BYKdb

Dataset for cluster tad of phylum proteobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

32 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F3CAY8      ------------------------MTVMNRPSLDFHQDSR---------------IDLAA
G7EJX5      ---------------------------MNQTNQNLKSDDEV--------------IELGI
H8YYB8      ------------------------------------MEEQL--------------LSLDD
E9TE87      ------------------------MTEKVKQHAAPVTGSDE--------------IDIGR
C0QCJ1      -------------------------------MQQIQQNQLP--------------ITPAQ
I5B297      -------------------------------MADPFQSQTQ--------------IKPDY
C7LPS4      -----------------------------------MNHELY--------------QQFER
Q314L4      ----------------------------MNTMLDDVEAGGG--------------LDILR
Q39U16      ------------------------------------MVSKT--------------EELNK
F0JCB9      ---------------------------MTDNKLETPGAEAS--------------FDVMH
G7QCG0      ------------------------------------MSAFL--------------KEFHH
I2Q342      ------------------------------------MSAFL--------------KEFHH
Q74BQ7      ------------------------------------MQQSE--------------FDYRH
B5EA80      ------------------------------------MQSPE--------------TEYKK
C6DZX6      ------------------------------------MQSPE--------------TEYKK
A1ARV9      ------------------------------------MSDSE--------------FDYKK
E8WSZ4      --------------------------------------MQE--------------SEYKK
A5G425      -----------------------------------MSTTNE--------------LDYKK
B9M2X7      -----------------------------------MPTTND--------------FDYKR
G8AU95      MNSSIGKGGTLPGHEAHASVLPDSLLQSGAAESSDVRSRQE--------------ATVFA
F0G6H6      -------------------------------------MSHLTMPESRGGPTARPPHPFRR
A3W0H6      -------------------------------------MSAI--------------QSFPD
A3K8W6      -------------------------------------MSQF--------------QSVGE
Q0FMP1      -------------------------------------MNQF--------------QSIGE
S9QRP2      -------------------------------------MTQF--------------QSIES
D0D9W1      -------------------------------------MNQF--------------QSVGE
I1AYC4      -------------------------------------MNQF--------------QSVGE
G5SDT9      -------------------------MTEKAKQSAAVTGSDE--------------IDIGR
G5LQM7      -------------------------MTEKVKQSAAATGSDE--------------IDIGR
G5Q4J1      -------------------------MTEKVKQSAAVTGSDE--------------IDIGR
E7T802      ------------------------MTTKNMNTPPGSTQENE--------------IDLLR
F4SM98      --------------------------MPLIKNKKLDKDADE--------------IDLGR
                                                                        

F3CAY8      VLRMLFDHKALILWTVSLFFLIGLGYAILATPVYQATAMIQIEPR---------------
G7EJX5      YINVIKRAKWRILSFAIVVTLLAIMVTLTLVPKYTATATLLIEAEQTKAVSFEEVYG---
H8YYB8      YIAILKRRKWQLIIPAVLLSIVGMITAVVLPPTYRSTATILIEQQEIP-----DELVRST
E9TE87      LVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGN-----SLVQDIG
C0QCJ1      IIDILIRRRWIIVIPLCITLTVGLYLALTSPRTYMAETSILVQAQTVP-----GNYVKSI
I5B297      IIDVLIRGRWFLIVPLCISLTLGLGMTLTANKTYEAGTMILVQPQRVP-----INYIKSV
C7LPS4      YARILLQRKRVVVVVALLVMTLGVITSYVLPRKYEAQSTVFIEQSVIS-----ELVKGIA
Q314L4      YIRLLWEHALAFWLMAAVVMLAALGFAYSLPKIYQAKSTVAIEQNVIN-----DLVRGIA
Q39U16      YLKMLMKRRYLFIVVSLVVMSVIAWGSFFLPKKYEASSTVFIEKSVIK-----DLVKGIT
F0JCB9      YVQLVGNHRGLFVFIVLLAMFIAIVTSYVLPKKYEAKSIVFIEQNVIS-----DLVKGIA
G7QCG0      YKQLIYLYKELFLAVSLLIMTGAIAVGYLSPKKYEAKSTIFIEQNVIT-----DLVKGIA
I2Q342      YKRLIYLYKELFLAVSLLIMTGAIAVAYLSPKKYEAKSTIFIEQNVIT-----DLVKGIA
Q74BQ7      YLTLIVARKRLFVVVALAVMAAAVVYSYVLPKKYEARSTVFIEKNVIS-----ELVKGIA
B5EA80      YLQLLISNKERFVVIALLLMTVAFVVSFVLPRKYEASSTVFIEKNVIS-----ELVKGIT
C6DZX6      YLQLLFSNKERFVVIALLLMTVAFVVSFVLPRKYQATSTVFIEKNVIS-----ELVKGIT
A1ARV9      YLELIVRKKELFVKLALLIMTIAIVTSYVLPKKYEASSTVFIEKNVIS-----ELVKGIT
