BYKdb

Dataset for cluster orphancd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

162 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A3R5R793      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      MDIDPFADDDKEYRSTGAEEPVVS------------------------------------
A0A2E0R252      MNEVDPPQNGYGNEAPASN-----------------------------------------
A0A3E1EF48      -----------------MA-----------------------------------------
A0A2A2PVG8      ---MSRSYAPDSDANETGQ-----------------------------------------
A0A2E0R421      -MIDHHQQPLEENLHSNPQ-----------------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A410ELH5      ------------------------------------------------------------
A0A2E5EJ69      MDFPESHDLGQQTQVEK-------------------------------------------
A0A1T4WWY4      MNSKTQPSGKDSKLD---------------------------------------------
A0A3D3LEQ6      MNPRQSSNSQKGKLD---------------------------------------------
A0A3D3NW23      MNPRQSSKSQKGKLD---------------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      MSKPVQAQTRSTAHRSAARVPDQAQAGGNLA-----------------------------
A0A290QD69      MSKSTKS---SSGKRGSSEQPQTKPAGGG-------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      MAETFSKKPVPAAGAWPPQSSSPFGEPPPFAGGSLP------------------------
A0A357FSP9      ------------------------------------------------------------
A0A2A2R174      MDQYSQTQVGDTSSDHG-------------------------------------------
A0A1H1SWX2      MSAPDAPLPTAPARAPGPSLHGNDQQVVE-------------------------------
A0A290QE54      --MSDSPLNPSNASQSG-------DQLVE-------------------------------
A0A1H2DTI1      MEPIPPSAPGTPGGFPPPQAPSSPMTAAMSQAGGRVPGTF--------------------
A0A1V5L462      MQDDFLESSGREGGHTDLGETL--------------------------------------
A0A2A2R3V9      MSSITPPPTLSSWSAAF-------------------------------------------
A0A3D3LGD3      ------------------------------------------------------------
A0A350ARX4      MILSVWRSESLPSDPNNFSSSYDLDESSGSLDWGERL-----------------------
B5JIS2          MAHSETKKSLRPHASAGYGASGSRNSNTEDTLAGV-------------------------
A0A1H2GQN6      ------------------------------------------------------------
A0A2A2RPW6      MQTTEDVTQQSPIGGLS-------------------------------------------
B4D1I7          MDAHPAATPARDQDAASWWYLI--------------------------------------
A0A353F286      ------------------------------------------------------------
A0A354FSA6      ------------------------------------------------------------
A0A3B9GA54      ------------------------------------------------------------
A0A2D7B7R6      ------------------------------------------------------------
B1ZT68          MPTSKKPAADRRNP--QANTGF--------------------------------------
W0J7C2          MTTTDTTAGNRPSPGRPRAASI--------------------------------------
A0A2E5K4P7      --------MDSEPPEDSSNSSYRGYRYY--------------------------------
A0A0R2XPB1      MDDLFQDENNTKTVDYTELF----------------------------------------
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      MDDLFQDEQNTKTVDYTELF----------------------------------------
