N9W1V6      -----------------------MT---MP------------------------------
A0A423GQ41      -----------------------MT---IP------------------------------
A0A423H7J2      -----------------------MT---IP------------------------------
A0A1H4N2K9      ------MEIIKPAGDKAEQP---AS---SS------------------------------
A0A2K4KWF7      ------MEIIKPTGDKAEQP---AS---SS------------------------------
A0A2S5ERE5      ------------------------------------------------------------
A0A3E0WXH2      ------MERIKQALEKAKSQ---AAGSTTG-----------------------------W
A0A2N2TRC8      ------MERIKLAIEKAKTG---GQSALAV---------------------------AIE
A0A1V4CIZ7      -----------MPVDQETTA---RDGDTPD------------------------------
A0A1M3BXA5      ------MERIKQALEKARQQ---SVGAAPA---APA--------------------HPQT
A0A1Y2R3U6      ------MERIKEAVEKAKSQ---RVGLQPPLHVAAV--------------------RTAA
A0A167HVD6      ------MERIKLAIKKAKDG---EADSKKS-DSRLL--------------------RGGR
A0A1V3SCT6      ------MERIKLAIEKAKAA---EADSARP-DVPLL--------------------RKVS
A0A1E2UHX3      ------MEKIKKALERAREK--------RSSELIDS--------------------SDQY
G2E3C0          ------MERLKKAMERARAE--------RQASLAGS--------------------AGRP
L0H287          ------MHRLRKAGKRPLAEPADGAGATRVASLAEL--------------------PDHQ
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      MDAGIS---------------NDVQIITAATQSSSP--------------------IGLP
A0A2D5LFD8      LRQPALMKGFEELQSRLXLVQGNLAALTSTQESFRLELAQNSVPWRLLSPPRMNPIPIEP
A0A0N0XAV4      LRAGSI---------------GNVRVIDHANANTEK--------------------PVKP
A0A0P9QD19      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
F3FHG4          LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
F3GGI0          LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0P9LE74      LRAGSI---------------GNVRVIDHANANTEK--------------------PVKP
A0A3M4ZQ14      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A3M5YLE8      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A3M3RP89      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A0P9QIY7      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A0P9VVH7      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A0Q0FJK6      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A0Q0G2J0      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A3M3LF66      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A0P9WIR8      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A3M3KPE5      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A3M4C263      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A3M5AD05      LRAGSI---------------GNVRIIDNADSNIER--------------------PVRP
A0A0N0FS39      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M6GHH2      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0Q0D3D2      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9R9W0      LRAGNI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0Q0B9T0      LRAGNI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M6CFI7      LRAGNI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9JXN0      LRAGNI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M6FIV7      LRAGNI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M4ENY1      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M5EZK7      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0P9SPP5      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M5DM48      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M3NNF2      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9NNS0      LRASSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M6AI26      LRASSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M4WA51      LRAGSI---------------GNVRVIDDADTNVER--------------------PVKP
A0A3M4A0E8      LRAGSI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M4GLF4      LRAGSI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M4PBZ2      LRAGSI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0P9IWP8      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0Q0B3J8      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M5M873      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9VHH8      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9YV98      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M3G2W8      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M6C224      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9PWZ3      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M5K254      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9KZ49      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9PS59      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9V840      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0Q0AIE5      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M2ZQH6      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0N8SQG2      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0W8HFU1      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M5JFB0      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M3TQV3      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M3EF92      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M5J1E2      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M5G7H9      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M4A376      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0Q0A5T8      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9SCD7      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9T4G3      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9VKB0      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0Q0BM35      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M3TPR7      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M3U4Q3      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9UCX7      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9S1F1      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9QCJ2      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9Q329      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M5GJ64      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A0P9MPC7      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M2XYQ3      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0P9XCE1      LRAGNI---------------GNVRVIDNADTNIER--------------------PVKP
A0A3M3EFX7      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M5B9D9      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0P9RRZ3      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M2VEK7      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0N8R9B3      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0P9VA27      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M4YBJ4      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0P9J470      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0Q0EVJ8      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M5UI30      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M5YQT8      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M5F5X1      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M5R8G1      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M5V012      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M3GA16      LRAGSI---------------GNVRVIDNADTNVEK--------------------PVKP