E8WSZ4      YTQLIARRKEFFVVAALLIMTLVFLVSYLLPRKYESSSTVFIEKNVIS-----ELVKGLA
A5G425      YLMLIDKKKKLFIITALAIMTVITIVSYFLPRKYEAKSTVFIEKSVIS-----DLVKGIA
B9M2X7      YLNLVKQRKTLFLVTALAVMTITVIVSYVLPEKYEAKCTVFIEKALIN-----ELVRGFA
G8AU95      TLAVLWRRKLLLLTIILLGTATITYVMQSLKPMYRATAMVQLDSRRVELAEFKSVVSNLT
F0G6H6      YWGMLYGGRRTIVASALICVAAGALYALCARPVYRSDVLFQVEQSPTD-----TKPASPT
A3W0H6      LIRLLHRKLWLIVLVAVVGAILSIIVALNQPKVFQATAVIQIETPQVG-----SDLAGQT
A3K8W6      VFAALRRRAWVILGIFLVGCVISVDYALMQQKVYEATAVVQIEDARVT-----STATGTA
Q0FMP1      VLSALKRRALLILLVTVLGSAASVWLALNQIKVYEATAVVQIEEGQMP-----DSLAGAS
S9QRP2      VFAALRRRAWIIILVTVVGCALSVWVALNQDKAYEATAVVQIEEARVP-----ERLTGGA
D0D9W1      LWAALRRRAALIALVALIGCAISLWVAFNQTKVYETTAVVQIEEGQVP-----DSLAGPS
I1AYC4      VLAALRRRVLLMIAVILLGSALSLYIATQQVKTYETTAVVQIEESQVP-----DTLAGSA
G5SDT9      LVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGN-----SLVQDIN
G5LQM7      LVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGN-----SLVQDIN
G5Q4J1      LVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGN-----SLVQDIN
E7T802      LVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGN-----AILSGLS
F4SM98      IIGELIDHRKLIIAVTALFTFISLLYALFATPIYQADALLQVEQKQGN-----AILNSLS
                :      .                     : :   . ::                 

F3CAY8      --------------------KIGIEGTPEVRRQAIVSVAGDH------------------
G7EJX5      ---------LDSNKKEYYLTQFEVMKSDSIAREVITKLNLKTTP----------------
H8YYB8      V--------T-----SYAAQRVQTISQRVMTTENLGKIIESYQL-YPELMQR--------
E9TE87      S--------ALANKPPASDAEIQLIR----SRLVLGKTVDDLDL-DIAVSKNTFPIFGAG
C0QCJ1      V--------S-----SGISSRISTISQQIMSMSNLEKIIDQFGLFEEEGAKD--------
I5B297      V--------S-----SSIGERISTISQQVLSRSNLEQIIEQFGLYEN--SSG--------
C7LPS4      T--------T-----PSMEAKIKVLTVAMLSRETLFKVMRILDK-DVEFASD--------
Q314L4      I--------T-----PSMGAKIRILNVSLLSRSSLLSVMKELDM-DLGLSGP--------
Q39U16      F--------T-----PSVEDKVRILRYAMLSRTFVTNVLKSLDA-DTKVKND--------
F0JCB9      V--------T-----PSMDTKIKAIKVTMLSRNMLSKVINALDL-DVDLKNE--------
G7QCG0      I--------S-----PSMQQKIQNLAVSLTSRNLLLPVIKQLDK-DITLKTA--------
I2Q342      I--------S-----PSMQQKIQNLAVSLTSRNLLLPVIKQLDR-DITLKTA--------
Q74BQ7      V--------T-----PSMEQAIKGLSEAITSRTLVTKVINDLDL-DVTTKSN--------
B5EA80      V--------T-----PSMEDTINVLTYEITSRTLLTKVMDSLDL-NLGKSDS--------
C6DZX6      V--------T-----PSMEDTINVLTYEITSRTLLAKVVDNLDL-DLGKNDS--------
A1ARV9      V--------T-----PSMEDTIKVLTYAITSRTLLSKAAENLDM-NVTRKGG--------
E8WSZ4      V--------T-----PSMDDTISVLTYAITSRTLLNKVVESLDM-NLGKDGN--------
A5G425      I--------T-----PSMDEKIKVLNYAITSRTLLLKVIDDLDL-NVNKQND--------
B9M2X7      V--------T-----PSMEDKIKGLNYAMASRPLLQKVVSDLDL-NLGKNGD--------
G8AU95      PE-------A-----PAVRSEVSIVGSRALAE----RVVEKLGLLNDPE-----------
F0G6H6      GDPSSMFDLK-----TDAATEIEVLKSRAV----MARAVDTTKLYIEARPRY--------
A3W0H6      I--------A-----TDANQRLQLIEQRLMARDNLVKVIERHGLFANAR-----------
A3K8W6      AD-------A-----NEASRRLQLIEQRLMSRDNLVSLMDKYDLFAEDP-----------
Q0FMP1      AQ-------N-----QDGSRRVRLIEQRLMSRDNLLALMEEHGLFDGDT-----------
S9QRP2      AQ-------N-----ADAARRVRLIEQRLMSRDNLMRIMEEHDLFTDAP-----------
D0D9W1      AQ-------G-----QDASRRVRLIEQRLMSRDNLLRFMEEHQLFTADP-----------
I1AYC4      AQ-------S-----QDAARRVQLIEQRLMSRDNLVRIMQEHQLFSDDP-----------
G5SDT9      S--------ALANKPPASDAEIQLIRSRLV----LGKTVDDLDL----------------
G5LQM7      S--------ALANKPPASDAEIQLIRSRLV----LGKTVDDLDL----------------
G5Q4J1      S--------ALANKPPASDAEIQLIRSRLV----LGKTVDDLDL----------------
E7T802      D--------MIPNSSPESAPEIQLLQSRMI----LGKTIAELNL----------------
F4SM98      Q--------MLPDSQPQSAPEIALLQSRMI----LGKTVDDLNL----------------
                                 .                                      