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6ME53      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A2V6NZZ3      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A2V6EBU2      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A2V6EY06      ----MNAPLERPAAAPWSTAF---------------------------------------
A0A2V6NIJ1      ----MNPPPVRPAAAPWSTAF---------------------------------------
A0A2V6C292      ----MNPPPERPAAAPWSTAF---------------------------------------
A0A2V6D2X0      ----MNPPPERPAAAPWSTAF---------------------------------------
A0A2V5ZUK1      --MQVAATRLQNLSTSWSAAF---------------------------------------
A0A2V5XFN9      ---MPASTAAKSLSTSWSATF---------------------------------------
A0A2V6EZC8      ---MPASTAAKSLSTSWSATF---------------------------------------
A0A2V6I7Z5      ---MPASTAAKSLSTSWSATF---------------------------------------
A0A3B9LCP2      ---MQASAAERSTPASWSTAF---------------------------------------
A0A3C0R669      ---MQASAAERSTPASWSTAF---------------------------------------
A0A2V6EID2      -MQAPIPAVERSTPAAWSNTL---------------------------------------
A0A2V6MHB0      -MQAPIPAVERSTPAAWSNTL---------------------------------------
A0A2W5YWL9      ----MNALAERTNPGSWSTAF---------------------------------------
A0A2V5NH62      MPAPAPATTDRPVSAPWSTAF---------------------------------------
A0A2W6A620      --MPAPAATDRPASAPWSTAF---------------------------------------
A0A2V5PIJ4      ---MGNAAPDHPVSPIWTTKF---------------------------------------
A0A2V6K2G8      ---MQPSTAVKNLSTSWSAAF---------------------------------------
A0A2V5W206      ---MQATTAGKNLSTSWSTVF---------------------------------------
A0A2V6MW77      ---MQVATVGKNLSTSWSAAF---------------------------------------
A0A3C1VFY9      ---------MKEDSALTAPDRHAWGRKF--------------------------------
A0A2G4GZN8      MPTPDPSSDNRPPEPSREGNPGYGSYGQGYGQGYGQGYGQGYGAYGAGNY-------RGG
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      ------MKNDYS-DNNMGNDNSYGNYGNYAPGN---QY-NQYNSYRYGGGGNYGNYGNYG
A0A2D7F4D9      ------MKNDYTGDQSNMNSNHYGGYSNNYGNP---QY-YNHGSYRYGGN------SGSG
A0A3R7RBR8      ------MKNDYTGDQSNMNSNHYGGYSNNYGNP---QY-YNHGSYRYGGN------SGSG
A0A2E0NH28      ------MKNDYVRGGPDPNTS-----------G---RYGYSSGNYGYNGS----------
A0A350AS32      ------MKNDYVRGAPDPNSGGYG--------G---GYGYG-GGYGYG-G----------
A0A368BGT4      ------MKNDYVRGAPDPNSGGYGSGGYGYGSG---GYGYGNGGYGYGNG----------
A0A1G3ZL71      MPSPLAIPAAPAKPSASTRAPQGGEEHLVE------------------------------
A0A2T6DX88      MNDLQAKHP--SLHTAQ-------GEVLNE------------------------------
A0A3E1E5C8      MPDHTARPF--PPAHDK-------EEPAVE------------------------------
B1ZZ74          MSLAEAKPAVQPGGARD-------EETLVE------------------------------
A0A2E0V4K6      MSARRLAGAGRELPDEDEVLEFPGR-----------------------------------
A0A2E6NAH3      ------------MKNDYIRGAPDPNSGGYGGSG------------YGYGGGNYGYGGSNY
A0A2A5VZA5      ------------MKNDYIKGGGDPNSGGY-GYG------------YGYSGGS--------
A0A424R295      ------------MKNDYIKGGGDPNSGGY-GYG------------YGYSGGS--------
B4CZV9          -----MIPGTKKPAFT--------------------------------------------
A0A3B9FM17      ------------------------------------------------------------
R7E4L8          -----MPVSVIQPEDND-------------------------------------------
