BYKdb

Dataset for cluster orphancd of phylum tenericutes

[Download (right click)] [Edit] [Sequences] [Repertoires]

28 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1W9S8F5      YEDAKIAEVSQLGNVRILETAGVPRIPIKPKKMMNYLIGVILGLGLGVGASFLAHSMDTK
A0A2N1QBP1      ------------------------------------------------------------
A0A3A6NBK6      ------------------------------------------------------------
A0A2N1PY17      ------------------------------------------------------------
A0A2K8ZVD1      ------------------------------------------------------------
A0A2K9ATM9      ------------------------------------------------------------
A0A1G3VWH5      ------------------------------------------------------------
A0A1G3WM69      ------------------------------------------------------------
A0A353PKB4      ------------------------------------------------------------
A0A1G3X178      ------------------------------------------------------------
A0A350RC25      ------------------------------------------------------------
A0A352TSP8      ------------------------------------------------------------
A0A449BLI1      ------------------------------------------------------------
A0A061A9I9      ------------------------------------------------------------
A0A2G7QFH1      ------------------------------------------------------------
A9NGZ9          ------------------------------------------------------------
A0A2N1PFF8      ------------------------------------------------------------
U4KT93          ------------------------------------------------------------
A0A2N1Q2N1      ------------------------------------------------------------
A0A1G3WJV7      ------------------------------------------------------------
A0A348NKG7      ------------------------------------------------------------
A0A1W9S8N6      ------------------------------------------------------------
A0A088TM87      ------------------------------------------------------------
A0A1G3X100      ------------------------------------------------------------
A0A357IN55      ------------------------------------------------------------
A0A2N1QAD1      ------------------------------------------------------------
A0A2K9A647      ------------------------------------------------------------