A0A3M3CJL0      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M3F6F5      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M3P9B7      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0N8QB74      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0Q0AUD0      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M5VR55      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0Q0FK97      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M3UCT3      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M5XGQ7      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M5KZ75      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A3M5L3G5      LRAGNI---------------GNVRVIDNADTNVER--------------------PVKP
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      LRAGTI---------------GNVRIIDNAYAVVEK--------------------PAKP
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      VRAGTV---------------GNVRIIDYAEVNTSK--------------------PVKP
A0A454CTF1      IKAGTV---------------GNVRIIDSAQ-SYAI--------------------PVKP
A0A352Q5C1      -----------------------MRVIDHAV-IPDR--------------------PIKP
K0XBA5          -----------------------------------------------------------M
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      AKASTV---------------GNVRIIDNAV-TQPD--------------------PIKP
A0A2A5PQG0      -----------------------------------------------------------P
A0A2J4QEC3      AKSSAI---------------GNVRIIDTAV-TETK--------------------PVKP
A0A2X5NHJ9      AKNSAI---------------GNVRIIDSAI-TEPK--------------------PVKP
A0A3S4JGG5      TKASTV---------------GNVRIVDPAV-TQPR--------------------PVKP
A0A377ZDH2      ----MV---------------TYVSWILPLR-SLVR---------------------LNR
A0A3S4HTS8      ------------------------------------------------------------
A0A2X1JBG5      MKAGTI---------------SNVRIIDEAA-VATQ--------------------AVKP
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      AKSSAI---------------GNVRIIDDAV-VQPK--------------------PVKP
A0A376RY66      TEASTV---------------GDVRIVDPAI-TQPG--------------------VLKP
A0A377K431      TEASTV---------------GDVRIVDPAI-TQPG--------------------VLKP
A0A352MMI7      TEASTV---------------GDVRIVDPAI-DQPG--------------------VLKP
A0A0T9WT26      TEASTV---------------GDVRIVDPAI-TQPG--------------------VLKP
A0A379TA56      TEASTV---------------GDVRIVDPAI-TQPG--------------------VLKP
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
W1AYZ1          ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A345BWI6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3R9TWL5      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A370WI76      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A1V6FYJ1      -------------------------------MHILKALEKQDHEFLKEGGVKGPLDDHLY
A0A0A6PQ76      -----------------------EEVEKKLGLPLLTVLPK-----VKIDKTEDKIKARWM
A0A2M7WWF7      ------------------------------------MVPR-----LKESADSDDAPIRY-
A0A2W4RFS2      -----------------------MSQETDQQPLSLIQYTHT----KVTRTTPDILRQRRT
A0A1Y6DC43      -----------------------MHEITRIQPLGPIRYTRT----KTVPVNYDALREHRI
A0A2S6HE06      -----------------------MIRNTDKYPLDSIRYTKT----HSVMIDPDVLRNNRV
G3J0M3          -----------------------MIKNTDKYPLDSIRYTKT----HSVMIDPDVLRNNRV
V5C6R5          -----------------------MVDSSESDSLDKIRYSKT----RITPLDAEVLQDNRI
A0A1J5DAY8      ---------------------------------MKIFTMGG----GRPGTESPSGRIGIL
A0A356GQV1      ------------------------------------------------------------
A0A3A4NIE9      -----------------------MGGDDPMKIPFLDTLLKE----NTKRPEHESGP--LF
A0A3A4NUI9      ----------------------------MIQFPFF-----K----RNGRPHVKRGPYDIF
A0A1S0ZAI3      ----------------------------------------------------MPTLEIAH
A0A3P6L543      ----------------------------------------------------MPTLEISQ
A0A3N5J7U8      --------------------------------------------MSESRD---------P
A0A3N5FRH4      --------------------------------------------VLDDKL---------V
A0A1V4Y2C3      --------------------------------------------VLDDKL---------V
A0A2N2KTJ4      --------------------------------------------VLDNKI---------V
A0A2N2LQX0      --------------------------------------------VLDNKI---------V
A0A0A6RK76      -------------------------------------------PKLKIGKTDDKMKVMWM
A0A176S762      -----------------------------------------------------------M
A0A3C0L0A8      ------------------------------------------------------------
A0A318D3U4      SPK-----------PVPDTITSKTDVQTGEGAGFVSKALQG---PVDPKL---------V
A0A1W9WUD9      ILGIAL----GIGFAFVLEYLDNTIRFPEEISDYLGIPYMGLVPAFDTDEVLDGMPVELI
A0A1W1ZQK0      QLDDDS----FIEKKSAFPVQGNVKSAMGDLTESSPPSWKE---TSPGILEIRDPHISLI
A0A401FQP5      DEQ-------------------------------TPVLRQK---QSDKKL---------L
A0A1W9PMU6      VLGFIV----GIALAFLRELLDDTVKSAEEIERLTNIPLYG---TIPLIK----------
A0A1Q6DMW3      FPK-------------------EPRITGATIMPSRSPVVPA---GWDERF---------L
A0A3A6P8F8      KIK-------------------SPR-------SFSSYVVGN---GWDERL---------V
A0A1F9NI02      HSA-------------------NIR--------SVQKSISG---KWDERL---------F
A0A2G2DSM4      TAD-------------------RPH--------PPTTPASS---QWDSRL---------F
A0A351Z4H9      KPAPKD----------------------------------I---ALDDRL---------V
A0A2N2KML4      KTSSED----------------------------------I---ILDDKL---------V
E1YJF1          PSLDND----------------------------------T---VFDDNL---------V
A0A1J5EVZ6      APPLPM----PGSARPTAKERRPERPAPQATAEG------Q---RWDERL---------D
A0A2G6FCC5      LQGLDK----ELFNEASNRQSDNQRTSS------------D---LWDERF---------I
A0A1F9MR25      AAEGRE----VMPGPSSTEPQDNQAVQNVEEGLESLGIQLK---DWDERL---------V
A0A2G6M7F1      ASSGRK----VSAG---EEPRSKKRSTRSLSG--------R---KWDDRL---------I
A0A1M6N1X5      ---------------------------------------------------LDVRLLVQA
A0A1G3VVY5      QPEQYQ----ESERATYKDAPKDNIFDKQKVQPSKPAPKDI---ALDDRL---------V
A0A0K9JYB4      PYH------------------------------QLQGHDDL---TMPHVGGEDARVLASR
A0A2N6BZD5      GLT----------------DHQAPPTPPLPPSQAIPPPFRE---NLDTGAMVDNWNERLV
A0A3N5MZ53      LLALLF----GVGAALLLASLDATIKNSSDVAEKLKRPLLG---IVPLLKGNALSVVSTP
A0A355TB56      ILGGVL----GLLAAYLAEFFDRGFRTAPQLEEGTGIPVIG---QVPSLKTISDRPPEDY
A0A0C1TRU6      ---------------------AVPRQTDDVPPRERAGLPPF---PAEPLDGIRHDNPLLA
A0A2Z5SSF4      ---------------------VAPRQMEDVQPRERAELPPL---PAEPLEGIRHDNPLLA
A0A327LYE6      DQE------------DQGATSPDATPEPPAPGRSWPQLASI---PVDAGH-LERNLIITA
A0A3N5Z7F8      FFGIFG----GIGLAFFIEYLDNTIKSSEDVEENLHIPVLG---VIPFSK-IKNQRIENV
A0A239HD34      GRP-----------------------------QVWQSLRPF---DREARE-LKRNRLLAL
A0A0P7ZZE4      STG-----------------------SSGAVEAAWAEIQTS---EIDPRR-LVKRRLISF
A0A369R0Q9      STG-----------------------SSGAVEAAWADIQKS---EIDTRR-LVKRRLISF
A5G4N9          EHKRHV----PEAPQYEFTTRPAEMEKLGWVSPTYHQSRSV---TLDPRA-IAENRCVAF
A0A238LBD3      PAEPAE----PAAKPAAQPAPPQRAPSPKALNAEWAGLPML---DVSPAL-LERNLVITA
A0A0P1FWI8      AEQ------------------PEPEPEPEMAPTFWPLLSRI---SVNPVQ-MDRNLIITA
A0A1V1UJT2      EPE------------------PEPEPEPEPEPASWETLRRV---TLDRRH-LMRNRLISA
A0A0L6CVX1      ----------------------------------------M---PLDTRH-LIRNRLISA
A0A0A0HJJ4      EPE------------------PEPEPEPEPEPLLWPALRRV---VLDPKH-LAKHRLISA
A0A1V0RR48      ALE------------------TPADSRPA--ALLWPALRRV---VLDPKH-LAKHRLISA
A0A2D9ABL7      PLE------------------AAPDPIPAPTPLLWPALRRV---VLDPKH-LAKHRLISA
A0A1S7S3I8      QKMLRL----AVD-----------------------------------------------
A0A354EI73      -----------------------------------------------------MLGLIPF
A0A1D2RNR5      RLALNA----AIGLLAGIVLGLGIVFLMESMDDSIKFADE-----VEKLLQVPLLGVIPK
A0A1F9E324      NKRLNL----LLAAVVGLFLGVGLAFFFEYLDNTVKTADD-----VEELVHLPSFGMVPA
A0A062ME93      NKLIIL----ALSILAGGFIGVLIALLRNMMRSGVKDSTQ-----IETELDLPVYATVPR
A0A3A3BFE8      KKLQVL----LLSLFLGGFIGTLIALVRNILRTGIKDSNQ-----IENELDLPVYATVPR
A0A0L0M4Q4      RNWIVL----LGSVFGGLFISTVSIYLIALHRRELRSPEE-----IDHFSQLPRLAVIAR
A0A2T4ZJZ6      NKPLII----GVAFALGLFLGVVAVFVRKSLLRGIEDPDL-----IEKQLHVPVYASIAH
