BYKdb

Dataset for cluster tadcd of phylum spirochaetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1V5RSB2      MNQAYDDQ--YTVHQ-QFDEEGMTIRELLSIFRKRFFWFLLGLVLVSGAAVGYLFWATPL
G8QXQ5          MNENTETQ--TGQNIYDNNDEGISLSELLKIFKHHFKWFLFGFFLVVGMAVVYLQLAIPQ
A0A372MIZ7      MSQQEEYA--QSTSPFDAGEEGISIAELLHIFHKRLRWFFVGFILVVALALGYLQIAIPQ
A0A356E0K2      MSQQEEMQ--NTLAPYDSGEEGISIAELLHIFRKRFRWFVIGLVLVVGLAVGYLQIAIPQ
A0A3C1ZMS7      MSQQEEMQ--NTLAPYDSGEEGISIAELLHIFRKRFRWFVIGLVLVVGLAVGYLQIAIPQ
A0A375AMC2      MSQQEELQ--NTLAPYDSGEEGISIAELLHIFRKRFRWFVIGLVLVVGLAVGYLQIAVPQ
F0RTV6          MSQQEELQ--NTLSPYDSGEEGISIAELLHIFRKRFRWFVIGLIVVMGLAVGYLQIAVPQ
A0A3C1LV35      MDRKEEAKVRSVNYAEKQAEQEISITQILGIIKQRRVWVYVFFVLACALAVFYLKITDPS
A0A2N1RHF1      MDSMNMAQ----QIPDDDMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPM
A0A2N1RZJ4      MDSMNMAQ----QIPDDDMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPM
A0A3D1WX44      MDSMNMAQ----QIPDDDMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPM
A0A2N1SPK0      MDSMNMAQ----QIPDDEMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPM
                *.              .  :: ::: ::* *:. .  *. . :.:. . *: **  . * 

A0A1V5RSB2      YESQVSVLVNPIQNSSSIDSLLSVTSSGAKIATEVELITSRSNINEALARLDLTRYENDE
G8QXQ5          YESGVSVLVDPIQKSSSIENLLESSASSTKIATEVELITSRKNIEFALSTLDLDSYKNAE
A0A372MIZ7      YESEVSVLVDPIQTSSSFESLMDMSASSTKIATEVELITSRSNIDYALSTLDLSQYKNAD
A0A356E0K2      FESQVSVLVEPIQRSSSFESLLNVSASTTKIATEVELITSRKNIEYALGTLDLASYRNAD
A0A3C1ZMS7      FESQVSVLVEPIQRSSSFESLLNVSASTTKIATEVELITSRKNIEYALGTLDLASYRNAD
A0A375AMC2      YESQVSVLVEPIQRSSSFESLLDVSASTTKIATEVELITSRKNIEYALGTLDLSSYHSSD
F0RTV6          YESQVSVLVEPIQRSSSFESLLDVSTSTTKIATEVELITSRKNIEYALSTLDLASYHNAD
A0A3C1LV35      YQASATALVEPISNATSIESLLTSSTSSTKIDTEIQLITSSSNLQNALDKLDLTKYLDPD
A0A2N1RHF1      YESEVTILVDSLQKGTDFESMLLGQ-STAKISTEVELTLSRSNIESALAKLDLSRYRTED
A0A2N1RZJ4      YESEVTILVDSLQKGTDFESMLLGQ-STAKISTEVELTLSRSNIESALAKLDLSRYRTED
A0A3D1WX44      YESEVTILVDSLQKGTDFESMLLGQ-STAKISTEVELTLSRSNIESALAKLDLSRYRTED
A0A2N1SPK0      YESEVTILVDSLQKGTDFESMLLGQ-STAKISTEVELTLSRSNIESALAKLDLSRYRTED
                ::: .: **:.:. .:.::.::    * :** **::*  * .*:: **  ***  *   :