A0A2K9AQG7      ------------------------------------------------------------
                                                                            

A0A1W9S8F5      LRTLDDIESFLKSPIIGTIPLIDLPTGELDELRNMIDHATSERKERLERSFLQINGQLIS
A0A2N1QBP1      -----------------------MSKKK-----NIFAPERNERYDYL-----------VT
A0A3A6NBK6      -----------------------MAKKNK---INLFNGERNERYDYI-----------VT
A0A2N1PY17      -----------------------MGKKKL----NIFNGERNERYDYI-----------VT
A0A2K8ZVD1      -----------------------MAKKKNFSLERLINGERVSKYDYL-----------VT
A0A2K9ATM9      -----------------------MAKKKNFSLERLINGERVSKYDYL-----------VT
A0A1G3VWH5      -----------------------MSKKKI----NIFQIERNERYDYL-----------VT
A0A1G3WM69      -----------------------MSKKKI----NIFQIERNERYDYL-----------VT
A0A353PKB4      -----------------------MSKKKI----NIFQIERNERYDYL-----------VT
A0A1G3X178      -----------------------MSKKKI------FNSERNERYDYL-----------VT
A0A350RC25      -----------------------MSKKKI------FNSERNERYDYL-----------VT
A0A352TSP8      -----------------------MLKNKK------LSVQNKLEYDYI-----------YT
A0A449BLI1      -----------------------MRRKKL------FQKERVQQYDYL-----------VV
A0A061A9I9      -----------------------MRRRKL------FQKERTAQYDYI-----------VS
A0A2G7QFH1      -----------------------MRRRKL------FQKERIAEYDHL-----------VT
A9NGZ9          -----------------------MRRRKL------FQKERIAEYDHL-----------VT
A0A2N1PFF8      --------------------------------MKLFTKKTADNYGYL-----------IA
U4KT93          ------------------------------MVPNILKRKRKESYGYL-----------VA
A0A2N1Q2N1      ----------------------------------------MEVFEYKN----------VV
A0A1G3WJV7      ----------------------------------------MEFFEYKN----------VV
A0A348NKG7      ----------------------------------------MEFFEYKN----------VV
A0A1W9S8N6      ----------------------------------------MEFYEYRN----------AV
A0A088TM87      -------------------------------------------MSYKI----------IT
A0A1G3X100      ---------------------------------MMKRKIDQL-GSYVP----------IS
A0A357IN55      ---------------------------------MMKRKIDQL-GSYVP----------IS
A0A2N1QAD1      --------------------------------MNRLNKLNKRLDSYIP----------IS
A0A2K9A647      -------------------------------MRNKKHKFDQR-GSYQP----------IT