A0A370WFN4      ------------------------------------------------------------
A0A1T2KYM8      NLERIV----AIATLAGLFLGLLLAFLLDYINDTLKNSQD-----VEEKIGIATLGNLQV
A0A2G9ZR82      KVTLNL----LLAIVVGLMGGIGCAFMVEYFTDTITNPDE-----ISDRFQIPILGVVPL
A0A0A8J8L3      KKIIVI----GLGFVLGFLLSIGLVFLRIFLRRGIESPE------QLEEMGINVYASVPV
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      --------------------------------------------------------MSGD
F5NSX0          --------------------------------------------------------MSGD
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      KKALNV----VLGFILGLFISVGAVLARAMLRRGVEAPE------QLEEHGISVYATIPM
D8EEU7          KKALNV----VLGFILGLFISVGAVLARAMLRRGVEAPE------QLEEHGISVYATIPM
A0A376QQZ0      KKSLIL----VLATILGFIVGCAYVIAREFFNNKIKGTE------DIDALGINVYATIPF
A0A0P1H2H0      -------------LLLTPAVAAVPFDHIPSPDSVTTAPEEQDYPTEPEMDEWPLLGTMPV
A0A258WKV0      SLPKNM----LIGLLLGTAVAVGIALLREIFDDRIRSTDE-----VERKLGLPLLGFTPD
A0A377N8F8      NKPLML----VLMLLCSSFLALGVVLLRNALKRSISSSH------ELEKLGLKVFCSLPH
A0A380AQW6      QKAMIV----LFALLMGGVLSASVVVLRAALHRGIGDTD------TLEKRGISVYATVPL
A0A3C2DSE7      NTRLFM----VVALFLALVAGIAQAIIREILDNTFKSSDE-----VETKLNLPVMGIVPQ
A0A0N0M5F7      NLPVNL----GLSLLAAFVAAIGVIYLRENLDDMLRTVDD-----AERKLGVTGLGMVPR
A0A444IY46      KVVRNL----LLGLILGLFCGIGLAFLLEYFDDTIKSPEE-----LIERFHIPVLGLIPF
A0A3E0WKI3      NRSLTL----AVSVVLGGLLGVFTVFLRNMLRRVVVSPDE-----LEKAFDLSCYAVIPE
A0A1H3I2J1      LPPARS----DAEKARQERLRAAYQASAPALH-------------IEPADRWNALDVMPV
A0A1V5DJV0      QKTQYL----LLGLLAGIIFGGGLAFVQEYLDDTIKDAEG-----ARRELNAPILAIIPH
A0A435NNF5      ------------------------------------------------------------
A0A436XH86      RLSINL----AVALALFMALAASIIYIIELLNNTFTNPEQ-----IEKELGLAMLGILPL
A0A436B5W5      RLSINL----AVALALFMALAASIIYIIELLNNTFTNPEQ-----IEKELGLTMLGILPL
A0A3S2AQS7      RLSINL----AVALALFMALAASIIYIIELLNNTFTNPEQ-----IEKELGLTMLGILPL
A0A3S2FP30      RLSINL----AVALALFMALAASIIYIIELLNNTFTNPEQ-----IEKELGLAMLGILPL
A0A436NMQ4      RLSINL----AVALALFMALAASIIYIIELLNNTFTNPEQ-----IEKELGLAMLGILPL
A0A1V4WHZ7      KKARNI----LLSFVVGLFMGVGLAFFLEYLDNTVKSPED-----VKEHFNAPNLAIIPS
A0A1E5AJN5      RRSRIV----VAAMAVMIMLSIVIIFILELINNRFSNPDQ-----IESELELPLLGIVPF
A0A2N3D2J1      KPLINL----LLASLLGLGLGVIIALARERFDDTIRTPAD-----LSEKLGVPLIGTVPK
A0A2N2GVE1      VLWLNL----ALGLALGMFFGVAFLFLLFYLDNTIKSQEE-----AEQYLGSSLLGYIPL
A0A2N2INV3      VLWLNL----ALGLALGLFFGVAFLFLLFYLDNTIKSQEE-----AEQYLGSSLLGYIPL
A0A1Y5DXG5      KKALIV----VMATMLGGMLAIAIVLVQKALHKGVEDPS------EIEAIGMPVYASVPF
A0A0B8P2H5      KKPLIA----VLATLLGGMLSVAFVLLRAAFHRGIENPD------QIEELGIPVYATIPK
A0A2G2GD62      KKMRML----LMGALLGLIIGVIIAFIRASINNVISNIEE-----IEKRSPIPIYGKIPY
A0A1M7HC79      KKPLIV----VLATLLGGLLAVGLVLVRGLFNRGVESPE------QIEDVGIPVYASVPL
A0A1D3JZN6      RKVIVV----LLAMLLGGMLSVGLVLMRSLLSRGLENPD------DIEKLGLPVYASIPF
A0A1V6ESG1      DMRTNA----MIGLAVGLMLALGLVYLREHMDDSIKHADE-----LEAQFGVPLLGIIPK
A0A328C2K5      QVPLNL----AVGLLLGLFVGGSIMVLIDALDTTVKTEDH-----VTKYTSRPILGMLPA
A0A3D8MRR7      QVPLNL----AVGLLLGLFLGGSIMVLIDALDTTVKTEEH-----VTKYTTRPILGMLPA
A0A437R5U4      QVPLNL----AVGLLLGLFLGGSIMVLIDALDTTVKTEEH-----VTKYTTRPILGMLPA
A0A1H7YHK3      RRPLIV----LVGTLLGGFLAVGLVFLRRIMNPGIEEPS------QIEELGLPVYAAIPL
A0A0P1FRV5      EPETEQ----PSEQ-------------------------------PPGDDGWNDLGPMPV
A0A3M0ZZ99      NRRMIL----GVGALLALGLGFAFALAREIHFDGITSPER-----LETVLGLPVAATLPR
A0A0H4KZM1      P--------------------------------------------RRNRGEPGAWAALPS
A0A090R136      NKALLV----AISVMMGFLLSIIGVLLRAAFHRGIENPD------EIEAIGLPVYASIPM
A0A2E2T3V8      GKNDLW----IAGVLVTLLVSVLIVILRDYFDQAIRSDED-----LKRVFLLPVLGRVPL
A0A367UAB4      RKNDLW----IAGVLVALLVSVLIVILRDYFDQAIRSDED-----LKRVFLLPVLGRVPL
A0A377V641      NKIIVV----LAGLFIGLVISVSLVLVRILLRKGIETPE------QLEELGINVYASIPV
A0A1F2YJ88      KKLQVL----ILSLFLGGFLGTLLALLRNMMRSGIKDSTQ-----IENELDLPVYATVPR
A0A0J7XGZ1      NYLVGA----LAGFVAALLVAGLATGMAEYVEDTVATRAD-----IEGGLGAVYAGAIPT
I4CBA7          DWRRII----AASLFVGLFGAIVVILGPGMLSTGVKTSG------DIKELGLPVLGVIPD
A3VE95          RPKLMA----AFGLVLGLTAGLVAALFLEMTRSTFRTRRE-----VEAETGLSVLASLPL
A0A154VE85      GKAVLA----VLAVLVAAVLAAGIAMLRERLRKGYGSVRQ-----VERSTGLPVLGALPA
A0A1G0NL95      SRNLVL----VMGLIVGLFGGAAVALLRESMRQPLSDARW-----LERRLGLPVLGVVPH
A0A024KA69      KVGLTL----ALAGGVALIFGLLLAFARERVTPGFVDAEE-----AGRRLGLEPILTIPR
A0A168QTU8      RKALII----VLGALFGLMLSMGTVLVRQAFKRGITLSE------QLEAQGMPVLATLPR
A0A0L1KFN4      RLLLNL----AISILAGFGLGAALAFALEQLDEAIADPSE-----VEHRLGLPLLGSVPK
A0A3T9EHW9      KKGLII----LGAIILGLMLSIVGVLLRSLFNRGIESPQ------VLEEHGISVYASIPL
A0A377LY04      KKALII----LGSIILGLMLSIVGVLLRSLFNRGIESPQ------VLEENGINVYASIPL
A0A2T1MXF1      KKGLII----LGAIILGLMLSIVGVLLRSLFNRGIESPQ------VLEEHGISVYASIPL
A0A2X3K9R3      KTALII----LGSIILCLMLSVVGVLLRSLFNRGIESPL------ALEEHGISVYASIPL
A0A1M7BLL7      EVP------------------------------------------APLPLLWPNLRSVPL
A0A358L616      KKILIM----LASLIAGLVLSVGIILLKAMFHHGITAPD------QLEEAGMNVYASVPL
A0A3D5UYX7      RVTLFV----GLGFVLSLMLGCGVAFLLEHFDNGIQTARD-----IEQSLHLPHLVSLPA
A0A2N1WQN5      NKPLVV----IVATLLGALLATAFVYVREALKRGVENPE------DIERTGTPVYASIPF
A0A352G2C2      NKPLVV----IVATLLGALLATAFVYVREALKRGVENPE------DIERTGTPVYASIPF
A0A3C0PZN1      NKPLVV----IVATLLGALLATAFVYVREALKRGVENPE------DIERTGTPVYASIPF
A0A3S1NQ09      RTIVVL----GLSLVLGLLMGAGFGGLNEFNERFFRTGED-----VRDRVNLKFLGYLPT
A0A443GJ52      RTSIVL----GLSLVLGLMMGAGVGGLNEFRERFFRTGED-----VRDRVGLKFLGYLPV
A0A3A0FZC0      RKKLIL----LLGMIVGVGLGVGVALLFNYMDSSIRTPED-----VMHLLKLPSLGVVPS
A0A1N7JVZ7      GAREGG----AEMMNGGGAKASETADEPDSVETDVDRDEPEAGNQVSEAEDTEPKAGQAQ
A0A091C4A8      RLSMNL----AIGLLLGLVVGLLLALLFEVIDDSVKHPED-----VERLLGQAVLGVIPL
A0A435LQD4      RLSINL----AVALALFMALAASIIYIIELLNNTFTNPEQ-----IEKELGLTMLGILPL
A0A3S1MCW7      RLTISL----AIALFLFMALSASIIYIIELLNNTFTNPEQ-----VEKELGLAMLGILPL
A0A434IGN6      RLSINL----AMALGLFMALSASIIYVIELLNNTFTNPEQ-----IEKELGLAMLGILPL
A0A2W6S588      RMLINL----LVGFVAGLAIAVAVAYLRERWSQTINTIDD-----VQRLLGVEFLTTIPT
A0A444I5K6      KRALVV----AFAMFVGCAFGSGIAAFREFRDRFFRTGDD-----VRDVLDVESLGVMPL
A0A3S3UPT3      RARMRV----SID-----------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A435BMN6      RARMRV----SID-----------------------------------------------
A0A3S1THE9      ------------------------------------------------------------
A0A436K268      RARMRV----SID-----------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435LF38      ------------------------------------------------------------
A0A435IRM5      RARMRV----SID-----------------------------------------------
A0A3S2C404      RARMRV----SID-----------------------------------------------
A0A435F6C0      RARMRV----SID-----------------------------------------------
A0A3C1S9Y1      NKSRNI----LLAVVVGLTMGIGLAFGLEYMDNSVKLPDE-----IKQYLGIPYLGPIPA
A0A353EH49      NKFLLD----AVGAMGGMMLGVFFTLFRHGLRNKVDNPEE-----IEQTLGLPVYASVLH
A0A1Y1Q9C1      KKALNV----ILGGLVGLMLGIGAALLRETLNQGVTSVTE-----LQALSGLPILGTIPH
A0A3M7LJH0      KKPLLV----VLATLLGGMVSVGGVLVKAALHRGVENPD------DIEQLGLSVYASVPK
A0A316KRG4      RTVEVS----KPPLIL----------------ERRPEPKVQSQPVFDPETAWYSIDRFPL
A0A1E4JHX8      SLILNM----LVALILGAGIGAALAFALEHIDEAISDPQE-----IADLLGLPVLGIVPK
M2U8P2          SLQMFG----LIGLMGAGLAAAATAAALELREQGYRSRRE-----VERHLGLPVLASVAD
A0A1H7KZF8      SLPLFA----AIGLLLGVVAATLFLLVRELLFVRLRTPAD-----VAARLSLPVIAAIPI
A0A0J5Q9T7      QSGTLI----RPHDPA-----------------------------PVPVDTWARMREFPI
A0A3D3VHV9      KKALIV----VLATLLGGMLGVAIALLRHALNRGIENPE------LLEQIGLPVYASVPF
A0A257NG76      KKALIV----AVSLILGLILGIALVFIRKSLHRGVEDPDL-----IEKQLNIPVYATIPH
A0A1T4TW59      QTTKLI----VISAAFALLIAIMGAFLADAYRNTIEKPDD-----VEEKLGLQQLGFLPR
A0A1Q3MB35      NLPLNL----ALGIIAALGLGAAYVFTREQLDQSLSDPSH-----VSERLGLPLLGTIPH