A0A1V5RSB2      GESYAADIAFPNSVKEK-ISVTTVKDTNIVRISVTDANRFFARDFANVLAESYDSMLTSI
G8QXQ5          GDSYSNREVLGN-VKDR-IVVSTVKDTNIVKIVVTDASPMFARDLANALASSYDGLLTGI
A0A372MIZ7      GFDYRDKLVLGN-LKER-IAVTTVKDTNIVRIKITDENPVFARDFANALASSYDTLLTGI
A0A356E0K2      GMDYRSKDVLGD-VKER-IVVSTVKDTNIVRITVTDANPAFARDFANALATSYDSLLTGI
A0A3C1ZMS7      GMDYRSKDVLGD-VKER-IVVSTVKDTNIVRITVTDANPAFARDFANALATSYDSLLTGI
A0A375AMC2      GIDYRSKEVLGN-VKER-IVVSTVKDTNIVRIAVTDANPAFARDFANALAASYDSLLTGI
F0RTV6          GVDYRSKEALGN-VKER-IVVSTVKDTNIVRIAVTDASPAFARDFSNALAASYDSLLTGI
A0A3C1LV35      GIPYSEKKLKGS-SFSKVVSVSTVSSTKVVKITVEDGNPQFCADYANAILEAYTEMLTRI
A0A2N1RHF1      GVSYAGEGIVGN-IKGR-TSVTTVKDTNIVRITVTDQDPTFARDFANALAESYNELLGSI
A0A2N1RZJ4      GVSYAGEGIVGN-IKGR-TSVTTVKDTNIVRITVTDQDPTFARDFANALAESYNELLGSI
A0A3D1WX44      GVSYAGEGIVGN-IKGR-TSVTTVKDTNIVRITVTDQDPTFARDFANALAESYNELLGSI
A0A2N1SPK0      GVSYAVEGIVGN-IKGR-TSVTTVKDTNIVRITVTDQDPTFARDFANALAESYNELLGSI
                *  *       .    .   *:**..*::*.* : * .  *. * :*.:  :*  :*  *

A0A1V5RSB2      ARNSKTAQRTFIESQIPINDQALREANDRLGDFKERSEIIQLSDKSSLLVNQISYYDLRL
G8QXQ5          AKNSKTAQREFIDAQIPINQKMLVLASDALGDFRENSDIIQLTDKSTLLVNEISYYKLRL
A0A372MIZ7      AKNSKTAQREFIESQIPINDRALSAAGDALGDFRENSDIIQLTDKSSMLVEQISYYTQRL
A0A356E0K2      AKNSKTAQREFIESQIPINDRELSRASDALGDFRENSDIIQLTDKSSLLVEQISYYTLRL
A0A3C1ZMS7      AKNSKTAQREFIESQIPINDRELSRASDALGDFRENSDIIQLTDKSSLLVEQISYYTLRL
A0A375AMC2      AKNSKTAQREFIESQIPINDRELSKAGDALGDFRENSDIIQLTDKSSLLVEQISYYTLRL
F0RTV6          AKNSKTAQREFIESQIPINDAELSNASDSLGDFRENSDIIQLTDKSSLLVEQISYYTLRL
A0A3C1LV35      SKNSKSAQREFLETQIPETEALLDEASEKLADFKETSGIMQMTQKNTLLTSKIAAFQLEK
A0A2N1RHF1      ARNNKTIQKDFIQSQIPINEKQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRR
A0A2N1RZJ4      ARNNKTIQKDFIQSQIPINEKQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRR
A0A3D1WX44      ARNNKTIQKDFIQSQIPINEKQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRR
A0A2N1SPK0      ARNNKTIQKEFIQSQIPINEQQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRR
                :.*.*: *. *:::*** .:  *  * : *. *.* *  :*:::*..:* .:*: :    