A0A2K9AQG7      -------------------------------MMNKKQKHDQR-GSYIP----------IT
                                                                            

A0A1W9S8F5      HYSPKSPVAESYRSLRTNIIANKATGPMSFL-VTSSSPKEGKSTTVSNTAITLAQMNSKV
A0A2N1QBP1      KEQPLSFTTESFQKVLVNLDYANIDKKIKVIEFTSTLASEGKSTFVSNLAYLMGQKNQKI
A0A3A6NBK6      KEQPLSYTAESFQKVIINLDYVNIDGKHKVIEFTSALASEGKSTFVSNIAFLLGQKNKKI
A0A2N1PY17      KEQPLSYTAESFQKVLINLDYANIDHEYKVIQFTSTLASEGKSTFVSNMAYLLGQKEKKV
A0A2K8ZVD1      KQDPLSFVTESFQKVIINIEYSNVDGDYKVIQFTSTLPSEGKSTFVSNLSYLMGQKGKKV
A0A2K9ATM9      KQDPLSFVTESFQKVIINIEYSNVDGDYKVIQFTSTLPSEGKSTFVSNLSYLIGQKGKKV
A0A1G3VWH5      KEQPLSYTSECFQKVLINIDYANLDNDMKVLQFTSTLASEGKSTFISNLAYLLGQKGKKV
A0A1G3WM69      KEQPLSYTSECFQKVLINIDYANLDNDMKVLQFTSTLASEGKSTFISNLAYLLGQKGKKV
A0A353PKB4      KEQPLSYTSECFQKVLINIDYANLDNDMKVLQFTSTLASEGKSTFISNLAYLLGQKGKKV
A0A1G3X178      KEQPLSYTAESFQKVIINLDYANIDGKIKVVQFTSTLASEGKSTFVSNLAFLLGQKDKKV
A0A350RC25      KEQPLSYTAESFQKVIINLDYANIDGKIKVVQFTSTLASEGKSTFVSNLAFLLGQKDKKV
A0A352TSP8      KENPISFITEAHQKFLVNLEFINVDKAYKSIQITSSLSSEGKSTFLSNVAYLLGQKGLKV
A0A449BLI1      HEQPMSYHAEAFQKALVNLEYVNVDGNLKVLQFTSSLAGAGKTTTISNIAYLMAKKGKKV
A0A061A9I9      HEQPLSFVAEAFQKALVNLEYVNIDGNLKVIQFTSSLAGAGKTTFVSNLAYLIAKKGKKV
A0A2G7QFH1      YESPMSYTAEAFQKALVNLEYINVDGNFKVVQFTSTLAGAGKTTFISNVAHLIGKKGKKV
A9NGZ9          YESPMSYTAEAFQKALVNLEYINVDGNFKVVQFTSTLAGAGKTTFISNVAHLIGKKGKKV
A0A2N1PFF8      KEAPNSYVTESLQKLIVNLEYANIDQKYKVVQFTSSMQAEGKTTLISNVAYLLAQRGKKV
U4KT93          REDKMSFVTESFQKLVLNLEYANVDNQYKVIQFTSTLQAEGKTTLFANIAYLLADKGKKV
A0A2N1Q2N1      IETPNSPQAEAYRKLELNIRMNSIDNPYKVIQITSATPEDGKTTTAINLAAVYAEKGLKV
A0A1G3WJV7      IESPNSSEAEAYRKLELNISLAGLDRRMQVIQCTSATPEDGKTTTSINLAAVYAEKGKKV
A0A348NKG7      IESPNSSEAEAYRKLELNISLAGLDRRMQVIQCTSATPEDGKTTTSINLAAVYAEKGKKV
A0A1W9S8N6      IEFPNSPEAESYRKLELNIRVFNLDNPIKVIQSTSATAQDGKTTTAINLAAVYAEKGKKV
A0A088TM87      KEEPHSVVTEQYKKVRTAIDFSSIDKKVKVINLTSTFPSEGKTVTSINLAMVYAQTGKKV
A0A1G3X100      DKEPHSIITEQYRKLRTNIELSNFNQEIKSIALTSTMAMEGKTVTSINLATVYAQSGMKT
A0A357IN55      DKEPHSIITEQYRKLRTNIELSNFNQEIKSIALTSTMAMEGKTVTSINLATVYAQSGMKT
A0A2N1QAD1      SKEPNSVISEQYRKLRTNIELSNFDKEVKVISLTSTKMMEGKTVTSINLATVYAQSEKKT
A0A2K9A647      RIEPNSIISEQYRKLRTNIELSDFNKKIQIVGITSTNAMEGKTLTAINLAEVYAQSGKKT
A0A2K9AQG7      RLEPQSIISEQYRKLRTNIELSEFNKKIQIVGITSTNAMEGKTLTAINLAEVYAQSGKKT