A0A0E3YV65      ------------------------------------------------------------
W0J900          -----MAEIPFTKTGPDTGPLHPRPSAPRSEPP------------FEGGSLP--------
A0A2T6DSN5      -----MAKASKTTPSKRNEAQSPTKGFN--------------------------------
A0A2V2SMX4      -----MNQPGAIETVSTTQHQHAWRARF--------------------------------
A0A317ZIW7      --------MSDLFNDDNQAGKVDYAEIL--------------------------------
A0A2D7WMI4      ----------MDENEIGSLSQNPPNQKV--------------------------------
A0A2D6VHX5      ----------MDLEENSNYGDYSPKSKK--------------------------------
A0A2D8I214      --------MEEEIENLNSQGSVRSKSKT--------------------------------
A0A1Z8VL41      --------MDDNFEDIDRPLSTKPKGRI--------------------------------
A0A2E6TNA4      --------MDDNLEDIDRSLSTKPKGRV--------------------------------
A0A1Z8RG47      --------MDDEIDTTEIHSGGRSKSNI--------------------------------
A0A1Z8RJJ5      --------MDDEIDTTEIHSGGRSKSNI--------------------------------
A0A2D7V631      --------MDDDIDSISVNAGGKPKSRI--------------------------------
A0A354RA24      --------MDDDIDSISVNAGGKPKSRI--------------------------------
A0A2E9RV62      -------MDSYSNPDPSQEIIQPASRSR--------------------------------
A0A2E4AY96      --------MDQEHPESFKN---QGDTIK--------------------------------
A0A3B9B9P4      --------MDQEHPESFKN---QGDTIK--------------------------------
A0A2D5Y6N6      --------MDDNFNKMTGDGGASPTGSK--------------------------------
A0A2E7HSS8      --------MEEDFDNFSTP-PQPKGKPK--------------------------------
A0A2D8VCK3      --------MEEDFDNFSSS-PVQKGKSK--------------------------------
A0A350QVY4      --------MEEDFDNFSSP-PVQKGKSK--------------------------------
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      -----MNESLEELDGTSSHVPSGAPGPK--------------------------------
A0A3D4HHL8      -----MTAPPTKSPRYDDVEPKIEWSELI-------------------------------
A0A366HV03      ------------------------------------------------------------
A0A2V2SDN0      -----MENQNHNEPAKANNQLTTPALDLMAPPD------------HF-------------
A0A1V6GL40      ---------MNDQP------VQSFHDRPNTAAR------------LH-------------
A0A2V5X6Z6      -------MNNNNHPNAAAVDLFAPADRFVSASR------------LY-------------
A0A2V5VGZ7      -----MNDNNHNQPNTPAVDLFAPANRFVSASR------------LY-------------
A0A2V5U130      -------MNNNNHPNAAAVDLFAPADRFVSASR------------LY-------------
A0A2V6C237      -------MNNNNHPNAAAVDLFAPADRFVSASR------------LY-------------
A0A3R8L982      ----------MPDTTNNRPPPSAKLHSGDDDLV------------E--------------
A0A2E7HPU9      -----MRRKKYYEHDEELDLLDEEDGLG-------------------------------G
A0A388PR45      ------MDTPSPKPGQPPEDPSRG-PRGYGSYG------------SY----GGY-----A
A0A388QR61      ------MDAPAPKPGQPQDDAQRG-PRGYGSYG------------NY----GNYGGPA-G
A0A2A2RS01      -----MAEKTQKPEDDQDDSAARG--RGYGSYG------------NYGNYGGNYGGNYGG
A0A2A2Y1A7      -----MAEKTQKPEDDQDDSAARG--RGYGSYG------------NYGNYGGNYGGNYGG
A0A388PDH9      -----MAETPQKPEDNQDDSASRA--RGYGSYG------------NY----GNYGGAYGG
A0A2G4H1E7      ------MANPEPSSDNRPPEPARGGNRGYGSYG------------SY----GQYGQGY-G
A0A2G4GZA6      ------MPNPDPLSDNRPPEPARGGNRGYGSYG------------SY----GNYGAAN-G