A0A1I5YYQ0      ESA------------------------------------------ADQDANWRALDTFRV
A0A259LUN7      RKLLNL----IIGCALGVMFGCGLALLLEMLDSKISSTED-----IENTLKTDAIGSVPL
A0A2D7AVL1      SLGKHL----LLATILSLAAGIGLAILWEYIDDTIRVPEQ-----LISKLGLPIIGIVPV
A0A3B9KZE9      SLGKHL----LLATILSLAAGIGLAILWEYIDDTIRVPEQ-----LISKLGLPIIGIVPV
A0A2U0NMP8      KKLIII----AIGLISGFAISLGVVFLRTFLRRGIESPE------QLEDLGITVYASIPV
A0A2G2CXY6      KKSLIA----MIATLLGGFVGVALVLLRHAMNRGVEDPD------VIENLGLPVYAAVPF
A0A3M1D4H3      KLLVNA----VFGIIAGGVFGFGLAFLLEYVDDTVRTPEE-----LSMVWEVPKLGVVPR
A0A447B6K7      KKVLII----VGAVIIGLILSIILVLLKVFLRRGIESPE------QLEELGINVYASIPV
A0A1J5ICP0      KVMRSL----MLAVVVGLFVGVGIAFFLEYLDNTIKNPDD-----VKRITDLPLLGSIAK
A0A0M3GBT1      GRLFYL----VSALLAAISAAVTAAFVMEMWDRSIRSFDQ-----IAGMARTIPAGLIPR
B3Q577          GRLFYL----VSALLAAISAAVTAAFVIEMWDRSIRSFDQ-----IAGMARTIPAGLIPR
A0A379B9V4      KKALVI----ILAFLLGGLLSSFLVLFRNYFQRGIESTA------DVDKTGLPTYAAIPH
A0A1A7QJ97      RLVLNL----LIALLGGMLLGVAIALGLEQLDESIGDPTE-----LQRRLGLPLLGSVPK
A0A0Q6TS97      KLLVNL----VLAMMAGGLAAALVAAGLEQIDEGIVDPAD-----LEEKLGLPLLGVAPK
A0A0Q6UYB4      KLLVNL----VLAMMAGGLAAALVAAGLEQIDEGIVDPAD-----LEEKLGLPLLGVAPK
W7Q5J0          QQSRIT----VLATLLGATLAVGLVLLRALFKRGVETPD------QIESAGMPVYATIPL
A0A087LTV7      KVGLTL----ALAGGLALIFGLLLAFARERVTPGFVDAEE-----AGRRLGLEPILTIPR
A0A0G9MZA5      SLIRNL----LIALVAGLVVVILGLYAYDFLNQTLRDPRQ-----VRDRLGLNLLANIPR
H0T8B0          ISSQIL----MLSALYGLGFGVLASLVRNRTDRGLRTRKE-----VERVAQKPCLANLPD
A0A351CXR4      NQSNTA----AWG-FIGLIFGTLIVGLRFQFDNTFKSHHE-----IEQKLGLPVLSILPR
A0A2N6GLF5      KKSLIV----AIAGMLGLFLGVLLAFLQEHLDNTIKRASD-----LEEKLKLPLLGWLPH
A0A1W9LJP0      NKTRNI----LLGAVLGLMLGIGMVFALEYFDNTFKFPEE-----IKNHLDIPYLGPVPV
A0A0W1ICB0      RLVLNL----AAALLLGLLFAGLTVVILENLDESVREPQQ-----ISDRLGVPLLGAIPV
A0A2E0UL88      DRPKNM----IIGVFFGLGLGFLLAFVARYLDSTIRNPE------DVEKHGIPVLTFVPS
A0A233IKJ2      NRKLIV----LLAFVASFGLACVVAFIADAVNDTFLDIKQ-----VEKQLSLSLLGIIPA
A0A2T1JE00      NRKLIV----LLAFVASFGLACVVAFIADAVNDTFLDIKQ-----VEKQLSLSLLGIIPA
A0A0T2QIS1      DLLLNL----ALASIAGLGLAFLVVLGLEQIDEGVRDPSQ-----IGRELDVALLGSVPR
A0A376KYN0      KKALNV----VLGFILGLFISVGAVLARAMLRRGVEAPE------QLEEHGISVYATIPM
A0A2X1JB05      KKALNV----VLGFILGLFISVGAVLARAMLRRGVEAPE------QLEEHGISVYATIPM
A0A376RML0      KKALNV----VLGFILGLFISVGAVLARAMLRRGVEAPE------QLEEHGISVYATIPM
A0A377E5P7      KKALNV----VLGFILGLFISVGAVLARAMLRRGVEAPE------QLEEHGINVYATIPM
A0A0P7Y1D0      NWMLNL----ALGFILAGMAGAGVIVLLEVFDNGVRSEAD-----VERELGAGHIASVPM
A0A2M7JRZ7      NKKLNL----LLAAVVGLFLGIGLAFFFEYLDNTVKSPED-----VEQLIRLPSFGMVPE
X7F6S5          PSVPG----------------------------------------DGSAAAWERLARFSV
A0A1P8USW9      EPKPA----------------------------------------PQATPLWDALPTFAV
A0A1G7CFZ2      AQSPA----------------------------------------PLQQRGWDDLAEFSV
A0A2E1D962      AQSPT----------------------------------------PLQQRGWHDLAEVSV
A0A1I6U4V1      FRRPIT----HRTA-------------------------------PQAEALWDRLPVFEI
A0A1G8NKI0      ASAPI----------------------------------------PGTDQRWSALTPFPV
A0A355QPE4      ASAPI----------------------------------------PATDQRWSALTPFPV
A0A357RN98      ASAPI----------------------------------------PATDQRWSALTPFPV
A0A3B8T2U6      RKAMLI----LLAFVASLLLAISAAIIKDTLNRGIRSVED-----VERKLNQRMLGLLPL
Z2EKW7          QRMKLV----LIATFFGFAIACALVIILETLREVIRTSND-----VQDKLGVTCLGVIPM
A0A365PWR2      NRKLVV----LGGLVGGFGLALAIVFIRRKLFPSIESID------EIERLGLPVLAAIPM
A0A2E9H5Z8      KVTLFL----SLGAAVGLIFGISIAFFLEYLDTSVKTLED-----VERYLQIPVLAVIPK
A0A2E2BR79      KKGLVI----MSATLLGATLSIGIVLLRAFINRGVEVPE------QLESIGLPVYATVPL
A0A0Q4Q524      RLLVNL----AIALIAGLGISAVLAFALEQMDEAIADPAE-----VERRLGLPLLGSVPK
A0A0Q4CFJ9      RLLINL----AIALVAGLSIGAALAFALEQMDEAIADPGE-----VERRLGLPLLGSVPK
A0A0Q4FE58      RLLVNL----AISLLAGLGLGAALAFALEQMDEAIADPAE-----VERRLGLPLLGSVPK
A0A0Q4JWC8      RLLVNL----AISLLAGLGLGAALAFALEQMDEAIADPAE-----VERRLGLPLLGSVPK
A0A0Q4KFL8      RLLVNL----AISLLAGLGLGAALAFALEQMDEAIADPAE-----VERRLGLPLLGSVPK
A0A2U9NDY5      VRPLVV----ALALFVGLLVSAAVILLRQAFYRGVESPD------VIEKLGVPVYAGLPY
A0A2J4YQQ6      KKILII----LIGIIFGAMVSAGLVLLRIFLRRGIETPE------QLEELGINVYASIPV
A0A0Q4IGG1      RLLLNL----LVSLLAGLAIGSLAAFALEQMDEAIADPAE-----VERQLGLPLLGSVPK
A0A3M1CJM3      RVKLNL----LLAMVVGLLGGIGLAFFLEYLDNTVKTQED-----VERQLGVPFLGLIPT
A0A2R7SVD4      KKALIV----LIATLLGAFVGVALVLLRKSLSRGLEGPE------AIEQLGLPVYASIPY
A0A3C0PWB6      VRPLVV----ALAIFLGLLVSAAVILLRQAFYRGVESPD------VIEKLGVPVYAGLPY
V4Q8B7          VKPLVV----AIAIFVGLLVSAAVILLRQAFYRGVESPD------VIEKLGVPVYAGLPY
A0A0Q8XKK5      RLMFNM----ALALVAGFALAGLATFALEQIDEGFREPGE-----VSKQLQIPLLGSVPN
A0A2E0Q2W0      SLVRNL----FLALLVALGLCGGLVFAREIFDDTVRDPSE-----LRRRLGLPVLGLIPK
A0A142W0R3      KLILNV----ALALIAGFGLAGALVFLLEQLDQSIRDPSE-----VSDRFGLPLLGSIPK
A0A0S4XR18      KRSLIM----MVGFILGLILGLFVAFIKEFFNNKIITPED-----IERITDIPMYGVVPE
A0A2E0GW64      HKSFIV----LASMFAGFTLVAIGLLASHLLLSGEMDPES-----IEELLGISVNAVIPF
A0A3S1IBR2      RTIVVL----GLSLVLGLLMGAGFGGLNEFNERFFRTGED-----VRDRVNLKFLGYLPT
A0A3S1NZ06      RTIIVL----GLSLVLGVLMGAGFGGLNEFNERFFRTGEE-----VRDRVGLKFLGYLPT
A0A434DUT4      RTSIVL----GLSLVLGLMMGAGVGGLNEFRERFFRTGED-----VRDRVGLKFLGYLPV
A0A3S3EAI9      RTSIVL----GLSLVLGVMMGAGVGGLNEFRERFFRTGED-----VRDRVGLKFLGYLPI
A0A3S1FD32      RTIVVL----GLSLVLGLLMGAGFGGLNEFNERFFRTGED-----VRDRVNLKFLGYLPT
A0A3S1P7J5      RTIVVL----GLSLVLGLLMGAGFGGLNEFNERFFRTGED-----VRDRVNLKFLGYLPT
W7Q8F9          QRSRIT----VLATLLGLTLAVGLVLLRALFKRGVETPD------QIESAGMPVYATIPL
A0A3M2BE89      KRALIV----ALGLVAGAFLGILLVFVRKAMQQGIQSPDE-----IEKRLGLSVYASVPH
A0A257G674      NLLRNI----LLALVVGVIGAAGFVYLRMQFDDSVRVPED-----VEGKLNMPLLGVIPL
A0A1I1UM01      ASGRAV----ARAPAVE----------------------------DDPGLIWDTMSSFPV
Q44573          NRKKIG----LGLIAVALAAGAGAVLLRDYFAAGFTEIER-----LRAAVPLPLLAVVPK
A0A167IR75      RLLINL----LVSLLAGIGIG------------------------AALALALEQLDEAIA
A2W025          KKVLIL----SAAVFLGLILGTGVVFLRRNLFQGIEDPDR-----IERAFNLPLYGLVPQ
A0A350DWX8      NLPLNL----MLA--------------------------------LTMGLTLGIIGAFLI
V4J283          NLRKTV----AISILLGLFLSFAMIFLLVKLRHGIEDPDE-----IERALGIPVFGSVPF
A0A0Q4UFQ5      RPLFNM----ALALFAGLVVG------------------------AALAIVFEQIDEGLT
A0A432EMV7      DKQQL----------------------------------------LGIALLLGLFAGIAL
A0A166Y9U5      KLLINL----VVSILAGLGLG------------------------VALAIGLEQMDDAIT
A0A318KWA2      AAPIEP----RKPRIVMLATLLGGMLAMSGVAVRGLLNRGVEVPEQLEEAGLPVYATVPL
A0A1H3KC95      AHPPAT----PRT--------------------------------DSRTSSWDALGRFTA
A0A0B3RZC9      APASAR----APQEPDP------------------------------VDSAWARLAEMTV
A0A2E9HXF7      APTSAP----VTPTPKTI---------------------------VDVEHAWSGLPELTV
A0A2K8U7M6      DLGKN----------------------------------------LSLALALGLLGGVAL
A0A238KJM1      AEIPQR----AQPEQLASPAIATE---------------------PNPSNPWDNLTGFTV
A0A3A0FJZ4      AHLPLF----AGAGGA-----------------------------AGLALGAAALLALAL
W4HJV8          ATDAAT----AFPSLTDTPAGILPARTGDHS--------------DPRDVAWDRLGAIPV
A0A0P1GDI0      EADPES----AEAEPETAPETLP----------------------APFDDPWAQLQTFTV
A0A2R8ATV5      AAEPAP----KLAAPAKVSAS------------------------ADSEAAWEALRSFPV
A0A1U7D3R6      ARRVAP----ADD--------------------------------ADVDDRWARLGSFPV
A0A2D4UVV2      ARRVAP----ADD--------------------------------ADVDDRWARLGSFPV
A0A0W7WHP4      DGPAAP----PRPDPERQPAPQSSRPGRPPPLALTNPAERAERVEAATRAAWARLDSFAL
A0A238J8F6      AAQEQR----DAL-AAQQAA-------------------------DAAKTPWDRVPEFTL
A0A238JQI6      AVAPSP----SPS-PDAPPV-------------------------DDT---WAQLQEITV
A0A222E077      A--PTT----APVTPTPKTI-------------------------VDVEHAWSGLPELTV
A0A239E3Y2      APDPAP----APVTPTAQPV-------------------------ADVETAWSVLPELTV
