BYKdb

Dataset for cluster tadcd of phylum rhodothermaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A271IYV2      MPTPQPFPPETFGASPPPPDYSRPGYVYGPPRRPADLASQLREWVDVVVRGRWLILACVA
A0A271J0V4      -MPELPYPTVTDRTSPGAPYRGEEPFYYGDQD-----GLDLRALLDILLRGKWIILATML
A0A271JH24      -MIDQPYPTAADRGAPGAPVRGEDPFYYGDRD-----GIDLRALLDILLRGKWIILGAVL
                     *:*. :   :* .*  .   : **        . :**  :*:::**.*:**. : 

A0A271IYV2      AVLVPVTAYVVTAPDVYEASSYLYVETSSGGGLSGMMPTGSDVVPFVQDQGISNELYILQ
A0A271J0V4      ALAVPVVLYSIVSPSKYRAYSILLVDKTD-TDLADVLPEQVPTAFWRQERNLSNELLVLD
A0A271JH24      ALTIPVMVYSMLSPSKYRSYAILLVDKTD-TDLADVLPEAMPSGFWRQERNLSNELLVLD
                *: :**  * : :*. * : : * *:.:.  .*:.::*       : *:..:**** :*:

A0A271IYV2      KAEDLPRAVAATLL--AQAASEEAPPLTVVETETGELASVEEVADRVT-EYIRVQQDGGD
A0A271J0V4      QSTELAESVARRLMEAGRVPGTERPLSILNDDDPATPLTVEEVAFRLQKEYINSSMETGG
A0A271JH24      QSMPLAEAVAARLIEAETVPGTNRPLPILRDDDPSTPLTVQEVAFRLQRGSIKSTMETGG
                ::  *. :**  *:    ... : *   : : :..   :*:*** *:    *.   : *.

A0A271IYV2      RTNGVRVAAKSTSPQEAALIAQLYAQAYVDRTQNSSRASVAASREFLESQADSVAAQLRS
A0A271J0V4      -ADAIRVNAVSTDPAEAALIANAFSEAFADLTQDQSRSSASASREFLEDQVETQNERLRE
A0A271JH24      -ADAIRVNAVSTDPQEAALISNTYAEAFAQLTQDQSRSGASASREFLEDQVETQNDRLQE
                 ::.:** * **.* *****:: :::*:.: **:.**:..:*******.*.::   .*..

A0A271IYV2      REEAARAYMDEEGAVRLDEEASNIVSQLAALQAERDQARVEAGMEASRIAELRAQIARLE
A0A271J0V4      ADAAVEDYMLQEGAVALQEETTRLVDQIATLDARRDQASVNLQTKRAELAALQGELARLE
A0A271JH24      TDAAVEQYMLREGAVALQEETSRLVDQIATLDARRDQAQVNLVTKRAELAALQSELSRLE
                 : *.  **  **** *:**::.:*.*:*:*:* **** *:   : : :* *..:::***

A0A271IYV2      GTVAQRMGSGTARELRQDEERLAALRERLETIYLNDPALRSRSDVPADVAQLRRQIDQLE
A0A271J0V4      GQLGDRLSSNLDGQLVTVREQIQQLRGELETFYSQNPALRTNPNPPANIARLRSELQRAE
A0A271JH24      SQLGTRLSSNLDSELAAARERIQQLNAELEVFYRQNPALRNDTNPPANIARLRTELARVE
                . :. *:.*.   :*    *.:  *.  **.:* ::****. .: **::*.** :: . *

A0A271IYV2      TRVQQRSDQLVEEAIAAG-GVDAAAEGLPRLSALRDRLTEAEVALQGLRSQISILNDRIA
A0A271J0V4      SEQDRIARALSEQSLASSTGPNDQASGFSRAAELRSQISAARVAVRGLEAEVRQVGARLG
A0A271JH24      ADQERIARQLSAQSLASGSSPDDQRSGFVRAADLRAQISAARVAVRGLEAEVSQVSSRLG
                :  :. :  *  :::*:. . :   .*: * : ** .:: * **:.** :::  :. *:.