A0A388P514      ------MATPEPSSDNRPPEPARGGNRGYGSYG------------SY----GNYGAGN-G
A0A2A2YG59      ------MATPEPSSDNRPPEPARGGNRGYGSYG------------SY----GNYGAGN-G
A0A2G4F7D5      ------MATPEPSSDNRPPEPARGGNRGYGSYG------------SY----GNYGAGN-G
D5EML0          --------------------------------M------------GK----DDFTIEANA
A0A3C1C1M3      -----MTQPNFPPSNLPPASGQPPGAPIYYGGG------------DP----YSGGMPMDS
A0A2E9EYJ1      ---------------------------------------------------------MAK
A0A258AXR6      --------------------------------------------------------MNES
A0A1T4WVZ9      --------------------------------------------------------MRET
A0A3D3NZQ6      --------------------------------------------------------MSEA
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A3R5R793      ------------------------------------------------------------
A0A2N8IV96      --------------------------------------------------------MVAT
R7E1V8          --------------------------------------------------------MVAS
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      --------------------------------------------------------MR--
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ----------------------NRIGISNVRQALSRWWIMLIFGVLGYFAALYYM-SINP
A0A2E0R252      ----------------------GKGIKDYVRWFLRRFWIFLITCLGGYFLGLYVA-SLTP
A0A3E1EF48      ----------------------TKTFADYLNWLKRYAWIAVLTTITGTFYGFYLF-TITP
A0A2A2PVG8      ----------------------SRGLQDYLRWFLRRFWIFLIAVVGGYFLGLYLY-SVTP
A0A2E0R421      ----------------------ARGLQDYVRWFIHRFWILPITIVSGILIGHYVY-THTP
A0A2N8IR72      ----------------------------------------------------------MT
A0A410ELH5      ----------------------MLSHYNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMT
A0A2E5EJ69      ----------------------EFSLRDSVDVVLDHAWLIILIFAACFGGAYYYL-KTAT
A0A1T4WWY4      ----------------------GSSIIRTVLAYEDYWRLMIILVLIGLLGGTCYF-IYAR
A0A3D3LEQ6      ----------------------SSKLIRLLLQFEDYWRLMALLFALGLLSGAGYF-VYAR
A0A3D3NW23      ----------------------SSKLIRLLLQFEDYWRLMALLFALGLLSGAGYF-VYAR
A0A2G4I5Z5      ------------------------------------------------------------
A0A2E7ALI1      ----------------------------------------PPASYLPDWITGFLN-----
A0A178IDB9      ----------------------HFSPRNLLNMFLERWWIGLIAGAAIATVFILAQ-PKLA
A0A290QD69      -----------------------FSPKSLLNMFLERWWIGLIVAAAVAAAFVLSQ-PKPE
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      ----------------------RLDIRQILLCIRERWIVAVSLAILVCVLLGVWL-LNQP
A0A357FSP9      ------------------------------------------------------------
A0A2A2R174      ----------------------MSLNRELWQVLVEKAWLIACIMAAAAAIGVWVG-VRSP
A0A1H1SWX2      ----------------------KRSLRDYYVILRERLWIALPVALLVALSIGYYQ-AQEI
A0A290QE54      ----------------------RRTIRDYLIILRERLWIALPLALLVAVGFGYWK-ARAV
A0A1H2DTI1      ----------------------MSRLHRYKLLVKKFWWILLFCTAVGIAIQAYKI-AHEV
A0A1V5L462      ----------------------RSLSHRARLLLQSYWWILLLCLSIGLLVQAVRV-KSMR
A0A2A2R3V9      ----------------------FTKLHRYRALVKRRWYVPLLTLSVGLCIQAYRF-AQIQ
A0A3D3LGD3      --------------------MKIERLQDKVQVF-----------------------ERSS
A0A350ARX4      ----------------------QRIYFESKRLLAIWWWIVLLAVAIGIGWQAYRE-LNRE