A0A0H6V1F7      NKKLIV----LLAFVVSFGFACVVAFIADAMTDTFADIKQVEKQLALSLLGVVPVVRKQR
A0A0H6F257      ---MIV----LLAFVVSFGFACVVAFIADAMTDTFADIKQVEKQLALSLLGVVPVVRKQR
A0A0H6GCF1      ------------------------------------------------------------
A0A0H7B811      -------------------------------------------------MGVVPVVRKQR
A0A2M9DPX7      KAVVGK----GAGENAGQLSPVGGNCGGGALG-AIETRSTGPRRGEPLLAMDPNL-----
A0A0B8PTA8      KKPLIA----VLATLLGGMLSVAFVLLRAAFHRGIENPEQIEELGIPVYATIPKSAQQEK
A0A0B8QF75      KKPLIA----VLATLLGGMLSVAFVLLRAAFHRGIENPDQIEELGIPVYATIPKSAQQEK
A0A1C2JGD0      KASKAV----LIGAFLGLLLGLAVVFARFLLHKGFHSDEGILSRY---------------
A0A259LQ70      NLPRSL----IQALILSLAAGIGLAFGLSYIDDTIKTPEDVKQKLGLAAVGVIPKVKASK
A0A3N5PM86      RKARNF----LLAIIVSLALGVGMAFFFEYLDNTINTPDELERYF---------------
A0A2E5YSA4      --------------DRADAVGSADHPPHSPLPTGVTKETRIGRSIQSLRHERDDPAPPAR
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      NKPLVV----IVATLLGALLATAFVYVREALKRGVENPEDIERTGTPVYASIPFTEKQAT
A0A3D2Y902      NKPLVV----IVATLLGALLATAFVYVREALKRGVENPEDIERTGTPVYASIPFTEKQAT
A0A318DSU0      KKVLAV----LGSTFFGGFLAVAFVLVRQMLHRGVEDPSVIEELG---------------
A0A1W1ZH10      NRKLMF----FVSVAFALVLGGAIAVLREHFVGGFTSEEQIEPVLRAKLATVIPKQTPDA
A0A1W2FF24      NRKLMF----FVSVAFALVLGGAIAVLREHFVGGFTSEEQIEPVLRAKLATVIPKQAVDA
A0A1V1PDB4      RKRLNI----FLGIVFGLFVGIAVAFAFEFLDNTLKSPEDI-------------------
A0A2M7C324      RKFLVV----STAFVLSLLLAIAIAFLMEYLDNSVRSAEDAERKL---------------
A0A3B7DTA4      SFPKNI----AIALLLGMGTAAAFVFLKDHFDDTIRSPLDVEGKL---------------
A0A432ZK62      KKALIV----VLATMLGGMASVGYVFVMAAFNRGVEPAEQIEELGINVYASVPESPLQQS
A0A1V5EEP4      EPRFAS----AAAPVSITVPDEAEITAAKVPEPQPLKTPAPISIPLPDEVVFPDFDEKL-
A0A1V5EF48      EPKFAG----AAAPVSIAMPEEVEAPPAKAPDPQPARVAPPIPLPVPDEVVFPDFDEKL-
A0A0S6X1X6      KMLINL----VIALLIGLVVSALVILLREYFDDAIRSPEDVERKL---------------
A0A383M853      QKMLIV----LLALLLGAGGAAAVVLLRAAFHRGINDIDTLEKRG---------------
A0A1H5YYQ4      ERQRLA----EQLRRVEEERKAEARRQAEAEQAAAAQSAQPEPEYVPDAPTLSD------
A0A1X4NLK2      QEVARK--------KDAERAERLESERKLAAELESRKQR--------EAELEAERAREVR
A0A1X4NWB5      KEAARD----AERVRAAEEAEEQARKEKAARDAELKAQRAAEREARLEAELVAKREAELE
A0A1M5UQ38      RKKAQA--------TQVSERPAPTVTTTDAKPRTKSRPLVLASPPRPKAPKTPEPKHDP-
A0A327YI48      AERQHK--------LTAERQAEADRRAAAERQGEVERLAEVERRAKAEQQAEAEHQAQAE
A0A1B1PNL6      EREQAE--------MEAARRELASLRP--TAPAASAEQLAPAQTVPPAAEAPARPPRRAV
A0A2U8H9H9      EQHRAE--------VETARRQPAATRARTVTPLPAPEPLAP----RAEAADPAPAPRRPI
A0A1X6YIC0      DRRTAE--------RRAADPDPAPAVAKAPEAASPGAIETPAPSTADAAHAPAHATTRAV
A0A1I5E9E9      ENIEPP--------LAEKPLAPEPAAQQLPEP-EPEPEPDDAPDVADESEGAP-------
A0A1X6Z7N7      EMIAPP--------LDQEPLAPEADGQQLPEP-EPEPEPEPEPEPEPEPEPEPEPEPEPT
A0A2E1DQ13      ARPRGS--------STIPEPEPEPSAATHAE-----------------------------
A0A1H8C800      ESLDSP--------EPEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPEPEPEPEPEP-
A0A2N3EZ05      ARRGDP--------VTLSEPEPEPEPEPEPEP-EPEPEPEPEPELSPEMEADAPPDSGA-
A0A445MZQ4      -----------------------------------------------------MQKEF-D
A0A0M9E0E3      ---------------------------------KIPYLGPVPTFDL-------EKEGVDK
A0A351B422      ---------------DIKAPWAENSRKPLPVAGSVGYAGPVKDICYTTTKTYPVDMKLLA
F2NEE9          ---------------DIKAPWAENSRKPLPVAGSVGYAGPVKDICYTTTKTYPVDMKLLA
A0A377ZC40      ---------------KMVL----NVYASIPLSDW--QLKNVNNSR---------KKDKKK
A0A378BPJ7      ---------------EIGI----SVYASIPVSES--FTKKINNSNKVKN-----VKAAEY
A0A377ZDN3      ---------------EVGI----NVYASIPVSDT--LSNYNQKKGIRIR-----ADKLEH
A0A2J5PAJ7      ---------------ERGI----NVYASIPISEA--FTKKAVQTYGLRK-----KQQDEY
A0A447YBN8      ---------------ELGI----NVYASVPVSEW--LTQKQSKTGKVITKKALLKQKEET
A0A0Q6QV61      -------------------------MRSREEENQITW-TELPPLKI-------DPDAI-A
A0A2Z3IKG4      -----------------------MPPLPPSQASDPVW-KKLPQVRL-------DRKHT-A
A0A3N5RNY4      SIWQGT-----------------------------------------------EAETLPA
A0A2N2G716      -----------------------------------------------------GISRFTD
A0A1M7Y300      ----------------------VVAAEEPSSYQESTYTVTNKRAPAVDASQPLQSGPW-N
A0A3S2K5U0      --------------------------------------LSVPVLASIPRMAGWSRDAH-S
A0A2N6BEI9      SPPVET----PGEGDAALLSGQTEPSLPPLRERINEL----------------VVRYR--
A0A0D5N3E9      DVQPLE----RAELPPLPAEPLE--GIRH----DNPL----------------LATLN--
A0A318CT66      RRLEPI----DPVYTQTRVYPFDKALLEK----HGVL----------------TTAF---
A0A3N5P205      -RQRLT----DLEYTQTRVEKTSDAVLKK----SGVL----------------TSFI---
A0A1H4B8T3      DAAPIR----PKTVKNMINSLLDVVPLKI----DHLM----------------LATAR--
A0A1E7IQC3      NELVSE----SQLPEKQFSNLLDVPPIKV----DNLM----------------LATAR--
A0A1M6KEN5      DSKISP----SPDAGEGFSSLLEVPPIKV----DNLL----------------LATAY--
A0A3N9VAW3      APSMVS----P----TTQYPPLTEAAVAL----ASPM----------------LVTAT--
A0A1G0M8Q7      QPASNR----PVPGAVHTAPPVAARALAP----KNPF----------------LVNLL--
A0A353MI14      QPASNR----PVPGAVHTAPPVAARALAP----KNPF----------------LVNLL--
A0A399I453      EQITNY----PENSNYSSQTVSRTLDIKP----SSRL----------------LTTII--
A0A1G0LDK7      HVPPPM----P-------GVALKITN---------QL----------------LVSAG--
A0A353QLL3      RPVAET----P-------STPARVVDVSC----VSPF----------------IVALN--
A0A354EF47      VTAEPI----ERKSPASEPALHPQPAG--------------------------SIENW-D
A0A1E7H876      -----------------------------------------------------SSSEAWD
A0A2G6MSP7      --------------------------------------PVLGLIPF-------DKEAEED
A0A354VPS3      -----------------------------------------------------SVPKV-D
A0A1I3XJ27      ------------------------IPSVHSV-GDALW-AKLEAGRL-------IPDQA-T
A0A1I7DCG1      ------------------------ATTVARMGSDMLW-ASLPSLKP-------DPKHL-A
A0A3A3H6D9      ------------------------TTTVARMGSDMLW-ASLPSLKP-------DPKHL-A
A0A0Q6VA36      ------------------------PVSRSQELSQIAW-DALSPLVI-------DHDAI-A
A0A1B2EQN1      ------------------------ASSFPPD-ENLTW-MRLRQMKV-------DESRA-A
A0A1V4M8I1      GTDVHT----GKEPGSTPRV---------------------------------LQGPV-D
B7RS54          ------------------------------------W-RNLPATDL-------DATTL-A
A0A0T5NSU3      ----------------------MPPKTGQSDTDRPAW-EALEALQI-------DGKRL-L
A0A1Q8QQ99      PANM-------------------------------------------------DPEQVTD
A0A1I0R9R6      MPEA--------------------------------W-AELEPFDI-------SASLA-Q
A0A443K010      TLAEQV----GA------------------------W-AALPEMTL-------DPKVL-E
A0A212AR83      AQAYAD----ADGTEA------A-------------W-AALRPLDT-------TRPAYSR
A0A2E2P4I0      AQAVAR----QAVPPA------G--------DVTARW-AALNPLQV-------TSKTV-R
A0A2U2CM86      KPSAVE----PAKPEP------PREKQATPVEMPEVW-KVLAPLHI-------NEKEM-I
A0A238IZI1      RRIAES----EAKDSV--------------------W-SAIPLFEP-------TARRM-Q
A0A316GHM6      RRAAKD----GAIGER--------------------W-ASIGMFEA-------SPKRM-H
A0A1X7ACC1      IQKDEV------------------------------W-SSLPEIEL-------DQRTA-A
A0A2N3BVE7      AAVVAA----VPDQFD--------------------W-LALPAISV-------PVGKA-R
A0A2S5JE21      PESRAD----A-------------------------WIDAFQEIVL-------DPARL-E
A0A2R8BKZ2      AEPVI-----V-------------------------W-AALPEIAL-------SPGKA-R
A0A2S8S361      PVATT-----G-------------------------W-EDLPEVTI-------SPEMA-M
A0A1E3DAN4      DQVDSA------------------------------W-AGLAEMTV-------DKGHL-D
A0A238KUF6      LPTQDA------------------------------W-AALSPLEV-------KPPKG-K
A0A095CTW3      QNVVEA------------------------------W-DALQPLSA-------DPKLL-Q
A0A2E3UGD6      QNVVEA------------------------------W-DALQPLSA-------DPKLL-Q
A0A285D390      TE--GP------------------------------W-AELAPFTP-------DPAVL-H
A0A2T0RFH0      HEIADR------------------------------W-SSIRRIDV-------SERKK-E
A0A3D5ZY44      ----MA----GAGTIVLLEVFDNGVRTEADVERELGV-AHIASVPLLGQGRFGRKRSG-K
