BYKdb

Dataset for cluster orphancd of phylum rhodothermaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A259U0G8      ------------------------------------------------------------
A0A271IXI4      MSITPTSSSRDPLLYAPAPGGGLRSGLQSLSRLLRRHWLIVAGSIALALAIAGAYLYFTP
                                                                            

A0A259U0G8      -----------------------------------MANELYLLQYAQDLADDAARALLVE
A0A271IXI4      DMYRAESVLLSEESDPNDPDDALSLGFVPGPTEEGPDEQLLMLRESSALAQEVAAQLLGG
                                                     ::* :*. :. **::.*  **  

A0A259U0G8      AETAGGELPITQTNDGDLAPVETVANRVGNAIRVDGAQDGVEGIQISAVSQSPVEAARVA
A0A271IXI4      SGTAAGP-------AGAESP-EALARQLRATVEFTAYEPNAIG--IAATSTDPREAARIA
                : **.*         *  :* *::*..:  :: . . : .. *  *:*.* .* ****:*

A0A259U0G8      NLYADLYVARTQSSSRSSVSASRSFLKRQVDSVAVELRAREEATEAYMNREGAVRLDQEA
A0A271IXI4      DVYAEVAIAHARNESKRRLAESRAFAEERLASAEADLRDAEGALAGFMSREGTAGLDAEA
                ::**:: :*.:...*.  :: **:* : .: *. .:**  * *  .:*.***:. ** **

A0A259U0G8      SNLVGQLSQLEAERDQARVEVGIRSNQIATLRNQIESLEQNVETRLRATADRELSESQAR
A0A271IXI4      AAVVNDGARLASSVREAAAALQARRASVRATETELGRIRPGLARRVASGVDREIEAAQTQ
                : :*.: :.* :.  :* . :  *  .: :  .::  :  .:  *: : .***:. :*:.

A0A259U0G8      VASLRAQLNQEYLSNPEFRNGGADVPARVLNAQREVATLERRIEQLSGQIAREAMAAGGV
A0A271IXI4      IATLETRLEQFYQNTPEARSDPSDPRARPL--RDEIAQWRQRVDDLSAQYVQETLAAGGS
                :*:* :.*:* * ..** *.. :*  ** *  . *:*   .*:::**.* ..*::**** 

A0A259U0G8      DGN--TSGLSRIANLRDQLGQAQVELSGLRERINILNSRISEYQGDLDQVPAQTVDLARL
A0A271IXI4      NAGDASSGISYATELERRLIDDRIAITGLEAQIAAQRGQLGSYAARRQSIPRQSVAVGQL
                :..  :**:*  ::*  .* : .: ::**  .*   ...:..* .  :.:* *:* :..*

A0A259U0G8      IRDRESTEQLLRNLTAKLQEVSVRESAELGYAEVLRPAPVPSTPAAPNRTRIMMLGLAIG
A0A271IXI4      ERKRASAEQLYLYLANTLQEITIAENSEIGSLQLLRRATTPDAPLNRGPVQVLGLAALLG
                 *.* *:***   *: .***::: *.:*:*  ::** *..*.:*   . ..:: *.  :*

A0A259U0G8      LGLGVVLAVGRDQLDQRIRRPIDLRDMGYPVLGVIPSIDRLIEDDFGGAETVRVQDRDVD
A0A271IXI4      LLLGFGTALARSRIDARVHTPEDIEALGMPLLGVIPKVEDHAAAAEGGPM----------
                * **.  *:.*..:* *:. * *:  :* *:*****.::       **.           

A0A259U0G8      TRLVTLLVPVAQASEAFRGLRTSIQFSRPDTVIQTILVTSGSPGEGKTTMSSNLAAVMAQ
A0A271IXI4      GNVVAVLDAQSAAAEAYRHLYSRIQFSRPDRVVEVVLVTSPEVGAGKSTTALNLAATMAR
                 .:*::* . : *:**:* * : ******* *::.:**** . * **:* : ****.**.

A0A259U0G8      SGRRTLLVDCDLRRSRAHKLFGLNREPGLTDLLSR-GANGPASGAAIGAVEVADDLFVLP
A0A271IXI4      ANRRTLVIDADLRRPSVGRYLGVDGGPSLQSLIDRDGSLEDAEALVEGAFTPVWNLYALA
                :.****::*.****. . . :*::  *.* .*:.* *:   *.. . **.  . :*:.*.

A0A259U0G8      AGSHVPNPSEHLGSLALRQQLDQFKKEFDIIILDAPPVMAATDAVLLSTQVDASMLVAAA
A0A271IXI4      TSTPVEVPMELLTSERLRELLGAFRSRFDTIVIDTPPMMVASDAALLASQSDACLLVVSS
                :.: *  * * * *  **: *. *.. ** *::*:**:*.*:**.**::* **.:**.::

A0A259U0G8      GKTKDYELEFAVTELTNVGAHIIGVVLNRFDITKEYAYRAQYRYQYGKKYTYGASST-
A0A271IXI4      GQTDTEALAQSRRELEDAGGHVIGVVLNQFD-PAEARYKSTYGYRERHYASYHDLRVN
                *:*.   *  :  ** :.*.*:******.** . *  *.: * *.  :  :*    . 

© 1998-2019