B5JIS2          ----------------------VTQIRSFFAIIRSRWLSGVVSALVVGSAFAYLF-LNDK
A0A1H2GQN6      --------------MSVSESIDLPHFNDYWRVIRARFGIILTLFILTFGTGYFVSAFVLQ
A0A2A2RPW6      ----------------------SVALRDFWQALLDKAWLVVCIMLAAAALGVWHG-ARSP
B4D1I7          ----------------------HTKIYRYRALLRKYWWMVLFTTCAGMAIGAWML-AHQQ
A0A353F286      ---------------------------------------------------------MIP
A0A354FSA6      ------------MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIP
A0A3B9GA54      ------------MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVIT-SVIP
A0A2D7B7R6      -----------------METGNTNSPQDILRSAKSHYAIVLIIIVACTFTAYMQT-RKMT
B1ZT68          ----------------------RITPRDLLQMFQERWLLGLFLGAIAAGVFVYFQ-PEKV
W0J7C2          ----------------------RRTPRDFLDMFAERWWIGALAGAAAAALIVVFR-PHFE
A0A2E5K4P7      ------GGYGYNYGGYDAEPQEHRSLKDYIIIFRERFWLFLFCFAIIITGVLLYT-LKKP
A0A0R2XPB1      ----------------------QQIVYRAKIVLRRYWWVIPLAITLGVSYKAVES-FVAD
A0A348NQP1      ------------------------------------------------------------
A0A357FV58      ----------------------QQIVYRAKIVLRRYWWIIPLAIALGVTYKAVES-FVAD
A0A2V6F9Q9      ------------------------------------------------------------
A0A2V6ME53      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6NZZ3      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6EBU2      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6EY06      ----------------------FTRIYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6NIJ1      ----------------------FTRLYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6C292      ----------------------FTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V6D2X0      ----------------------FTRMYRYKSLLLRRWWILLLTICCGLFVEAWLI-FQTP
A0A2V5ZUK1      ----------------------ITRLHRYKSLLLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V5XFN9      ----------------------ITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V6EZC8      ----------------------ITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V6I7Z5      ----------------------ITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A3B9LCP2      ----------------------ITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLI-YQTP
A0A3C0R669      ----------------------ITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLI-YQTP
A0A2V6EID2      ----------------------ITRLHRYKALLLRRWWIPVLTICLGLFVEAFLI-YQMP
A0A2V6MHB0      ----------------------ITRLHRYKALLLRRWWIPVLTICLGLFVEAFLI-YQMP
A0A2W5YWL9      ----------------------ITRIHRYKSLLKRRWWIPLLTICLGLFVQSWLI-FQTP
A0A2V5NH62      ----------------------ITRLHRYKALLQRRWWIPVLTICLGLFVQAWFI-YQTP
A0A2W6A620      ----------------------ITRLHRYKSLLQRRWWIPVLTICLGLFVQSWLS-YQTP
A0A2V5PIJ4      ----------------------VTRFHRYRALLLRRWWILLLTVCMGLFVQAWMV-YQRA
A0A2V6K2G8      ----------------------VTRLHRYKSLFLRRWWIPVLTICLGLFVEAFLI-YQTP
A0A2V5W206      ----------------------ITRLHRYKSLFLRRWWIPVLTTCLGLFVEAFLI-YQMP
A0A2V6MW77      ----------------------ITRLHRYKALFLRRWWIPVLTTCLGLFVEAFLI-YQMP
A0A3C1VFY9      ----------------------FSRVQRYRNLLLRRWWVLVVCLVLALGIEAVHI-QFTP