Q44570          PLPLLA----VVPKVGGRT-------------------------------------EQ-T
A0A432HIS7      VKKTSS----PFPLRLNFTNR-----------------------------------PL-D
A0A127AL56      ENIEVQ----APTLPKAEKD------------------------------------II-K
A0A1E7JCL5      IEKSPL-----------PQS------------------------------------AM-D
A0A2N2H8D2      GPEARL-------KPLGPLS------------------------------------GY-D
A0A2N2KC63      GPEARL-------KPLGPLS------------------------------------GY-D
A0A3A4ZYW4      GPETAL-------KSLGPLS------------------------------------GY-D
A0A1V4MCJ4      AEEREI----VSSQDLVQDR------------------------------------GF-S
A0A1V4S7E4      PHKDEL----ALARKITRES------------------------------------NY-N
A0A0F2NF69      ---------------MESFNEQHRLAKSLSG-------------------------KW-D
A0A1F9NFD0      ---------------MESFTEQHRPAKSLSG-------------------------KW-D
A0A1W9M770      ----VP----PSFPSPHATTGGKQGREPRGE-------------------------NW-D
A0A1W9M7R6      ----VP----PSFSSPNPTTGGPQGNEQRPR-------------------------NW-D
A0A1M5YLH5      ----AK----PVERAAPAPRTKLVRSNDNSG-------------------------KW-D
E8RBB2          NFPEVD----SRETGHTHEDEAADRQSPRQG-------------------------RW-D
A0A3A4S038      DRDDSA----QVEGRSQSNTA-----------------------------------RF-D
A0A1F9N669      SFSEPS----VITSDKEKKKSISEIDPNLPQ-------------------------NL-D
A0A1F9PFA7      SFSEPS----VITSDKEKKKSISEIDPNLPQ-------------------------NL-D
A0A1H2EN09      VPEETE----YEFCISDADTSISEPYEEIPEKEV-------------------MPGNI-D
K0NP00          VSEEPK----NDFYVSNSDISMAEPYEEIPE-------------------------NI-D
A0A1G5C236      GSRADD----HRAAEQ-------------------------------------KPGAA-G
A0A2V2BX84      --------------------------MPKKSKKDLSR-KLIQNLDI-------EP-----
A0A3S1WTQ1      -----------------------------------------------------SAEKR-A
A0A435ZMC2      -----------------------------------------------------AAERR-A
A0A3S1X1N3      -----------------------------------------------------AAERR-A
A0A434B8G6      -----------------------------------------------------AAERR-A
A0A3S1PSR2      ------------------------------------------------------------
A0A436BIA6      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A1X0YE57      ----------------------SRVAAERTADRVGCY-PVVAPIQV-------ESEWL--
A0A2K2H9Q8      ----------------------SRVAAERTADRAGCY-PAVAPIQV-------ESEWL--
A0A1F9EUS2      ------------------VQIFEEKAVLKKEEPTLIF-PEEKITNIEKIKEF-DLPSK-E
A0A1I6ENM4      TPAASA----AARAPA-------------PSATDAAW-AGLAPIEL-------DDAHL-T
A8LNM8          L--------------------------------EDRW-KALKPIHT-------DPKIL-R
A0A2M8J3R9      TGRDRA----RRGAAS-------------ATEVAANW-SEFAQLEL-------SDRTV-E
A0A1I6X762      APQKR-------------------------TPVQDAW-QRLTPLIV-------DPKAV-V
A0A0P1EFX8      VPSNR-------------------------T--TDPW-LDLTPLDI-------SKTDV-R
A0A2G5KB39      TTDKK-------------------------L--VENW-ERLAPVVM-------DPKQS-A
A0A257F1F4      TTKAPV----RRWHPE-------------DI--TARW-QALKQVSL-------SRRKL-E
A0A2N3CNV1      RPAPAR----QAPAGP-------------RA--QARW-EDLAPLQI-------RPVAL-K
A0A2D5J8T8      LSDPRP----R----P-------------GL--EERW-QALQPLEL-------NKTKL-V
A0A2E3P9W6      -EAHQP----S----P-------------GV--EDRW-AALKPLQF-------SKKKL-L
A0A1G9FY29      PETVEH----L----P-------------SR--EEIW-QGLQSVDM-------TARAL-R
A0A2G2B1P9      VEPVVK----P----A-------------PI--LDPW-DTLKEVKL-------SPRVA-R
A0A258GCD5      --VVQK----D----G-------------RG--AASW-ESLPEITV-------SAGTA-L
A0A2D9YR88      GTVQDK----S----G-------------A---DEAW-AALPEIKL-------QRRQM-L
A0A443INY4      VSVAAP----T----E-------------QR--AEAW-SALPEMTL-------DPALL-E
A0A372IH36      PPAPAD----AATAPR------------PQADP-AIW-GRLPRIPV-------EPRRL-D
A0A1H9C241      ERAPTV----AAVPSA------------PEVKQVDIW-DMLPTVPV-------DEALL-E
A0A2E3FCR1      -----R----ADIPAQ------------P-----DLW-AELALIPV-------DGRQM-D
A0A3E0H727      NIFVFA----QLTLRPIEPKKSLIVVLATIPASDAQD-KLVKKLQK-------KGGSL-A
A0A1G8QZS5      DPLILE----QSHSVG---------------DTEQLW-KAVKGFNP-------SDRWL-K
A0A1V4QMH7      HSLFTG----MEMPVE-----------------EIQY-HVTRSVPV-------KADWL-R
A0A1F9BJF7      PSVQAA----IPTERE-------------VIPPEISY-TVTRTVAV-------DPEVM-R
F2NDF5          LSDLEE----APYPEE-------------I--KDIAY-SLTKTVPI-------QMETM-V
A0A1I3TTC3      YSDPSM----FQAPKPRRPVAPVEDATVTTSDPDAAW-AALPYHAP-------PVDAL-L
A0A1H3IZW6      VSPRPA----DPVPEP------------AKSTTDQSW-DALQWFEP-------DPAHL-T
A0A0M6YG59      AVAPQP----DAIVTP------------TPGAAD-AW-SALPIFKP-------DAAHL-E
A0A1H7G8B0      TTPEQA----VSL------------------PKD-NW-QALTRFEP-------DTDHL-T
A0A059IPK4      PQPDSG----RPIKDV---------------RPEALW-TALHEIPI-------GNALA-R
A0A1H2Y469      EHDQQD----QILPHS---------------SADQLW-AELTKIQL-------DPRQL-H
A0A1E7HSL6      -------------------------ETDPPPPNITTF-KEFGLLR--------KNRNI-D
W9VVY5          RLEPAQ----P---------------KPPATDVKVDY-TRTATVRI-------DADEL-R
A0A1E2URD3      SDNRN-----------------------YLDLENINY-TKTKKVKV-------SEELL-R
A0A2T6MY81      SQSPE-----------------------SVDLTKITY-TSTKSINI-------PAEFL-R
A0A1E2ZGQ8      QQTAE-----------------------PEFPTKITY-TKTKSVEI-------SKDLL-R
A0A2T6NBQ8      RKSPE-----------------------PEFTSKITY-TKTKSVEV-------SKNSL-R
A0A421K431      SKDPE-----------------------SDFTSNITY-TKTKSVEL-------SQHNL-R
A0A2G2I5M1      ISSPID--------------------PLKSPIDNISY-QQTRVVET-------SRDHL-E
A0A2G2M6F0      ISQLED--------------------PLKSPIDNISY-QQTRVVET-------SRFHL-E
A0A1W9J9F8      LLQSGV----VSQKEI------KSFPNTENELGMINY-LNTPVIKL-------DSAHL-E
A0A2S5LFJ9      LLQSGV----VSQKEI------KGFPNTENELGMINY-LNTPVIKL-------DSAHL-E
A0A2D8R8F8      --------------------------DERYEPGVIEY-TRTRCVDL-------DEGRL-A
A0A010SNS0      T-------------------------GQSAGLNALSY-VQTKVVPL-------RPEHL-E
A0A0C2I782      T-------------------------GQSAGLNALSY-VQTKVVPL-------RPDHL-E
A0A2N8BYF5      T-------------------------GQSAGLNALSY-VQTKVVPL-------RPDHL-E
A0A2W7MAV4      T-------------------------AQSTGLNALSY-VQTKVVPL-------RPDHL-E
W6VFG3          T-------------------------AQSTGLNALSY-VQTKVVPL-------RPDHL-E
A0A1P8ENT1      T-------------------------AQSTSLNALSY-VQTKVVPL-------RPGHL-E
A0A2N7XRV4      T-------------------------AQSTSLNALSY-VQTKVVPL-------RPGHL-E
A0A0Q6QPG8      T-------------------------AQSTGLNALSY-VQTKVVPL-------RPDHL-E
A0A059L434      T-------------------------VQSTGLNALSY-VQTKVVPL-------RPDHL-E
A0A0F4UWN2      T-------------------------AQSTGLNALSY-VQTKVVPL-------RPDHL-E
A0A0F4SWA7      T-------------------------AQSTGLNALSY-VQTKVVPL-------RPDHL-E
A0A423J219      T-------------------------AQSTGLNALSY-VQTKVVPL-------RPDHL-E
A0A1H1DBA0      P-------------------------APT--LNALSY-VQTKVVPL-------RADHL-E
A0A2R7TMW6      P-------------------------APT--LNALSY-VQTKVVPL-------RADHL-E
A0A0K1QRZ4      T-------------------------AHSSGLNALSY-VQTKVVPL-------RPDHL-E
A0A1H5J974      T-------------------------AQSSSLNALSY-VQTKVVPL-------RPDHL-E
J2TAD5          T-------------------------GHSAGLNALSY-VQTKVVPL-------RPDHL-E
J3H699          T-------------------------GHSAGLNALSY-VQTKVVPL-------RPDHL-E
A0A1G0KSD0      ASRDGG----GRAAED------PDSRPKDSSLRSVKY-QQTKVVEL-------DMEHL-A
A0A1D2S760      ALTAPA----AAAQQA------D---ALASGAIEVNY-TQTEIVRL-------DRATL-E
A0A258TN88      --TAPA----ARTRPV------P---AQFTDIESVDY-RHTRVAPL-------DAAHL-E
A0A1M5GH86      ----------------------------------------RGVVVP-------SLPAS-P
A0A1W1XQZ5      ----------------------------------------QRVVTP-------SLPKS-T
A0A3D6C3I2      ------------------------------------------------------MDGL-H
S0G1D4          ----------------------VQEDEVPVHTVKTGE-IPANDRQI-------LPKTV-H
A0A0F2R2U0      ---PLP----HVRTDI------VNGKGADRIVPIS-----NSNKLT-------SEHKL-D
A0A2G6CSG7      ---PAP----ALRKPA------ASTVEVIPPAQVKSP-SVQRRPET-------EYNRL-D