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
E9TE87      WDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNKNYTLSSDGGFSARGQAGQMLKKEG
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
F0G6H6      ----------------------------------------------VPLIGWRLVNGADG
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
D0D9W1      ------------------------------------------------------------
I1AYC4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      --------------------YGLVSAVEQMREDIEL------------------EMISAD
E9TE87      VTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTV------------------TE----
C0QCJ1      --------------------MYLEDKIEAMRKRIKV------------------TL----
I5B297      --------------------MYQEEKIEALRKRIKV------------------KI----
C7LPS4      --------------------MDREAYIKDLRERISI------------------RL----
Q314L4      ---------------------ALEERITSVRRKVSV------------------GL----
Q39U16      --------------------KEMEGLVEDFQKRTQI------------------SI----
F0JCB9      --------------------ISLDSTIKSLRGRIKI------------------GL----
G7QCG0      --------------------YDQEVYIKDLQRRIMV------------------NL----
I2Q342      --------------------YDQEVYIKDLQRRIMV------------------NL----
Q74BQ7      --------------------AEIEARVRAIQQNITI------------------KL----
B5EA80      ---------------------ETEELIKQLQLSTKV------------------KV----
C6DZX6      ---------------------ETEELIKQLQLNTKV------------------KV----
A1ARV9      --------------------ADMEALYLTLQKNTVV------------------KV----
E8WSZ4      -----------------------EELIRDLQKNLTV------------------KV----
A5G425      --------------------AQLEELVAKFQKNTVI------------------KL----
B9M2X7      --------------------T--DTLISQFQKDTKV------------------EL----
G8AU95      --------------FNPSLKAPDGTDDHWLKRVTKAGVGALPPEGNDVL----RQIVQQA
F0G6H6      LSSPLPGGYVYGTERIDVAAFDVPKRLYDKSFALTVGRGGAYTLQRTGLFGRKGPVWQGR
A3W0H6      -------------------DMPMAEKVHQLRISARI-----------------TPITVGV
A3K8W6      -------------------ALNDGERIYMMRQAARI-----------------TPITRPG
Q0FMP1      -------------------GMSVGQRLFRMREAVSI-----------------QEIRTNS
S9QRP2      -------------------EMTMNERVYQMRMAARI-----------------EEIRSNS
D0D9W1      -------------------TMTLNERVFQMRKAVQI-----------------EEIRAAG
I1AYC4      -------------------DMSLNERVFHMREAVRI-----------------DEIRSNP
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ----------------------------------------------------------IL
H8YYB8      VIDPRSGRPSEATIA-------------------------------------------FS
E9TE87      ------NGKDAG--V-------------------------------------------LS
C0QCJ1      ------SSARSGADA-------------------------------------------FT
I5B297      ------EHSRGGSEA-------------------------------------------FS
C7LPS4      ------DEKRG---I-------------------------------------------FF
Q314L4      ------DEKRG---L-------------------------------------------FF
Q39U16      ------KGN-D---L-------------------------------------------FI
F0JCB9      ------DEKRG---V-------------------------------------------FD
G7QCG0      ------NERQG---L-------------------------------------------IV
I2Q342      ------NERQG---L-------------------------------------------IV
Q74BQ7      ------KGD-N---I-------------------------------------------FT
B5EA80      ------KDK-N---L-------------------------------------------FT
C6DZX6      ------KDK-N---L-------------------------------------------FT
A1ARV9      ------KDK-N---L-------------------------------------------FT
E8WSZ4      ------KEKNN---L-------------------------------------------FT
A5G425      ------KNDEN---F-------------------------------------------FI
B9M2X7      ------RDKEN---L-------------------------------------------FT