A0A2G4GZN8      NYGGGNYGYGNNPGYGKGGAGESNPIQNYLLMLKERYWWILLASLVFLTLSLLNT-YNVV
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      NYGY--GSYGQNADEQG----PQRTFKDYLFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A2D7F4D9      SYGY--GSYGNVSEEQG----PQRTFKDYIFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A3R7RBR8      SYGY--GSYGNVSEEQG----PQRTFKDYIFLIRERIWYLIIVFFIIFLGSILYT-FNKT
A0A2E0NH28      NYGY--GSYGSNSSGYG--TIAQRSISDYFLMLRERVWYLVVAFFIIFSGSILYT-FNKT
A0A350AS32      GYGYG-GGYGAGGGYEGGSSAPQRSFKDYLLMFRERVWYLIVAFFIIFSGSILYT-FNKT
A0A368BGT4      GYGYGTGGYGGYGGGYGGGAGPQRSFKDYFLIFRERIWYLLVSFFIIFSGTIMYT-FNKT
A0A1G3ZL71      ----------------------RRTLRDYYVIIRERLWIALPLALLVSLGLGYWK-MRET
A0A2T6DX88      ----------------------RRTARDYLIILRERVWIALPIGILVGVILGYLQ-ARVT
A0A3E1E5C8      ----------------------RRSLRDYYIILREKLWIALPLALLVSLSLGYYE-ASRP
B1ZZ74          ----------------------RRGLRDYYIILRERLWIALPLALLVAVPLGYFR-ARET
A0A2E0V4K6      ----------------------ARGLPKVFWEMLGKWYFPVMGAILGLFASAYYL-KKTP
A0A2E6NAH3      GYGGGNYGFGGGYGDGGAGP--QRSFKDYLLMFRERIWYLIVSLFIIFSGSILYT-FNKT
A0A2A5VZA5      GYSYGNYGYGGYGGGGEQAP--QRSIKDYILIFRERIWWLIVSFFIIFSGSLLYT-FNKT
A0A424R295      GYSYGNYGYGGYGGGGEQAP--QRSIKDYILIFRERIWWLIVSFFIIFSGXLLYT-FNKT
B4CZV9          ----------------------LHDIFLYVAIASKHARLMVLLICFALTAGLTYY-VFAK
A0A3B9FM17      ------------------------------------------------------------
R7E4L8          ----------------------IFSFRFIFSTARRYWPWILACALLGGGLAYFIC-ARQG
A0A0E3YV65      -----------------------MSPREILLSIRERALTSFVLALLICSLLGGWL-LSRP
W0J900          ----------------------RLDIRQILLCIRERWIVSTSLATLVCVLLGVWL-LKQP
A0A2T6DSN5      -----------------------FSPRSLLNMFLERWWIGLIAGALGAVAFVLAQ-PKQD
A0A2V2SMX4      ----------------------FTRLQRLRGLLLAKWWIPALGVALGVGIQASRS-ITEK
A0A317ZIW7      ----------------------HKSIYRTKIVLKRFWWVLPVAVSLGVAYKAIES-FLEA
A0A2D7WMI4      -----------------------KGISDFLLILRDRWMLSLTLALPIALGFTYKS-LQVP
A0A2D6VHX5      ----------------------NKTVSEFLLILRDRWLLAVTLALPFSLAYVYKE-LQVP
A0A2D8I214      -----------------------KSIAEILLVIRDRWLLALSLALPISLGYVYLK-FQDT
A0A1Z8VL41      -----------------------RGISDFLLIIRDRWLLALTLALPIALGFVYKE-LQVP
A0A2E6TNA4      -----------------------RGISDFLLIIRDRWLLALTLALPIALGFVYKE-LQVP
A0A1Z8RG47      -----------------------KGVSDFILIIRDRWLLALTVALPISLGFVYNK-LQSP
A0A1Z8RJJ5      -----------------------KGVSDFILIIRDRWLLALTVALPISLGFVYNK-LQSP
A0A2D7V631      -----------------------KGLSDFVLIIRDRWLLSLTVALPVALGFVYNQ-LQGP
A0A354RA24      -----------------------KGLSDFVLIIRDRWLLSLTVALPVALGFVYNQ-LQGP
A0A2E9RV62      ----------------------LRGVFDYFLIIRDRWLLATALSLPIALGFVYKE-YQQP
A0A2E4AY96      ----------------------VRGVSDVLLILRDRWLISLCIALPIALTIAYKD-LQVP
A0A3B9B9P4      ----------------------VRGVSDVLLILRDRWLISLCIALPIALTIAYKD-LQVP
A0A2D5Y6N6      ----------------------IKGIGDFILILRDRWLIALTLSLPXALAYIYVK-SQGI
A0A2E7HSS8      ----------------------IKGVSDFLLIIRDRWLLSLALSLPFALGFVFVK-QQVH
A0A2D8VCK3      ----------------------IKGLSDFLLIVRDRWLLAIALSLPCALLWVFYK-QQEP
A0A350QVY4      ----------------------IKGLSDFLLIIRDRWLLAIALSLPCALFWVFYK-QQEP
A0A2E4ZYR7      ------------------------------------------------------------