A0A2G6NB59      ---PAP----ALRKPA------ASTVEVIPPAQVKSP-SVQRRPET-------EYNRL-D
A0A1W9U045      ---ASR----FK----------VYDRKVMEKEASG-----AIKTVL-------GNKGI-D
A0A1F9L9G4      ---ENP----FS----------GDDQRQMDTIKESTL-PMEEADLD-------LPKNL-S
A0A328FD76      ---DDT----AM----------VSDDSDTQVSELS-----ETTVQP-------FSIHA-N
A0A348UX90      ---DNT----AL----------VCDDPDNQVYKQS-----DEVTQS-------GSSRT-Y
A0A357Z0N5      ---DNT----AL----------VCDNPDSQVYKQS-----DEVTQS-------GSRRT-D
A0A2M7JX59      ---LKV----FEEKTV------LKKEAPTLKFPKEKI-GEIKAL---------ELPSK-E
A0A0W1DLQ3      -----------------------------------------------------EKSRI-S
A0A246JVD8      -----------------------------------------------------PVTEI-R
A0A2N3BB54      -----------------------------------------------------PVKAI-R
A0A0A7PGL6      -----------------------------------------------------PLTAI-K
A0A1H6G7A3      -----------------------------------------------------PLTAI-K
A0A3A4XVN3      -----P----AVQKKN------FRYDSSIKQWKPPVY-SRSRSVEL-------DQTAV-I
A0A1E7JEV6      -----E----NL------------PEREEAGWTKVAN-REIKCVDL-------EEKKA-V
A0A2N2KDY5      -----K----NFMPLI------MPADKEKIGWVSPVY-SKSRAIKL-------DPDTL-A
A0A3N5YUD9      -----P----EVQTAV------SDSPQRPAEWKSPAY-LNSQRVEL-------NPAVL-T
A0A352B502      ----------------------VPQRSSVREAHTAVV-AEVAVVNP-------DPLHL-A
A0A2K8WHP8      --------------AP------APRPEARRPQPDTAW-LDLPVARF-------ELGQL-N
A0A410V446      ----------------------SVGPQ------GNAS-DAIREIRL-------NSAHL-E
A0A0R3KGJ5      ----------------------GPPLAADGSLHSSAE-SQHNEVRL-------RADHL-E
A0A0R3N604      ----------------------GSALAAEGPLQRSAE-SPFNEVRL-------RADHL-E
A0A1N6JQ20      ----------------------PGLSAGVRP--GSVD-ARTREVRL-------NSAHL-E
A0A1B1UCM8      ----------------------GSALAANGPLQRSAE-SPINEVRL-------RADHL-E
A0A1B9Z0F1      ----------------------GSALAAEGPLQRSAE-SPFNEVRL-------RADHL-E
A0A1M5TI07      ----------------------VSVPDPARP--GLHD-PQFRQVRL-------SEADL-E
A3X191          ----------------------LADLAGMTR--QDPF-DQVTEVLL-------DQAHL-E
A0A1H4RKV5      ----------------------AGAFGISRQ--TTSD-TQIRDVRL-------NAAHL-Q
A0A160UA87      ----------------------IGGSKPIAT--GQEP-ASASEVRL-------DVDHL-E
A0A1Q5SFV5      ----------------------IGGSKPIAR--GHES-TSVREVRL-------DADHL-E
A0A1J5N774      ---AIP----TGPHGG------ESANDLGRAPRKEIP-QEVL-----------DRVAG-Q
A0A2C8F781      ---TET----FDPPSE------EAINR--KLVESSVT-AEAI-----------ERVKG-Q
A0A2E3R6G0      ---TET----FDPPSE------EAINR--KLVESSVT-AEAI-----------ERVKG-Q
A0A1F8XMK2      ---KER----APLDPK------HSPVVPEYDDSNTL-----------------EIQCD-N
A0A3M8EMP2      ---SSA----SAPLKV------DLASRPLVSPDYGT-----YTVDN-------KIDVT-N
A0A2J6J6K6      ---LPV----APVLGT------DPDMSRLQTDC--------------------PVQVD-N
A0A1G6EKK9      ---QVG----YVSAAR------LKPTPPQTSPEIFTP-PEG------------SLKIN-N
A0A0A8WSG4      ----------MPDVQP------EPVEFPPSTSNVQAS-SEYPLQTV-------VTEIS-N
S7TK97          ---RPS----QAKSVA------ASKCCPMPETPEMN-----------------KVSVR-E
S7UE93          ---LER----SGRHGR------KVGRSPLVEPQITP-----------------VQQVP-E
A0A3D5BR56      ---GGK----KKKRAK------GSDRHPLKHGEESR-----------------SIRLP-E
A0A2N2IB15      ---GNM----AA--GP------GIVRVPMGESTSVG-----------------GVRLA-E
A0A1I3PSR2      ---GNR----AE--VS------GIARAPMGEPTSVG-----------------GFRLP-E
A0A1I4GEK4      ---GNR----AG--VS------GIARAPMGEPTSVG-----------------GVRLA-E
A0A2T5R3J5      ---RAP----EKRE------------------PDAPA-PKVFEADQ-------HPEIT-S
A0A1W7QPT7      ---SAR----QPMESP------VLPPLPPRVPAISPQ-YG-------------RLEPQ-N
A0A0M4D373      ---KAS----LRREYQ------ERPPVPLEAGPRAPG-HVALKVA--------PLPVN-S
A0A1L3GKM9      ---ISP----VKVT-----------PLPAAASTIQPP-AEDLPTGQ-------ALQPD-H
A0A430DNP0      AGAAVL----VREQFD------DAVRAPDEVEGKLGL-PLLGAIPL-----------V-Q
A0A3A0FQ32      ---GVT----APAAQP------IARAPGGAPAGRLAR-LRSWVVRQIRPVEVEDANAY-N
A0A1E7HFN0      RHEEGH----RIPVEQ------AASEMPGLAEKVRGD-TRTKAISL-------DHSHI-E
A0A1E4UZA0      -----------KPQAS------SAVAQPLAELGALNY-VQTKVISL-------RAELL-E
A0A1H9KL56      -----------KPQAS------SAVAQPLAELGALNY-VQTKVISL-------RAELL-E
A0A1A9KEF8      -----------APSHA------VSPAVRPDVPGQFDY-VQTRVVPL-------RAEHL-E
A0A0N9W1V6      -----------KAMTV------TGQSA---GLNALSY-VQTKVVPL-------RPDHL-E
A0A423GQ41      -----------KAMTV------TGQSA---SLNALSY-VQTKVVPL-------RPDHL-E
A0A423H7J2      -----------KAMTV------TGQSA---SLNALSY-VQTKVVPL-------RPDHL-E
A0A1H4N2K9      -----------LVTTS------TGQSA---TLNALSY-VQTKVVPL-------RADHL-E
A0A2K4KWF7      -----------LVTTS------TGHSA---TLNALSY-VQTKVVPL-------RADHL-E
A0A2S5ERE5      ------------MTTS------SGQPAPAPTLNALSY-VQTKVVPL-------RADHL-E
A0A3E0WXH2      SGVSPG----AFVAAE------SKASADTGDVSSLAY-SHTRVVTL-------DPTHL-E
A0A2N2TRC8      PVGESN----QVSETA------AAPEVPHLSPASIQY-QKTPVVRL-------DEKHL-E
A0A1V4CIZ7      ------------------------------DLGSVQY-AQTAVVPM-------DPAHL-E
A0A1M3BXA5      APVAAT----APAAVA------QQADALASGVIEINY-TQTEVVRL-------DRATL-E
A0A1Y2R3U6      KP-----------ASE------VVQESLPGTDADVHY-RQTPVVEL-------DPAHL-E
A0A167HVD6      APD----------PST------AGRKAESGDLGSLQY-VQTAVVSL-------EPEHL-D
A0A1V3SCT6      DSETPA----GESSSA------IRREASPGDASSVHY-TQTAVVSM-------DAAHL-E
A0A1E2UHX3      HSHM------------------RINPMEKVDLTKISY-TKTKKIEV-------SKELL-R
G2E3C0          ERQKAG----GSRFAH------RTQPRPPASDAKVDY-THTATLDV-------DADAM-R
L0H287          QSTRGG----AD------------APNDPAGAS-----IRTRRVLV-------DPERL-L
A6DVL6          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A1W9HS52      FGTRL-----FTSGLVGLFMGLIILVLKNTFIHTVRNYREMQE-EGITVIGEVPILPGLN
A0A2D5LFD8      SVKTGF----LKAILIGVASGLGIGVLRDRIDHVFHTPEEVDNDLKLPLLGHIP------
A0A0N0XAV4      MKKLIV----LMATLIGALVAVMIIFVRQAFYRGVESAEVIEG-LGMPVYASLP------
A0A0P9QD19      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
F3FHG4          MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
F3GGI0          MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A0P9LE74      MKKLIV----LMATLIGALVAVMIIFVRQAFYRGVESAEVIEG-LGMPVYASLP------
A0A3M4ZQ14      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A3M5YLE8      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A3M3RP89      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A0P9QIY7      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A0P9VVH7      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A0Q0FJK6      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A0Q0G2J0      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A3M3LF66      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A0P9WIR8      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A3M3KPE5      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A3M4C263      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A3M5AD05      MKKLIV----LIASLFGVLVAVTIIFIRQAFYRGVESAEVIES-LGMPVYASLA------
A0A0N0FS39      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M6GHH2      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0Q0D3D2      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9R9W0      MKTLIV----SLATLIGALVAMIIVFIRQAFYRGIESAETIES-LGMPVYASLP------
A0A0Q0B9T0      MKTLIV----SLATLIGALVAMIIVFIRQAFYRGIESAETIES-LGMPVYASLP------
A0A3M6CFI7      MKTLIV----SLATLIGALVAMIIVFIRQAFYRGIESAETIES-LGMPVYASLP------
A0A0P9JXN0      MKTLIV----SLATLIGALVAMIIVFIRQAFYRGIESAETIES-LGMPVYASLP------
A0A3M6FIV7      MKTLIV----SLATLIGALVAMIIVFIRQAFYRGIESAETIES-LGMPVYASLP------
A0A3M4ENY1      MKTLIV----LIATLLGAMVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A3M5EZK7      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGIESAEIIEN-LGVPVYASLP------