A0A1V5RSB2      EPLKLQLEEAYIGFRSHEPFIAASGTTSDQLLTTIRSDEEISKKLSELESWLLELAMYES
G8QXQ5          EPLKLQMQEASVFIQNYNQGLVNAGIKGILTLDELGNDVKIKAKLKELNGWKTELTMYES
A0A372MIZ7      EPLKLQLREAMVFLDSYNEGLTQAGVTGVLSLDDVRRDPVIAEKLNDLAAWKTELTMYES
A0A356E0K2      EPLKLQLRESEVFIDTYNASLKQAGVEGVLTLDQIKKDSVVMAKLSDLSAWKTELTMYES
A0A3C1ZMS7      EPLKLQLRESEVFIDTYNASLKQAGVEGVLTLDQIKKDSVVMAKLSDLSAWKTELTMYES
A0A375AMC2      EPLKLQLKESEVFIDSYNASLKQAGIDGVLTLEQIKNDSVIISKLADLSAWKTELTMYES
F0RTV6          EPLKLQLKESQVFIESYTNSLKAAGIAGVLALDQIKNDSVVMAKLADLGAWKTELTMYES
A0A3C1LV35      APLSLQLVEVESLLASLNSDGSLMAVE-TIAQNDAVR-----VSLEEYVSNSKELMMYQN
A0A2N1RHF1      EPLALQLKEADLIIQAHEETLSSFALE-TPGYDEVLADIDMGNLLESYMQRSRELIMYEA
A0A2N1RZJ4      EPLALQLKEADLIIQAHEETLSSFALE-TPGYDEVLADIDMGNLLESYMQRSRELIMYEA
A0A3D1WX44      EPLALQLKEADLIIQAHEETLSSFALE-TPGYDEVLADIDMGNLLESYMQRSRELIMYEA
A0A2N1SPK0      EPLALQLREADLIIQAHEGTLSSFALE-TPGYDEVLADIDMDHLLESYMQRSRELIMYEA
                 ** **: *    :          .                   * .   .  ** **: 

A0A1V5RSB2      LPTNLGQG-----ALSEGTLARIFTINNAIDTTKKSLLNRVRKLIEC----------CYI
G8QXQ5          LSSPQIGTSAT--SLSSNNSSRVYFLNSAIEQITKDLLDRVSVLTSA----------YAN
A0A372MIZ7      LGNSSAPQTQV--SMPMDASSRTYVISSAMNQLNKDLLDRVSLLTRS----------YGN
A0A356E0K2      LSNLAGNASTAAPSTTLDSSSRIYVINSAINQVTKELLNRVADLTRS----------YAN
A0A3C1ZMS7      LSNLAGNASTAAPSTTLDSSSRIYVINSAINQVTKELLNRVADLTRS----------YAN
A0A375AMC2      LSNPARNTATLAPSTTLDSSSRTYVISSAISQVTKELLNRVASLTKK----------YAN
F0RTV6          LSNPAGNTATVAPSTVLDSSSRTYVISSAISQVTKELLNRISTLTRS----------YGN
A0A3C1LV35      VD-------------ATASSSRVYVLESSLASNEKNVLNAVTEIVGS-----------EN
A0A2N1RHF1      IQ-----------EGVPEGSDRLFVLQSALNQLSKSLLDRVTLLVAPRGLSTDPFIMVTS
A0A2N1RZJ4      IQ-----------EGVPEGSDRLFVLQSALNQLSKSLLDRVTLLVAPRGLSTDPFIMVTS
A0A3D1WX44      IQ-----------EGVPEGSDRLFVLQSALNQLSKSLLDRVTLLVAPRGLSTDPFIMVTS
A0A2N1SPK0      IQ-----------EGIPEGSERLFVLQSALNQLSKSLLDRVTLLVAPRGLSTDPFIMVTS
                :                    * : :..::    *.:*: :  :                