G8AU95      TALFRADDGPVARDPNQARLLTIDTLLRRIEARNDDRSFT------------------II
F0G6H6      IGEPLHAETPDGNIDLLVRGIDGEPGARFDLTRHGEAETTAWLQKNVLISERGKQSNIIG
A3W0H6      PGMGPAT-TPSG----------------------------------------------LS
A3K8W6      PTFSAAAQAPSG----------------------------------------------LM
Q0FMP1      NSFAAQQEMPSG----------------------------------------------LR
S9QRP2      GSFQASQEVPSG----------------------------------------------LT
D0D9W1      NSYQPMRDAPSG----------------------------------------------LL
I1AYC4      DAYAATQEAPSG----------------------------------------------LL
G5SDT9      ----------------------------------------------------------DI
G5LQM7      ----------------------------------------------------------DI
G5Q4J1      ----------------------------------------------------------DI
E7T802      ----------------------------------------------------------HD
F4SM98      ----------------------------------------------------------QA
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      LQSPQ-------------------------------------------------------
H8YYB8      LSFESESPTVAQRVANDITSLFLSENLKDRQESAKETTAFLQKELAKLTDKLSLLEARLA
E9TE87      LTYTGEDREQIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLN
C0QCJ1      ISYKGSDPDKVMRITNTLTSFFMDENLKLREAQAIGTSEFLDAELEKTRKKLVDREEQLS
I5B297      ISFTGSEPQRVMRIANTLASYFMDENLKVREAQAIGTSEFLDSELEKTKKRLEEKEQKLA
C7LPS4      ISFQDSDPRYARDFVNTITQVYIESNTASKRDESLEATRFLSEQIESFKKRLDAVEDEIN
Q314L4      ISYESSNPVLARDFVNTLTRHYIEQSTSDKREESFEATRFLADQIEVFRKRIEAVQAEID
Q39U16      VSIRDKDPKLATDYVNTLVRKYVEENVSSKRQDSFGADRFISEQLKTFKDKLDESENKIV
F0JCB9      IRFADTDPVLARDVVNTLTRVYIEDSVSNKRKESYEATRFLADQIEVFKKRIDEAKKEIE
G7QCG0      LNFSDKDPRFARDFINTMARVYIERNTSTKREESTEATKFLAEQIETFKKRVDAADEAIN
I2Q342      LNFSDKDPRFARDFINTMARVYIERNTSTKREESTEATKFLADQIETFKKRVDTADEAIN
Q74BQ7      ISYVDKDPRVARDFVNTLVRRYVEENISSKREESYGAIKFLSEQIDTFRGKLEEAEGELN
B5EA80      ISFTHTNPRIARDYVNTLVRLYIEGNISSKRGESYDATKFLSEQIDTFNAKLQKVESEVN
C6DZX6      ISFTHTNPSIARDYVNTLVRLYIEGNISSKRGESYDATKFLSEQIDTFNEKLQKAENEVN
A1ARV9      ISYTDKNPQMARDFVNTLVRLYIEENTSSKRGESYDATKFLGEQIDTFREKLEKAEKELN
E8WSZ4      ISFVHTDPRIARDLVNTLVRLYVEQSTSSKRGESYDATKFLSEQIQAFNRKLQSAEAEVN
A5G425      ISFTNENPRLARDYVNTLVRRYIEENVSSKREESYGATKFLSEQIEVYKEKMDKAEAEVN
B9M2X7      ISYTGENPKRARDYVNTLVRRYIEENSSSIRAESYGASKFLSEQITVLKEKMDKAEAEVS
G8AU95      IEASSVDPAKAAAIANAFGQAYLDYRTEMNRDMTERVNQWLGGRLIEAREAVRGAEEAIR
F0G6H6      ATLDGSDAAHISSILNAVGDAYLAQNTQRKSEAADKLIRFMDAQLPQLKAQLEAAEGRFN
A3W0H6      VTVNLNDPVKAAEVANDFVETVIAENRERRMALVRETFDFFSAEETRVSARIAEVEGVIA
A3K8W6      ISVMLPDPEKAAVVANDLMTKVIAESRDRSAEQASETLAFYQTEEARVDAEIVALEDRIA
Q0FMP1      ISVVLPDPQKAADVANEMMYQVINQSRDRSLSSARDTLAFFESEEARVETEIEAMEAKIA
S9QRP2      ITVRLGDPQKAADVANELMTTVIEQSRSRSASSARDTLEFFEKEEARIGAEISEQESRLA
D0D9W1      ITVTLDDPQKAADLANELMETVIRQSRDRSVDRARDTLAFFEEEAARVEASIEAQELRIA
I1AYC4      ISVTLGDPQKAADLANELMNTVIEQSRDRSVSRARETLDFFESEEARVEAEIQAKEAEVA
G5SDT9      AVTKNTFPLFGAGWERLMGRH---------------------------------------
G5LQM7      AVTKNTFPLFGAGWERLMGRH---------------------------------------
G5Q4J1      AVTKNTFPLFGAGWERLMGRH---------------------------------------
E7T802      IVEQKYFPIVGRGWARLTKEK---------------------------------------
F4SM98      IAEKNYFPIFGRGWARLIGHK---------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      QFKEEHGQS-LPELKSLNMQLIQRSEDQLRDTEQSIRTLVERKIYLEGQLAQIDPYSELF
E9TE87      AFRQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFK-------------------------
C0QCJ1      SYRAKNMGG-LPDELDSNLRTLDRLQLQLTDKQAMLRDAKNAINTLSAQIAQASKMGSQG
I5B297      AFRAKYLGG-LPDELESNLRTLDRMQKQVTDKAMLLREVNNSISQLDSQISSMAATGGSG
C7LPS4      QYRAEHGLQ-LATDETTIRFEIADAERKLEAIRARKLELETKLQLMPSG-----G-----