A0A0P9SPP5      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M5DM48      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M3NNF2      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9NNS0      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M6AI26      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M4WA51      MKTLIV----LIATLIGALVAMIIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M4A0E8      MKTLIV----LIATLIGALVAMIIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M4GLF4      MKTLIV----LIATLIGALVAMIIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M4PBZ2      MKTLIV----LIATLIGALVAMIIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9IWP8      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0Q0B3J8      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M5M873      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9VHH8      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9YV98      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M3G2W8      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M6C224      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9PWZ3      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M5K254      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9KZ49      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9PS59      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9V840      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0Q0AIE5      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M2ZQH6      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0N8SQG2      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0W8HFU1      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M5JFB0      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M3TQV3      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGIPVYASLP------
A0A3M3EF92      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M5J1E2      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M5G7H9      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M4A376      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGIPVYASLP------
A0A0Q0A5T8      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9SCD7      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9T4G3      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9VKB0      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEIIES-LGMPVYASLP------
A0A0Q0BM35      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEIIES-LGMPVYASLP------
A0A3M3TPR7      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M3U4Q3      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9UCX7      MKTLIVLIATLIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9S1F1      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9QCJ2      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9Q329      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M5GJ64      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A0P9MPC7      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M2XYQ3      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A0P9XCE1      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGIESAEIIEN-LGMPVYASLP------
A0A3M3EFX7      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGIESAESIEN-LGMPVYASLP------
A0A3M5B9D9      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGIESAEIIEN-LGVPVYASLP------
A0A0P9RRZ3      MKTLIV----LIATLFGALVAMTIVFVRQAFYRGVESAEVIEN-LGMPVYASLP------
A0A3M2VEK7      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A0N8R9B3      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A0P9VA27      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A3M4YBJ4      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A0P9J470      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A0Q0EVJ8      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A3M5UI30      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M5YQT8      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M5F5X1      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M5R8G1      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M5V012      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M3GA16      MKTLIV----LIATLIGALVAMTIVFVRQAFYRGIESAEVIES-LGMPVYASLP------
A0A3M3CJL0      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A3M3F6F5      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A3M3P9B7      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A0N8QB74      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A0Q0AUD0      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A3M5VR55      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A0Q0FK97      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A3M3UCT3      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A3M5XGQ7      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A3M5KZ75      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A3M5L3G5      MKTLIV----LIATLLGALVAMTMVFVRQAFYRGVESAEIIEN-LGMPVYASLP------
A0A0H6WI56      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      --------------------------------------------MNSFPNLPQP------
A0A0Q8RMY3      ---------------------------------------------------MVI------
A0A1A7QC21      -----------------------------------------MQDADTAFIGSDQ------
A0A351Z9A2      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A2S5ZLM1      ------------------------------------------------------------
A0A369PF62      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      IKPLVV----LVAIFVGLLVSAMVILLRQVFYRGVESPETIEHL-------GIP------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      --------------------------------RGVESPDVIEKL-------GVP------
A0A350L5D2      --------------------------------RGVESPDVIEKL-------GVP------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A379GWF0      -----M----VLATILGFIVGCAYVIAREFFNNKIKGTEDIDAL-GVNVYATIP------
A0A2V2C254      ------------------------------------------------------------
A0A3R0G3L3      ------------------------------------------------------------
A0A334Z204      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      -------------------------------------MKTPEQLEELGINVYAS------
W1DSK1          ------------------------------------------------------------
A0A3B8SQ27      -----M----LGGLVVGFGLALAIVFIRRKLFPSIESIDEIERL-GLPVLAAVP------
A0A0U2VAW2      KKALIV----VMATMLGGMLGVAIVLVQKAMHKGVEDPSEIEAL-GIPVYASVP------
A0A454CTF1      KKPLIV----VLATLLGGMVAVAFVLVKTAFHRGVTSPDEIEQT-GISVYASVP------
A0A352Q5C1      KSMLII----ALSIVAGAVCGVILSFCHKLIKGGIEDPDELEQKFDIPVYASVM------
K0XBA5          NVVLGF----ILGLFISVGAVLARAMLRRGVEAPEQLEEHGISV-YATIPMSEW------
A0A3Z1VWW2      ------------------------------------------------------------
A0A0I1Z5N6      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A336JDN2      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A378G3G7      KKLLVI----VVLTVFGTMLSLMYVIVKVAFNKGVQSAEQLEEN-GLNVYASIP------
A0A2A5PQG0      KKSLVV----IIGFILGLFIAVSAVLIQVFLRRGIESPEQLEEA-GINVYASVP------
A0A2J4QEC3      KKMLIV----LAGIALGLMVSIGLVLLRVFLRQGIESPEQLEER-GINVYASIP------
A0A2X5NHJ9      KKSLIL----LIGIVLGGVISVGLVLLRVFLRRGIESPEQLEEL-GINVYASVP------
A0A3S4JGG5      QKTIIV----LIVTLLGGLFSTGFVLLKTMLHRGIESPEQLEQQ-GINVYASIP------
A0A377ZDH2      KKTIIV----LIATLLGGLFSTGFVLLKTMLHRGIESPEQLEQL-GINVYACIP------
A0A3S4HTS8      -----M----LIVTLLGGLFSTGFVLLKTMLHRGIESPEQLEQQ-GINVYASIP------
A0A2X1JBG5      KKALIV----ILATLLGAMLSVGLILVRAAFHRGIESPEQLEEI-GLSVYATIP------
A0A1W9F5M9      ------------------------------------------------------------
A0A3P5DSS6      KKIIIV----LVGFALGFILSMSLVFIRVLLRRGIESPEQ