A0A1V5RSB2      DSLAQNIAQILTTGVSIDILQSRAAVFEEELSRLPLLERTLSELLRDVQISEAIGLKLRE
G8QXQ5          ESNTQSIVQLLTTEVAIQVLEERGAQFTNELSQLPVLERQLSELQRDVQIYETIDLKLRD
A0A372MIZ7      ESYTQAIVQALTTEVGIQVLEERGEVFISELSQLPVLERRLSELQRDVQIYEAIGLKLRE
A0A356E0K2      EANTQAIVQALTTEVGIQVLQQRGAVFVEELSQLPVLERRLSELQRDVQIYEAIGLKLRE
A0A3C1ZMS7      EANTQAIVQALTTEVGIQVLQQRGAVFVEELSQLPVLERRLSELQRDVQIYEAIGLKLRE
A0A375AMC2      EANTQAIVQALTTEVGIQVLQKRGAVFVEELSQLPVLERRLSELQRDVQIYEAIGLKLRE
F0RTV6          EAYTQAIVQALTTEVGIQVLEMRGEVFVEELSQLPVLERKLSELQRDVQIYEAIGLKLRE
A0A3C1LV35      TMYAKAITEYLCVKASISAIDNIIESYNEELSDYPIMERQYLELQRDVEIYEQLLLSLRQ
A0A2N1RHF1      QELAKAMHQRAMTEAQMSVLESIEMTYSDELSHLPILERQLLDLQRDVEVYETLRMRLME
A0A2N1RZJ4      QELAKAMHQRAMTEAQMSVLESIEMTYSDELSHLPILERQLLDLQRDVEVYETLRMRLME
A0A3D1WX44      QELAKAMHQRAMTEAQMSVLESIEMTYSDELSHLPILERQLLDLQRDVEVYETLRMRLME
A0A2N1SPK0      QELAKAMHQRAMTEAKMSVLESIEMTYSDELSHLPILERQLLDLQRDVQVYETLRMRLME
                   :: : :   . . :. ::     : .***  *::**   :* ***:: * : : * :

A0A1V5RSB2      MLEEIKLLEASVSGNVKVIDTANLPLK------PVSPNSLLILAVALLLGSAIGLLLALL
G8QXQ5          MLEEVKLVEAAVTGNVTVVDQANIPLN------PVSPNKLLILAVALLLGCAVGLLFALG
A0A372MIZ7      MLEEVKLVEASVSGNVTVVDEAILPRN------PVSPNRVLILAVALLLGAAFGLLLTLA
A0A356E0K2      MLEEVKLTEAAVTGNVTVIDAANLPLN------PVSPNKLLILAVALLLGAAIGLLLTLG
A0A3C1ZMS7      MLEEVKLTEAAVTGNVTVIDAANLPLN------PVSPNKLLILAVALLLGAAIGLLLTLG
A0A375AMC2      MLEEVKLTEAAVTGNVTVVDAANLPLN------PVSPNKLLIIAVAMLLGAAIGLLLTLG
F0RTV6          MLEEVKLTEAAVTGNVTVVDAANLPLN------PVSPNKLLILAVAMLLGAAIGLLLTLG
A0A3C1LV35      LLEETKMVEAAVVGNVNVIDEAVVPIR------PVSPKKLMVMAIAVVGGVVLGVLFGLF
A0A2N1RHF1      LLEEVKIAEAAVAGSVTVVDPAIVTQNREGTAIPVSPNKMLILAVSVLLGGALGILLALL
A0A2N1RZJ4      LLEEVKIAEAAVAGSVTVVDPAIVTQNREGTAIPVSPNKMLILAVSVLLGGALGILLALL
A0A3D1WX44      LLEEVKIAEAAVAGSVTVVDPAIVTQNREGTAIPVSPNKMLILAVSVLLGGALGILLALL
A0A2N1SPK0      LLEEVKIAEAAVAGSVTVVDPAIVTANREGTAIPVSPNKMLILAVSVLLGGALGILLALL
                :*** *: **:* *.*.*:* * :. .      ****: ::::*:::: * ..*:*: * 