Q314L4      SFKASRGQI-LNMSEPALRREIQMAQEELQALRIRKTDLLAQRGVMLRN-----T-----
Q39U16      AFRQKRGVS-VGIDEALLVNDIRQYQGELDSMRIKRNELTATRDALRRQL----K-----
F0JCB9      DYKVASGKV-LTTNEYAVRREIEKGEDQIKDIDIRISTLESSRTMLLSN-----S-----
G7QCG0      AFRSERGML-LSSDGAFIRSEIKAAEQKLEELSLRRAQLEAQRKMLASGK----G-----
I2Q342      AFRSERGMI-LSSDGAFIRSEIKAAEQKLEELSLRRAQLEAQRKMLVSGKGPARG-----
Q74BQ7      RYKTEKGGV-IAIDEAKLFEEINVAQQKLYDIQLRRRHLEGLRPVTRKAG----D-----
B5EA80      AYKRDKGGV-IAIDEGKLFQEINVAQQKLYDLELRRHQLEGMRQITRRTG----D-----
C6DZX6      AYKRDKGGI-IAIDEGKLFEEINIAQQKLYDLELRRRQLEGMRQITKRTG----D-----
A1ARV9      DYKRDKGGV-IAVDEAKLFEEINVSQQKLYDLELRRRQLEGMRRVTRKSG----D-----
E8WSZ4      AYKRSKGGV-ISIDEGKLFEEINTAQQKLYDLELRRRQLEGMRLVTRKAN----D-----
A5G425      NFKIGKMGV-IATDPATLQKEINDAQQKIDDMRLKRAQLESLRIQIKK-N----N-----
B9M2X7      RFRMEKGSV-ATADPAALEREISGAQQRIDEIAFRKAQLEASRNQLKK-H----N-----
G8AU95      SFRKENSLL---------------------------------------------E-----
F0G6H6      AYRASH------------------------------------------------------
A3W0H6      DFKRANA-----------------------------------------------E-----
A3K8W6      DYKKANS-----------------------------------------------A-----
Q0FMP1      TFKRENA-----------------------------------------------E-----
S9QRP2      DFKRANA-----------------------------------------------E-----
D0D9W1      GFKQDNA-----------------------------------------------A-----
I1AYC4      RFKQDNG-----------------------------------------------D-----
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      SADGRRVL--------------GPADRLKAL------------EAEYATVAARYSSQHPE
E9TE87      -------------------------------------------EAEISKLYTKVHPAYRT
C0QCJ1      MDDQ----FDFSDFGEEVGMGGEDEATLAEA------------EKRLDAMLLRYTRQHPD
I5B297      SGGDDFLSFDFDDSQE------GDDSALQAA------------QEKYDALLLRYTEKHPD
C7LPS4      ----------------------GRSAHLADM------------ERQLATLLTAYTDQHPK
Q314L4      ----------------------PLRNRLETL------------EAQLAAMLVSYTEKHPA
Q39U16      ----------------------SIKPTTVALSSRENSSEVEMLERRLKQLSANYTDNYPE
F0JCB9      ----------------------PSRSRLRQQ------------EQLLDDMLARYTENHPR
G7QCG0      ----------------------PAKASRASSGGNPR-------EAELRRLLAVYTEKNPK
I2Q342      ----------------------PAKAGRASSGGNPR-------EAELRRLLALYTEKNPK
Q74BQ7      ----------------------PLQVKLVAL------------QKQLEELRVSYTDSYPE
B5EA80      ----------------------PLQSRLAGL------------QKRLDELLVEYTDSFPE
C6DZX6      ----------------------PLQNRLAGL------------QKRLDELLVEYTENFPE
A1ARV9      ----------------------PLQARLSAL------------QRRLDELRVQYTDSYPE
E8WSZ4      ----------------------PLQAKLASL------------QKRLDDLRVQYTDSYPE
A5G425      ----------------------PLQQKMLSL------------QKKLDEMLVEYTESYPE
B9M2X7      ----------------------PAQMRLQTL------------EKKLEEMRVEYTDRYPE
G8AU95      ----------------------LPPDGRNMV------------QQQMNELATQLTAAQAQ
F0G6H6      --------------------------GSVNT------------SDEALALRQQSVDIETR
A3W0H6      ----------------------SLPTSITPV------------REELRTLNETLLALDQQ
A3K8W6      ----------------------QLPAGVAAL------------RTELTTLRETELDLSQE
Q0FMP1      ----------------------ALPSGTGAL------------RSQLTTLEDSQLALARD
S9QRP2      ----------------------ALPGGITSL------------RSQLVTLEENELELDRE
D0D9W1      ----------------------ALPNGLTAL------------REQLTTLQDNELELDRE
I1AYC4      ----------------------ALPAGLGSL------------RDQLTTLRDNALTLDRE
G5SDT9      -------------------------------------------NEMVKVTTFTRPETMSG
G5LQM7      -------------------------------------------NERVKVTTFTRPETMSG
G5Q4J1      -------------------------------------------NERVKVTTFTRPETMSG
E7T802      -------------------------------------------PGELAISWMHIPQLNGQ
F4SM98      -------------------------------------------PENLTITRLYLPSSDKE