A0A271IYV2      AYQSDLDQIPSQSVELARLIRERESAERLALGLDQRLQEARVAESAELGYAEVVRSADVP
A0A271J0V4      QYEGELSSVPEQSIELAQLERDRRAAETLYGALEQNLQQARVAEQSQLGYARVIRPAFPP
A0A271JH24      QYESELSNVPAQSIELAQLERERQAAETLYGALEQNLQQARVAEQSQLGYARVIRPAFPT
                 *:.:*..:* **:***.* *:* :** *  .*:*.**:*****.::**** *:*.*  .

A0A271IYV2      EDPVAPNRPQTLILGLILGLGLGVMLAVGRAQLDQTLRRPTQLRELGHPILGVIPDVTKL
A0A271J0V4      TRAFSPLRVRNTVLALLCGLVFGGLLAIGRVKLDHRIHTPDDLGKLGFPVIGTVPSTDTL
A0A271JH24      PAPFSPLRARNTILALLCGLVFGSLLAIGKVRLDHRIHTPDDLAKLGHAIIGTVPSTTAL
                  ..:* * .. :*.*: ** :* :**:*...**: :. * :* :**..::*.:*..  *

A0A271IYV2      IEEDAGGADAVTVQGWTLDSRVVTILYPMSAGAEAFRGLRTSVQFSKPDAVVQTLLVTSA
A0A271J0V4      VKEEYGGAEAAEVNGRMVDTHVVSLLNPMATASESYRALRTNIQFSRPDVVVQTILVTSA
A0A271JH24      VKEEYGGADVAEVNGRMVDTHVVSLLNPMATASESYRALRTNIQFSRPDVVIQTILVTSS
                ::*: ***:.. *:*. :*:.**::* **::.:*::*.***.:***.**.*:**:****:

A0A271IYV2      SPGEGKSTVAANLAAVIAQSGRRTLLIDADLRRPRVHSLFGMSKTPGLSEYISGQGDQRD
A0A271J0V4      NPGEGKSVTSSNLAVVFAQAGRRVLLVDSDLRRPTVHKKLGIPREPGLVQELFTDDEINP
A0A271JH24      NPSEGKSVTSSNLAVVFAQAGRRVLLVDADLRRPTVHKKLGISREPGLVQQLFSSESIQA
                .*.****..::***.*:**:***.**:*:***** **. :*:.. *** : :  . . . 

A0A271IYV2      IT---VGDEFDVLPAGTMVPNPAEYLGSKAFRDLLDGFRQTYDVVVIDAPPVLAATDPVL
A0A271J0V4      DALDRLADDLYVLPAGSIAPNPSELIGSRRMRDLIEDMRSKFDIIIFDAPPILAATDAVL
A0A271JH24      TTLDQLADDLYVLPAGSLAPNPSELIGSRRMRDLIADMRTKFDIIIFDAPPVLAATDAVL
                 :   :.*:: *****::.***:* :**. :***: .:* .:*::::****:*****.**

A0A271IYV2      LSTQVDGTVVVAAAGQTKDFELEHAVQEIHNVGGDVLGVVFNRFDVSKEYGYRYQYAYRY
A0A271J0V4      LSTQCDATLVIARAGETKDFELQSAMTALADVGTKPSGLVLNAFDVRQAYGYRYKYAYRY
A0A271JH24      LSTQCDATLVIARAGQTKDFELNSALAALKDVGTKPSGLVLNAFDVRQAYGYRYKYAYRY
                **** *.*:*:* **:******: *:  : :** .  *:*:* *** : *****:*****

A0A271IYV2      GRKYTYGHEGNA-----
A0A271J0V4      GSSYGYGSSKVTEA---
A0A271JH24      GNAYGYGSPKAADQPDA
                *  * **    :     

© 1998-2019