A0A1V5RSB2      VESLDTSIQNEEQVQRIVGRNAPMLGWVPIMKTYQKD--VYPMFMVRTHPNSFEAERLKL
G8QXQ5          IEASDQTIRNEAQIKKLVKNAIPLLGWLPLMKVSPKD--KYPMFSVFNDPLSFEAERFKL
A0A372MIZ7      IEALDVSIQTEQQIQKIVGKDVPLLGWIPMMKVSNLD--LYPTLIVYNDPLSFESERFKL
A0A356E0K2      IEALDVSLQSEQQIQKIVGNDVPILGWIPMMKVSEKD--KYPTLSVYNDPLSFESERFKL
A0A3C1ZMS7      IEALDVSLQSEQQIQKIVGNDVPILGWIPMMKVSEKD--KYPTLSVYNDPLSFESERFKL
A0A375AMC2      IETLDVSIQSEQQIQKIVGKDVPILGWIPMMKVSDND--KYPTLSVYNDPLSFESERFKL
F0RTV6          VETLDVSIQSEQQIQKIVGKEIPILGWIPMMKVSEND--KYPTLSVYNDPLSFESERFKL
A0A3C1LV35      LEFIDDSIRSEDSIKQILGSEIPSLGWTPYVKNVEKIQKEIPALYVFNDPDAAVSERFKS
A0A2N1RHF1      VEMLDVTIKDEGTLRKLAGPNRPLLGWIPLMSFNQDL--DIPSLVVHNDPLSFESERYKL
A0A2N1RZJ4      VEMLDVTIKDEGTLRKLAGPNRPLLGWIPLMSFNQDL--DIPSLVVHNDPLSFESERYKL
A0A3D1WX44      VEMLDVTIKDEGTLRKLAGPNRPLLGWIPLMSFNQDL--DIPSLVVHNDPLSFESERYKL
A0A2N1SPK0      MEMLDVTIKDEGTLRKLAGPNRPLLGWIPLMSFNQDL--DIPSLVVHNDPLSFESERYKL
                :*  * ::. *  :..:     * *** * :.         * : * . * :  :** * 

A0A1V5RSB2      IANMIYS---MDGKKVFSITSSSMAEGKSMIVANISLALAQLGNKVLVVDGDLRLPSMER
G8QXQ5          ISNMLYN---KHDMKVFSITSCSMAEGKSTIVANVALSLAQMGKKVLIIDGDLRLPSMER
A0A372MIZ7      VANMLYN---RSEKHVFSITSCSMAEGKSTIIGNIAVALAQMGSKVLIIDGDLRLPSMER
A0A356E0K2      IANMLYN---KTDKKVFSITSCAMAEGKSTIIGNIALALAQMGSKVLIIDGDLRLPSMER
A0A3C1ZMS7      IANMLYN---KTDKKVFSITSCAMAEGKSTIIGNIALALAQMGSKVLIIDGDLRLPSMER
A0A375AMC2      VANMLYN---KTDKKVFSITSCAMAEGKSTIIGNVALALAQMGSKVLVIDGDLRLPSMER
F0RTV6          VANMLYN---KTDKKVFSITSCAMAEGKSTIIGNMALALAQMGSKVLVIDGDLRLPSMER
A0A3C1LV35      IANNIVY-SLPKKIQVLSINSTEMGEGKTTAICNVATAYALSGKKVLLIDGDFRKPAIEA
A0A2N1RHF1      IANNVSFGTMRNNQRIFSITSPGMGEGKTSATANIATSMAMNGLKVLVIDGDLRLPQLET
A0A2N1RZJ4      IANNVSFGTMRNNQRIFSITSPGMGEGKTSATANIATSMAMNGLKVLVIDGDLRLPQLET
A0A3D1WX44      IANNVSFGTMRNNQRIFSITSPGMGEGKTSATANIATSMAMNGLKVLVIDGDLRLPQLET
A0A2N1SPK0      IANNVSFGTMRNNQRIFSITSPGMGEGKTSATANIATSMAMNGLKVLLIDGDLRLPQLET
                ::* :         .::**.*  *.***:    *:: : *  * ***::***:* * :* 

A0A1V5RSB2      FFRLEHQSVGLVDAVTSGVSLEDCIVQPLEDVSTLHLLPAGSSPLVPAAIFSNPRYISWT
G8QXQ5          FFLLKHSESGLVDYVINSVPLERSIVQPLDSVPNLHLLSSGSTPLVPAAIFSNPNYIETL
A0A372MIZ7      YFHLKHREVGLVDYVTKNATLEACILKPIEKVPGLHLLPPGNAPLVHAGIFSNPRYTRLI
A0A356E0K2      YFRLKHREVGLVDFVTKKTKLEECLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGL
A0A3C1ZMS7      YFRLKHREVGLVDFVTKKTKLEECLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGL
A0A375AMC2      YFRLKHREIGLVDFVTKKTRLEDCLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGL
F0RTV6          YFRLKHREVGLVDFVTKKARLEDCLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGI
A0A3C1LV35      FFCLKRSKLGFVDAIVDDVPLEKCIVRPLAQVPNLHLMPPGKGTRNPNALYNSPKADAVL
A0A2N1RHF1      FFNLKKSPQGLVDVVTTEISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEML
A0A2N1RZJ4      FFNLKKSPQGLVDVVTTEISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEML
A0A3D1WX44      FFNLKKSPQGLVDVVTTEISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEML
A0A2N1SPK0      FFNLKKSPQGLVDVATTDISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEML
                :* *:.   *:**       :*  ::.*: . . ***:..*  .    .::...      