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      RMRIEREIATLRQQVGQSANARAELERSLKEQQEELAGLRERYSTEHPDVKAQTGAIAIT
E9TE87      LLEKRQALEEEKAKLNGR------------------------------------------
C0QCJ1      VRRLEAVIEKLRAKIEAAQA----------------------------------------
I5B297      VKKLKRIIEKLKQNLEAAKE----------------------------------------
C7LPS4      VVRLQGQIRAVKSSPSGGMT----------------------------------------
Q314L4      VIRTKQEIEGLRREVARKGE----------------------------------------
Q39U16      VIRIKSIIASLKKKQEPGHQ----------------------------------------
F0JCB9      VRQLENAIAETKRQIAHNSE----------------------------------------
G7QCG0      VIKARAAAKAWRPS---GGG----------------------------------------
I2Q342      VIKARAALRAWRPSGGGGGG----------------------------------------
Q74BQ7      VLRVRGEIETLKEQMKNRSP----------------------------------------
B5EA80      VVKVKGDIETVKAQISERRG----------------------------------------
C6DZX6      VVKVKGDIETVKAQLSARRG----------------------------------------
A1ARV9      VLQIKGDMETIRAQLKTR-G----------------------------------------
E8WSZ4      VLTVKGDIETVKEQMKLRKG----------------------------------------
A5G425      VIRVKTELQAVKEQLRNRNT----------------------------------------
B9M2X7      VMRLKSEIESVREQALASSG----------------------------------------
G8AU95      KAAAEARVRQARDQTAANNA----------------------------------------
F0G6H6      ILTLQ----QQRQELLTR------------------------------------------
A3W0H6      IITLETEASRQRQEVFARQ-----------------------------------------
A3K8W6      IITIQGDTARKRPEDLARQ-----------------------------------------
Q0FMP1      IVEMEGNSTRQREEVLARQ-----------------------------------------
S9QRP2      IVALRTNSARQREDVLDRQ-----------------------------------------
D0D9W1      IVAMEGSPTRQREEVQARQ-----------------------------------------
I1AYC4      IVALEANSSRQREEVLGRQ-----------------------------------------
G5SDT9      QIFTLKVLGDKRYQLVSDGG----------------------------------------
G5LQM7      QIFTLKVLGDKRYQLVSDGG----------------------------------------
G5Q4J1      QIFTLKVLGDKRYQLVSDGG----------------------------------------
E7T802      DQQLTLTVGENGHYTLEGEE----------------------------------------
F4SM98      LPELNLTVKDKLHYTVEYN-----------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      QRQLAQARQGGSANSPGVIDADNPAYIQLQAQLQAAVVELASLQESREEIRSKLADLEER
E9TE87      ------------------------------------------------------------
C0QCJ1      QEAAETLEPLETENLDVVEPGMNFAVMQQKTQLAQMNREIQALNAEIKSIQEKMVVYQKR
I5B297      E---EELPSAESEEDILPDMGMD-PVAPLKAQRAQLVAEANNIQAEVSAIQEKMKIYAQR
C7LPS4      GNSGAAAKT-------------------------LVQAEIEAATLQEKAQLATIEEKTEL
Q314L4      EERKIIYGT-----------------SEYQR----IKVELTAVEQQEAQLVSKIADNERL
Q39U16      ADTGAKEEFSTANP----------VYQNLEQQLYQVEAELEAVNAKQRQLHATIGGKEHE
F0JCB9      EELSLIYSS-----------------PEYQH----LKVQIRALNTQKANIEEEMASNKAL
G7QCG0      GGESAGEGV-----------------AEGTRNAQILQYQLDSIKAMEDYQNKIIGENKGA
I2Q342      GGESAGEGV-----------------AEGTRTVQILQYQLDSIKAMEDYQTKVIGENKGA
Q74BQ7      Q-QETVVDP-----------------QEYEK----AEAELQALKVSEDGLKRYIATNQAL
B5EA80      Q-PSQPLDP-----------------GELAK----IESEISAIKITESGLRRYIDTNRAL
C6DZX6      Q-QSQSLDP-----------------AELAK----IESEISAIKITESGLRRYIDTNRSL
A1ARV9      T-TFQPLDP-----------------QELEK----IDSEVAAIRASESSLRRYISTNQSL
E8WSZ4      A-ASQPLDP-----------------QELAR----IDSEIAALRITEDGLRRHVATNRQL
A5G425      GFDMSPAET-----------------PDLDR----VEAELKALKAAEANQYVIISSTRSL
B9M2X7      QARLGGAEM-----------------QELER----IDAELRVLRSAESKQYANIASSRAM
G8AU95      ----------------------------AAIPEVLASPLIQKLREAEAMLERRLAELQQG
F0G6H6      -----------------------------------------FMNKHPAVVA---------
A3W0H6      ---------------------------------------IGQLTEQRALVAGRIAENEAA