                     *  :*  ..    :         . :  **:    **:    * :   ..   * 

A0A1W9S8F5      VIIDIDMRRPTIHTKFGIKKENGASDYLIDDTITVDDIVKPSGISNLDIITSGFIPPNPS
A0A2N1QBP1      ILLDLDLRKPKGHRVFNSANKDGLTDYLSGK-VSYEKLIKHSEEFGIDYIVTGEKTTAVI
A0A3A6NBK6      ILLDLDLRKPKMHRVFNAPNKNGLTDYLSGK-IEFSQLIKHSDEIGIDYIVTGEKTTAVV
A0A2N1PY17      VLIDLDLRKPKMHRVFNVANKDGLTDFLAGK-VTYQQLIKKSDDFGVDFINTGEKTTAVV
A0A2K8ZVD1      ILLDLDLRKPKMNRVFGVPNKDGLTDYLAGK-ISLEKAINHSDEIGIDFITAGEKTSAVV
A0A2K9ATM9      ILLDLDLRKPKMNRVFNVPNKNGLTDYLAGK-IPLDKAINHSDEIGIDFITAGEKTSAVV
A0A1G3VWH5      ILIDLDLRKPKMNRVFNVTNREGLTDYLSGK-VQYETVVRHSEEIGVDFIVGGEKTTSVV
A0A1G3WM69      ILIDLDLRKPKMNRVFNVTNREGLTDYLSGK-VQYETVVRHSEEIGVDFIVGGEKTTSVV
A0A353PKB4      ILIDLDLRKPKMNRVFNVTNREGLTDYLSGK-VQYETVVRHSEEIGVDFIVGGEKTTSVV
A0A1G3X178      ILIDLDLRKPKMQRVFNVPNKNGLTDYLSGK-ISYEELIQHSADFDFDFIVAGEKTTAVV
A0A350RC25      ILIDLDLRKPKMQRVFNVPNKNGLTDYLSGK-ISYEELIQHSADFDFDFIVAGEKTTAVV
A0A352TSP8      ILVDLDLRKPKVHRIINKANEDGITDVLTEK-ISLEKAIKKDTKLGFDALVSGEKASAVV
A0A449BLI1      VVLDLDLRKPKINRIFKAANENGITDYLAGK-VKYEKLVRYDEKFKIHYIVSGEKTTAVV
A0A061A9I9      VIVDLDLRKPKINRVFKAANENGLTDYLAGR-INYDKLIGYSEKLGINYIVAGERTTAVV
A0A2G7QFH1      VIVDLDLRKPKINRIFRSPNENGVTDYLTGK-IDYKTLINYSEKFSVHYIVAGERTTAVV
A9NGZ9          VIVDLDLRKPKINRIFRSPNENGVTDYLTGK-IDYKTLINYSEKFSVHYIVAGERTTAVV
A0A2N1PFF8      LMVDLDLRRPKINRIFSVINKSGLTEYLLGK-IEKKDLIQHSED-KVDFIISGEKTTSVV
U4KT93          VVLDLDLRRPKLNRVFSEINKDGITDYLAGK-ITYEQLLRVSED-GIYYMVAGEKTTAVI
A0A2N1Q2N1      IILDFDLRRPKIHRAFHKINDLGFYDFIVNE-KPIEELIIKDDS-KIDLLLTGNMLTAPH
A0A1G3WJV7      IILDFDLRRPKIHRAFHQPNDRGFYDYVVDN-VDYHDLIIHDES-KIDIILSGKRISFPH
A0A348NKG7      IILDFDLRRPKIHRAFHQPNDRGFYDYVVDN-VDYHDLIIHDES-KIDIILSGKRISFPH
A0A1W9S8N6      IILDFDLRRPKIHRAFHKANDGGLYEFVVND-KDVHDLIIHDAS-GIDLLLTGHRLNYPH
A0A088TM87      LLVDMDLRIPKIHRFFNLPNKDGISGYVDSR--DIKKCIQKGTD-NLDILVTGKKTPFPS
A0A1G3X100      LLIDMDLRKPKIHRGFKMINQIGLSDMITHK-LDIDQAVQIVNP-HLDILTSGTKLPYPA
A0A357IN55      LLIDMDLRKPKIHRGFKMINQIGLSDMITHK-LDIDQAVQIVNP-HLDILTSGTKLPYPA
A0A2N1QAD1      LLIDMDLRKPKIHRGFHLSHKNGLSNIITDN-LELSEAIHKVTP-KLDVITAGNKLPFPA
A0A2K9A647      LLIDMDLRKPKIHRGFRLINKKGLSDIFTKN-YDITDVVEHVEA-NLDVLPSGSKLPYPA
A0A2K9AQG7      LLIDMDLRKPKIHRGFKLINKKGLSDIFTKK-YDITEVVEHIDA-NLDVLPSGSKLPYPA
                :::*:*:* *. :  :   :  *    .          :       .  :  *       