A0A1V5RSB2      KMLSNIYDYIIIDAPPLDAASELLAIAKHVDGLIITVRAGVTSRIALRDLLESLINANVQ
G8QXQ5          KHLKTLYDFIIIDAPPLDSASELLTISKNIDGLIITVRAGVTSKLSLIDLVDNLKTGNAP
A0A372MIZ7      SYLESVYDFVIIDAPPLDSASELLSISKHVDGLIITVRAGITSKGSLFDLISSLRTANVP
A0A356E0K2      QYLEKLYDFIIIDAPPLDSASELLSISKHVDGLIITVRAGISSKGSLYDLVSNLRTANAP
A0A3C1ZMS7      QYLEKLYDFIIIDAPPLDSASELLSISKHVDGLIITVRAGISSKGSLYDLVSNLRTANAP
A0A375AMC2      SYLENLYDFIIIDAPPLESASELLSISKHVDGLIITVRAGITSKGSLYDLVSNLRTANAP
F0RTV6          AYLENLYDFIIIDAPPLESASELLSISKHVDGLIITVRAGITSKGSLFDLVSNLKTANAP
A0A3C1LV35      AKLKAVYDYIIIDCPPISYGSEFTHLARHLDGFVINVRAGVSSKRALSSFMSELDFINAP
A0A2N1RHF1      DHLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGVSTKGGLRELLDNLDLAGIN
A0A2N1RZJ4      DHLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGVSTKGGLRELLDNLDLAGIN
A0A3D1WX44      DHLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGVSTKGGLRELLDNLDLAGIN
A0A2N1SPK0      DHLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGISTKGGLRELLDNLDLAGIN
                  *  :**:::** **:  .**:  ::.::**: :.****:::. .* .::..*   .  

A0A1V5RSB2      LAGFVFNGVMPSKHSRYGTYGYSVSYKMGKTERKFGRKYRYLP-------------RRRT
G8QXQ5          ILGIVFNGCSAGTTNS--------GYHYGNYYNSYAYRYNSYQNNNSKKGLKLSNYKIQN
A0A372MIZ7      ISGVVFNGVVPGSVGTGYRYGYGYGYGKGYGYSSYASRYSAMGSSGTLKKRRKHQVRKRS
A0A356E0K2      LIGFVFNGVIPGATSS---YGYGYGRNYGYGYS--AYRYGYAQGQGTAKKK-KANIRRRS
A0A3C1ZMS7      LIGFVFNGVIPGATSS---YGYGYGRNYGYGYS--AYRYGYAQGQGTAKKK-KANIRRRS
A0A375AMC2      LIGFVFNGVIPGTTSS---YGYGYGRGYGYS----AYRYGYAQGQSGSRKKSKSHSRRRS
F0RTV6          LIGFVFNGVLPGSSSS---YRYGYGKGYGYGYGHYAYRYGYAQGQGNARKNSKGHMRRRS
A0A3C1LV35      LLGYIYYGVIARNQSS----YSNYGY-----GSYYGNKKYGYGYGYG--YGNKKSMYEEG
A0A2N1RHF1      VLGVIFNGVIESKMGG----HYSSGRYYTYQGSSYAKRYYSSRYNTGDKEGKKASQSTKV
A0A2N1RZJ4      VLGVIFNGVIESKMGG----HYSSGRYYTYQGSSYAKRYYSSRYNTGDKEGKKASQSTKV
A0A3D1WX44      VLGVIFNGVIESKMGG----HYSSGRYYTYQGSSYAKRYYSSRYNTGDKEGKKASQSTKV
A0A2N1SPK0      VLGVIFNGVIESKMGG----HYSSGRYYTYQGSSYARRYYSSRYNTGDKEGKKASQSTKV
                : * :: *      .         .          . .                      