A3K8W6      ---------------------------------------VAQLEDQRALVAARATEIEGQ
Q0FMP1      ---------------------------------------LGLMREQQSLIEQRISEIEET
S9QRP2      ---------------------------------------VALLQEQKALIAQRSETIRDT
D0D9W1      ---------------------------------------VALLKEQKVLVQNRIAQIEET
I1AYC4      ---------------------------------------IGLLREQKTLVENRIIAINET
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      IAKGPRIELEYQALTRDHENAMSSYSEVKQRLVAAELGEAMEAERKGERFSLIEPPRLPE
E9TE87      VTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITEASTVGD----VRIVDPAITQP
C0QCJ1      VEDTPKKEQDLLSLKRDYANIQSVFNSLLDRKLEAELSVNMEKKQKGEQFRILDHARIPE
I5B297      VEDTPKRELELQSLTRDYSNIQNVYNSILDRKLEAELSVNMEKKQKGEQFRILDHARLPE
C7LPS4      LRRIPTLRTGLNELLRKKDNETLIYSQLVTRYGQSEVSKQMEMENKSMNFRVVDPAVMPD
Q314L4      LREIPSVATELADLENRKRKESLIYEQLVGRYGQSEVSKQMELQDKAVSFRIIDPAVLPS
Q39U16      LRNVPADQKTLTDLIKERDANRQLYEQLLTRQGQAQLTKEMEVEDKATTFRVVDPAIVPM
F0JCB9      LDQIPRAQAELQELKRKEKNEVIIYEKLVSRYGQSEVSKEMELQDKAVSFRVLDPAVIPT
G7QCG0      LRDLPRVKATLAELVNKKDQEAAIYNQLVNRYGQSEISKEMELKDKSVMFRIVDPAVIPE
I2Q342      LRELPRVKATLAELVNKKDQEAAIYNQLVNRYGQSEISKEMELKDKSVMFRIVDPAVIPE
Q74BQ7      LRNIPSAKAGLEKLELEKKNRKDLYDQLMARHGQSEVSKQMEVQDKTTTFRIVDPAVTPS
B5EA80      LQTIPSAKAGLEKLELEKKNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRVVDPALLPV
C6DZX6      LQTIPSAKAGLEKLELEKKNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRIVDPALLPV
A1ARV9      LRSLPSAKADLERLETAKNNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRIVDPALLPQ
E8WSZ4      LQSIPDAKAGLAKLEVERENQKKIYDELYSRHGQSEVSKQMEVQDKSTTFRIVDPAMLPT
A5G425      LHNIPVAKATLEQLERDKNNQKNLYEQLVTRHGQSEVSKQMEVQDKATTFRIVDPAIMPI
B9M2X7      LRNIPAARAELEQLERDKANQKQVYDQLVTRHGQSEFSKQMEVEDKGTTFRIVDPAVLPV
G8AU95      LWRQASGHRESSPRRR--------------------------------------------
F0G6H6      ------VDAQLADAQRSLAAV----------------------REQIQKLPAVEQGVL--
A3W0H6      LAAAPRVERELGALTRNLTQLQDQLSTITTSRVEAEMASVLESRQQQERFEILETAIPPE
A3K8W6      IASAPEVERQLGQLEREMDRLKDQYSVITRGKAEAEMGQALQDRQAAGRYEVLETALVPD
Q0FMP1      LLQAPEVERELSALERDLERLKDQYSVITRRKADAEMGQMLEDRQQTDRFEVLETALVPE
S9QRP2      LRRAPDVERELNEMERQLGSLQEQYSVITRRKAEAEMGSMLEDREQTDRFEVLETALVPE
D0D9W1      IRNAPEVERALSGLERELTQLQEQYNVITRRKADAEMGQMLEDRQQMERFEVLETALVPE
I1AYC4      IQRAPEVERALSGLERELTRLQEQYNVITRRKAEAEMGQMLQDRQHMARFEVLETALVPE
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      QPAKPNRLAIAFLGLVLAFGGGVGNLALQEALDKS-VHNARDVELITMGPPLAVIPFIET
E9TE87      GVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRG-IESPQVLEE-HGISVYASIPL---
C0QCJ1      KPISPDVRKMLVFSLAAGLGVAGGIIFLLEVLDFS-IRRDEDIEK-LGLLVLASIPPLKN
I5B297      KPISPNVKLMFLLSIAGGLGLGGGILFLKELLTFSVIRRDDQIDTLLGLPILASIPPLEK
C7LPS4      TTVSPKRVPIMLLSALAGIGIGMAVIMVPYLMRGS-VESLADLRS-LNQRVLAVLPAISK
Q314L4      VPVSPKRWLILLAGMAAGLGGAFGVLFLFDLLNPR-VRSVEDLRR-LGFHVMAVVPSISD
Q39U16      KPVSPDRVKMIIMGIIMGFVAGAASVFVMEMFDSS-VKDVTSLKK-LGFEVLAVIPTIFN
F0JCB9      IPSSPNRPLIMLAGMAIGVAFGLGVIFLMDLIDPS-IKNVDDLRE-FGIPVLAVIPKLKN
G7QCG0      VPVSPNRPVIILIGIVLGLGAGAGATYLADRFNHS-IRSLHELRT-LGLPVFAVIPRISS
I2Q342      VPVSPNRPVIILIGIVLGLGAGAGATYLAERFNHS-IRSLNELRT-LGLPVFAVIPRISS
Q74BQ7      SPISPNRVKIMLMGIVAGLGCALGLIVLLDRLNNS-VHSVDALKE-TRIPVLAVIPKIRT
B5EA80      KPSSPDRLKLMLLGMVGGVAGSFALLFLVDHLNIT-VKEVEFVKG-LGVPVLAVIPRLQD
C6DZX6      KPSSPDRLKLMLLGMVGGVAGSFALLFLIDQMNNT-VKEVEFVKG-LGVPVLAVIPRLQD
A1ARV9      KPVSPNRLRIMLLGFIGGLAGSFGLLFLLDQMDGT-VKDVDFLKQ-FGVPVLAVISRIRI
E8WSZ4      RPASPNRLLIMLLGIFGGAAGSLFLLVLRDQMDTT-AKEVDFVKS-LGGPVLAVVPRMQI
A5G425      NPVSPNRVNIILMGIGAGLVIAFCLLMLLDYLDQS-VKNVDALKS-FGLPILAIIPKMQN
B9M2X7      KPISPNRIAIILGGIAGGLAVAFGLVLLLDYYDES-VKSLDGLKA-LGLPVLAVIPKMQI