A0A1W9S8F5      ELLSSDRMDNFIAELKSKYDYVIFDTPPVIAVTDAIIMAKKVDKLFLVLRVAHTEKAVLG
A0A2N1QBP1      NVLEAEKLKDLILKLRETYDYVLLDAPPVLAVSDALYIAKHADGVIFVVAQNNAKKTLVR
A0A3A6NBK6      NVLEALKMKELIQKLRETYDYVLLDAPPVIAVSDALYIAKNADGVIFIVAQGVAKKSLVK
A0A2N1PY17      NILESNKLKELIDKLKEDYDFILLDAPPVLAVSDALYISKFSDAVIFVVAQGVAKKALVK
A0A2K8ZVD1      NVLEAKKLKDLIAHLRETYDYVLLDTPPVISVSDALYIASLADGIIFVVAQNKAKKALVK
A0A2K9ATM9      NVLEAKKLKDLIAQLRETYDYVLLDTPPVISVSDALYIANLADGIIYIVAQNKAKKALVK
A0A1G3VWH5      NVLEAKKLKELIVRLKSEYDYVLLDTPPVIAVSDALYVAKLADGVIFIVAQNVAKKSLVK
A0A1G3WM69      NVLEAKKLKELIVRLKSEYDYVLLDTPPVIAVSDALYVAKLADGVIFIVAQNVAKKSLVK
A0A353PKB4      NVLEAKKLKELIVRLKSEYDYVLLDTPPVIAVSDALYVAKLADGVIFIVAQNVAKKSLVK
A0A1G3X178      NVLESAKMKELIVKLREQYDYVLLDTPPVIAVSDALYVARNADGVVFIVAQGVAKKTLVK
A0A350RC25      NVLESAKMKELIVKLREQYDYVLLDTPPVIAVSDALYVARNADGVVFIVAQGVAKKTLVK
A0A352TSP8      NLLQSNKMKTLFSDLKKLYDYILVDSPPVINVSDALYIAQITDATVFAISQQETKRSVAK
A0A449BLI1      NVLEAQKLKDLIARLRAEFDYVILDSPPVLAVSDSLYIARLADGVIFVVAQNEAKRAVIN
A0A061A9I9      NVLEAQKLKDLIARLKTEFDYVLLDSPPVIAVSDALYISRLADGVLFVVAQNEAKRAVIN
A0A2G7QFH1      NVLEAQKLKDLIARLRTEFDYVLLDSPPTMAVSDALYISRLADGVLFIVAQNETKRTVIN
A9NGZ9          NVLEAQKLKDLIARLRTEFDYVLLDSPPTMAVSDALYISRLADGVLFIVAQNETKRTVIN
A0A2N1PFF8      QVLQSQKLQDLFTELRQEYDYILLDTPPVIVVSDALLVNKVADGIIFVVAHGLGRKSMVK
U4KT93          NLLESKKLEELINKLKEDFDYVLLDTPPVLAVADTLIINKISDGVIFVVGFGKAKKALVR
A0A2N1Q2N1      VILQSKKVKDLIEKFRKEYDYIVIDSPPVLTVTDALVISSLADGVVYIASYKKTKKDQAK
A0A1G3WJV7      IALESHRTAQLIEDLRKEYDFIVIDTPPVLSVTDAVIISKIVDGVVYVAAYNKTRKDDSR
A0A348NKG7      IALESHRTAQLIEDLRKEYDFIVIDTPPVLSVTDAVIISKIVDGVVYVAAYNKTRKDDSR
A0A1W9S8N6      IVLQSKKIMEMVNKLRDEYDYIVVDTPPVLSVTDALVVSKYVDGVIYVAAYNQTKKDAAK
A0A088TM87      ELLASKVVNEMMEKLRDMYDVIIIDCPPMTAVTDASIISNFSDGTVYVLASRRTNRDMAN
A0A1G3X100      EFLMSDALKSLMKDLKTKYDRIIIDTPPMTAVTDASIISSLVDGMIIVIASREAKTDVAS
A0A357IN55      EFLMSDALKSLMKDLKTKYDRIIIDTPPMTAVTDASIISSLVDGMIIVIASREAKTDVAS
A0A2N1QAD1      EFLMSAQLKELILKLRDLYDIIIIDTPPMTAVADAAIISSFVDGTILVIASRETNIDACE
A0A2K9A647      EFLSSEQLKSFVNNLKDVYERIIIDTPPMTAVTDASIISSFCDGMLLVIASRETEVHITK
A0A2K9AQG7      EFLSSEQLKLFIDNLKGIYERIIIDTPPMTAVADASIISSFCDGILLVIASRDTEVHITK
                  * :     :.  :.  :: ::.* **   *:*:  :    *  .              