A0A1V5RSB2      ASWYRKRYKQDVKIRGKLPA--LFTPVRAFGPHAPYMNLKEMEEKNNGNGEEKLIFKPVA
G8QXQ5          SSGYRKKYRQNIRQRDNQKL-DLSDTVLAFGPQSYCHSLHEW-----------------G
A0A372MIZ7      NGWYRKMYKRDVKNRGKLSQ-EQFDAVLAFGPDSPYATIADW-----------------V
A0A356E0K2      TSWYRKRYKLDLKDRGKINS-EQFEPVLAFGEHAEYRTLEAW-----------------A
A0A3C1ZMS7      TSWYRKRYKLDLKDRGKINS-EQFEPVLAFGEHAEYRTLEAW-----------------A
A0A375AMC2      TSWYRKRYKQDLRNRGKISS-EQFDPILAFGEHAEYRTLEAW-----------------A
F0RTV6          TSWYRRRYKLDLKNRGKITT-EQFDPVLAFGEHAEFRTLEAW-----------------A
A0A3C1LV35      KGNYKIIYKKEIQHRSEVRH-GNREPVLAFAGGAENAFTGS------------------Q
A0A2N1RHF1      RSSYRQNFLKDLKRREKSRNLGTATPIHPFIDKRDPFLDDD------------------H
A0A2N1RZJ4      RSSYRQNFLKDLKRREKSRNLGTATPIHPFIDKRDPFLDDD------------------H
A0A3D1WX44      RSSYRQNFLKDLKRREKSRNLGTATPIHPFIDKRDPFLDDD------------------H
A0A2N1SPK0      RNSYRQNFLKDLKRREKSRNLGTATPIHPFIEKRDPFQDDD------------------H
                 . *.  :  ::. * :        .: .*                              

A0A1V5RSB2      SGDAGSRSKEVAEKRDETGAEKSVFTPAAFKDTPKHP-------------MTEDKVIDFL
G8QXQ5          DVQHFNPVTGIGPQHNA-------------------------------------DFKDGL
A0A372MIZ7      EAERENGKTKPNETRQT------EVPSAKQEDPRPSS-------------DPVEQDLASL
A0A356E0K2      GEHATTHSTVFPEARTS---GFTDSPAAKVEEKPVVQ------------PVQDAVKHDGL
A0A3C1ZMS7      GEHATTHSTVFP------------------------------------------------
A0A375AMC2      QEHATTHSTAFTEARTS---VFADLPPSKVESKPASP-------QQKPKADLPVVELDGL
F0RTV6          QAHASTHSSAFFEAKASPSVASQSAPVVQVEEKSATPAVPVAPKQSEKPAKKANVPFDSL
A0A3C1LV35      SAKAGNVSQVLKPEAKPAQKSSAKPSGTKMSAAEKKT-------------------SDML
A0A2N1RHF1      SSKP--ISNILR---------------KKVDDGNRAY-------------------ADLL
A0A2N1RZJ4      SSKP--ISNILR---------------KKVDDGNRAY-------------------ADLL
A0A3D1WX44      SSKP--ISNILR---------------KKVDDGNRAY-------------------ADLL
A0A2N1SPK0      SSKP--ISNILR---------------KKIEDGNRDY-------------------EDPL
                                                                            

A0A1V5RSB2      SAIEGDEAARGKK---
G8QXQ5          EAIENDLESIGKL---
A0A372MIZ7      RDIENDADAAGKKRED
A0A356E0K2      GVIERDPDAVGKK---
A0A3C1ZMS7      ----------------
A0A375AMC2      GAIEKDPDAVGKKQEE
F0RTV6          SVIEMDELAIGKKQED
A0A3C1LV35      ADIEKIYRK-------
A0A2N1RHF1      AAIEDDPRATGRIEE-
A0A2N1RZJ4      AAIEDDPRATGRIEE-
A0A3D1WX44      AAIEDDPRATGRIEE-
A0A2N1SPK0      AAIEDDPRATGRIEE-
                                

© 1998-2019