G8AU95      ------------------------------------------------------------
F0G6H6      -----------------------------------------QLQRDVTVDTALYTNLLNA
A3W0H6      FPVSASRKKLVIAGAVASLVAGIGFAVLLEIMNPA-IRSAAQLEQELEITPVVTIPIVRL
A3K8W6      DPVTSSRKKIAGMGAVASLIAGLIVALVFEIMNPA-IRTQKQMERVLGIQPVVVIPVIST
Q0FMP1      FSASSGRKKIVLAGVVASVLAGVVIAFVAELLNPA-IRSAAQMERVLGLQPVVSIPVVEA
S9QRP2      VPASQSRRKLAMAGGVASLLAGLGIAFLAELMNPA-IRSAAQMERSLGIQPVIAVPVIRS
D0D9W1      VPASSSRKNLAAMGAVASLIAGLVAGFVAELANPA-IRSAAQMERALGIQPVVAIPPIRT
I1AYC4      FAASGSRKKVLAMGVVASVIAGLAATFIAELMNPA-IRSAAQMERALGVQPVVSIPTIRT
G5SDT9      ---------FSAQGVVGQPLNKDGVTMRVEAIDAR-PDTEFTVSTVSKFSTLGILR----
G5LQM7      ---------FSAQGVVGQPLNKDGVTMRVEAIDAR-PDTEFTVSKK--------------
G5Q4J1      ---------FSAQGVVGQPLNKDGVTMQVEAIDAR-PDTEFTVSKPVLIQNLR-------
E7T802      ---------FTVNGMVGQRLEKMALR----------------------------------
F4SM98      ----------------GKKLTELLVFY---------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      EADVHRRTRR--RLIAVLGSILGVVLATAAVHQF-----VMPLDVLWIKVLDRAGLLHTE
E9TE87      --SEWQKARDSVKTIKGVKRYKQSQLLAVGIQPIWRLKPSAVCVPVCTSR----------
C0QCJ1      PGD-RLKKRLEMIFLSLAATYALVMLAAFIVLNDKGLDRVVNFIKSFING----------
I5B297      PNG-RTKKKIEWAMFICCCSYSAVFLAFFAILNHKGLDRTMNFIKTTLNL----------
C7LPS4      PKEERQRVRGDRIFMSGAALYFLMLVTIGVMEAL-----GNSPLDVLFERALGPWL----
Q314L4      VAEERRIFRRRAAVTACGVLLCGGVVAVAAAEFL-----QLRFMENFIAGAVFTVKSWF-
Q39U16      QEEASKVAKKDRKIYLVAGCYFALICLMLTHELL-----GLTLIEKVLTKLGLDQFIMS-
F0JCB9      VEEERKTSRRNLRIYVIVAVGLMIFLAFLGSEFL-----GLGLVDKLIAKGALVVQQWRM
G7QCG0      EKEIRRQARRDHLVMAVAGGYFALVVGVLVLETLRAQGVGTAWLQKIAHSIL--------
I2Q342      EKEVRRQARRDHFVMAVAGGYFALVVGVLVLETLRAQGVGTAWLQKIAHSIL--------
Q74BQ7      IEAVARERSENIRVFAAAGACFMVILAFLVMELL-----NISPVDRIISRLHGML-----
B5EA80      PEVEAKRRRRSRLILGCALVYFLVLMVFPGMELL-----GLPYMDKVLDLLSGPEARLRI
C6DZX6      PEVEAKRRRRSRLILGGALMYFLVLMVFPGMELL-----GLPYMDKVLDLLSGPEARLRI
A1ARV9      QRDIELQRRRTKRLCLYAGAYFLFLLCFPLSELI-----GLTFMDTLVDALRPANLVQNV
E8WSZ4      PEEVARLHRKSLGVFALSAFYFLLLLVFPTMELM-----GLPYMDQVLDRVSSSGITQGV
A5G425      PVELLLQKKKNVKLYVIASVYFSLILTVLLLEVL-----NSSLSNTFIDSIEIKQYLPDL
B9M2X7      PAEIKLQKAHDVRLYAISACYFSLILIVLLLELL-----QIPLFSSSLNSLQLKQYLSQA
G8AU95      ------------------------------------------------------------
F0G6H6      RQQMMLARASKTGTVRI-------------------------------------------
A3W0H6      RHERRRRALKIAGTVVMILLIVPILVRFAQERLMPLRMLSGN------------------
A3K8W6      RRDRTWGGLKFLAKALGIVALVGGVAAWLTK-ISGLGALFGGGAPRRAVRG---------
Q0FMP1      RRDRRSRQLRSVTAVGLLAALMLGLYRLFTD-ILPWQGLLDRFLPRMARS----------
S9QRP2      RGHHRRRGLGLLALVALLAGAVWAGLRFVGD-LGPLQGLLERILPRSVQSS---------
D0D9W1      SRDRRGKGLRRLGLFALLAAALWAGLHFFGS-LVPWQGLFGKWLPRAAQG----------
I1AYC4      RGERRITGMRLFSLLGLLFAAMWAAL---SS-VTDWSALLGRFLPRAVRP----------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
                                                                        

F3CAY8      ----------
G7EJX5      ----------
H8YYB8      TPNPS-----
E9TE87      ----------
C0QCJ1      ----------
I5B297      ----------
C7LPS4      ----------
Q314L4      ----------
Q39U16      ----------
F0JCB9      ----------
G7QCG0      ----------
I2Q342      ----------
Q74BQ7      ----------
B5EA80      KGLLQ-----
C6DZX6      KGLLQ-----
A1ARV9      KDQVR-----
E8WSZ4      KGILH-----
A5G425      MSQIKYHGGN
B9M2X7      VGQFK-----
G8AU95      ----------
F0G6H6      ----------
A3W0H6      ----------
A3K8W6      ----------
Q0FMP1      ----------
S9QRP2      ----------
D0D9W1      ----------
I1AYC4      ----------
G5SDT9      ----------
G5LQM7      ----------
G5Q4J1      ----------
E7T802      ----------
F4SM98      ----------
                      

© 1998-2019