A0A1W9S8F5      RAQEILANVNKKVDGFVVNGIKVQKYYNRHKYYYYYYYYYYGEQNPTPKKKSLFSRLRKN
A0A2N1QBP1      EAIQTLKESNVHIIGTVLTQVSLKSGE----YGYGYDYS-YKYEDE--------------
A0A3A6NBK6      EAIQTLKTNHVPIIGTVLTQVSLKNNS----YGYGYDYS-YKYEE---------------
A0A2N1PY17      EAIQTLKHNHVNIIGTVLTQVNIKSQ--------GYDYT-YGYGE---------------
A0A2K8ZVD1      EAISNLKDHGTPILGMVLTQFDMKSG-----YGYNKDYSYYNYSEEDDE-----------
A0A2K9ATM9      EAISSLKDHGTPILGMVLTQFDMKSG-----YGYNKDYSYYNYSEEDDE-----------
A0A1G3VWH5      EAIQTLKHNNVHIIGTILTQVDLKNGS----YGYGYDYS-YKYE----------------
A0A1G3WM69      EAIQTLKHNNVHIIGTILTQVDLKNGS----YGYGYDYS-YKYE----------------
A0A353PKB4      EAIQTLKHNNVHIIGTILTQVDLKNGS----YGYGYDYS-YKYE----------------
A0A1G3X178      EAIQNLKNNNVHVIGTVLTQVSLKGGE----YGYGYDYS-YKYED---------------
A0A350RC25      EAIQNLKNNNVHVIGTVLTQVSLKGGE----YGYGYDYS-YKYED---------------
A0A352TSP8      EAINLLKQSNVNLIGAVATQVDIRKNAYGYGYGYGYGYG-YGYDYTYEQNGND-------
A0A449BLI1      EAIATLKQNNVNIIGSMFTLVDVKESEL---YAYTYGYG-YGYTSS--EQIEDTKEWLIF
A0A061A9I9      EALKTLRQSNVNVIGSVFTQVDLKENDI---YSYTYGYG-YGYTSSDKEAFEEKE-----
A0A2G7QFH1      EAIQTLKQNKVNIIGIAFTQVDVKNSDL---LSYTYGYG-YGYNSSLQDDLDKEKS----
A9NGZ9          EAIQTLKQNKVNIIGIAFTQVDVKNSDL---LSYTYGYG-YGYNSSLQDDLDKEKS----
A0A2N1PFF8      EAISSLTRNNVPIIGIAMTQDRVNKG-----NRYGYTYK-Y-YD----------------
U4KT93          DAFHALERNNAKIIGIGFTQVKMTNG------VYGYKYS-YKYD----------------
A0A2N1Q2N1      HGLKQLKENGANVIGAVLSNVDAKKSN--GYYNYYY----YQREE---------------
A0A1G3WJV7      EGLKILHANNANVIGGVLANIDVRKTKQYGYRGYYY----YGTDEKKSK-----------
A0A348NKG7      EGLKILHANNANVIGGVLANIDVRKTKQYGYRGYYY----YGTDEKKSK-----------
A0A1W9S8N6      QGLEQLRESKANIIGGVLANIDVRKAQ--GLYGYYY----YSNYDTEE------------
A0A088TM87      KAINDLKKNGANILGGVLTRVSKRDSN---YGADYY----YYYGE---------------
A0A1G3X100      RVIQDLKDNGANIIGSVMTRVQKREHK---YMNYYY----YNYKA---------------
A0A357IN55      RVIQDLKDNGANIIGSVMTRVQKREHK---YMNYYY----YNYKA---------------
A0A2N1QAD1      RVIKELKDNGANIIGSVLTRIRKKDTN---YSNYYY----YQYNEK--------------
A0A2K9A647      DVIKDLENNGANIIGSVLTRVSKRDSR---YMNYYY----YQYR----------------
A0A2K9AQG7      DIIKSLENNGANIIGSVLTRVSKKDSR---YMNYYY----YQYR----------------
                     *      : *                         *                   

A0A1W9S8F5      ------------------
A0A2N1QBP1      ------------------
A0A3A6NBK6      ------------------
A0A2N1PY17      ------------------
A0A2K8ZVD1      ------------------
A0A2K9ATM9      ------------------
A0A1G3VWH5      ------------------
A0A1G3WM69      ------------------
A0A353PKB4      ------------------
A0A1G3X178      ------------------
A0A350RC25      ------------------
A0A352TSP8      ------------------
A0A449BLI1      IHISCQTSMMGQKVMKKL
A0A061A9I9      ------------------
A0A2G7QFH1      ------------------
A9NGZ9          ------------------
A0A2N1PFF8      ------------------
U4KT93          ------------------
A0A2N1Q2N1      ------------------
A0A1G3WJV7      ------------------
A0A348NKG7      ------------------
A0A1W9S8N6      ------------------
A0A088TM87      ------------------
A0A1G3X100      ------------------
A0A357IN55      ------------------
A0A2N1QAD1      ------------------
A0A2K9A647      ------------------
A0A2K9AQG7      ------------------
                                  

© 1998-2019