A0A2E6TCV1      ----------------------LKGVIEYLLIIRDRWLLAIALSLPISLWYVYDR-YQEP
A0A3D4HHL8      ----------------------HVWLFRAKLLLKRFWWVFLITISLGVAFQTYDV-LITP
A0A366HV03      ------------MSAPIKKGAPGVDMLHYAVGYLKYGRMMILLLLLGVLAGVCYY-TYSP
A0A2V2SDN0      ----------------VATSRLFVRLHRHQVLLREYWWVLALILLVTVVPALVIT-LATP
A0A1V6GL40      -----------------------ARLSRFRNLLREKWWVLVLGAMAGAIIKIVLL-WNAP
A0A2V5X6Z6      -----------------------GRLHRWWLLLGRYWWVIVLILVLVLGPVGFLS-FNSL
A0A2V5VGZ7      -----------------------GRLHRWWLLLRRYWWLIVLILVLGLGPAGFLS-FNSP
A0A2V5U130      -----------------------GRLHRWWLLLGRYWWVIVLILVLVLGPVGVLS-FNSL
A0A2V6C237      -----------------------GRLHRWWLLLGRYWWVIVLILVLVLGPVGFLS-FNSL
A0A3R8L982      ----------------------RRTLRDYYIIVRERLWIALPLALLAALGYAYYK-SREL
A0A2E7HPU9      GTSR------------------RARTRQLIGDILVRWHWMALGLVLGLLGSFYYL-SKAP
A0A388PR45      GYGAPGYGNYGNYAAGGASGGKGGPFTVYLAMLRERWWWVLLSVLVFVTIAVVYT-STII
A0A388QR61      GYGAGGYGAYGNYGAYGSSGAKASPFTVYLTLLRERWWWVLISILVFVTVAIVFT-SSIV
A0A2A2RS01      GYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLVGVTIALVLT-YQTM
A0A2A2Y1A7      GYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLVGVTIALVLT-YQTM
A0A388PDH9      GYGA-GYGQGGYGRYGVKEG--GNPLYAYIAMLRERFWWLILAVLLGVTIALVLT-YQTM
A0A2G4H1E7      AYGA-GYGSYGGGPRGGAGG--ASPISNYLLMLRERYWWVLLTSLVFLTLSLLNT-YNTV
A0A2G4GZA6      GYGY-GNGNYGAYNRGGAGE--GNPIQNYLLMLRERYWWILLSTLVFLTLSLLNT-YNTV
A0A388P514      GYGY---GNSGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
A0A2A2YG59      GYGY---GNYGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
A0A2G4F7D5      GYGY---GNSGAYNRGGAGE--GNPIHNYLLMLRERYWWVLLSTLVFLTLSLLNT-YNTV
D5EML0          STTS------------------VFGLTDLLAVVRKHWMSGAFIGLVVAGLFVASV-LTKE
A0A3C1C1M3      GPLQ------------------SLNPMRLLQIARNHWVILLLA--ILFAGGAAAF-YLSR
A0A2E9EYJ1      QSET------------------KLHALDYWQVAXNRYAVILLTXALVXMTALVIA-YLRP
A0A258AXR6      GTEL------------------QKHAMDTWQVVKNRFGLIALSFLLIFAAAAVLT-YIMP
A0A1T4WVZ9      SNEL------------------QQQALDSWQVIRNRFGLIILSFLLVFATAAIIT-YIMP
A0A3D3NZQ6      SPDL------------------QNHALDSWRVIRGRAGLIILSFLLVFGSAAMLT-YIMP
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A3R5R793      ------------------------------------------------------------
A0A2N8IV96      SNVTANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLAGMIKVAPVR-----
R7E1V8          SNVTANYIPMQYSVLTSTEVLKVVSRKLNLAAEWGMTDEMAASNLAGMIKVAPVR-----
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ----------------------------------DLEDLESVGYVDAASEKARPDNLTNE
A0A2S7U0Z3      PSSEAIAVLEVNIQTGQ-----------LLGQDLVQERMTPDIILATEASKLMGPAILSA
A0A2E0R252      VTYQSQATIEIERVKKED----------ADVDEEERIRMGGASEMFSVTEKLRLPNLYTN
A0A3E1EF48      KTYQSWTSIQIARVKQEA----------ADVAEEERIRLGVPAELQATLEKLRMPRIYQN
A0A2A2PVG8      PTYQSSATIEILRVKRDA----------ADIAEEEKIRMTGAAEMLSASERIRLPQIYVE
A0A2E0R421      HTYQSSATIEVLRIKKDD----------ADVDEDEVLRMNGVAEMMSASEKLRMPALYTQ
A0A2N8IR72      DAWNGKAVIVRHSP-----------------------------VLETANALLRGLTITRP
A0A410ELH5      DAWNEKTVIVRHKP-----------------------------VLETANNLLHGLTVTRP
A0A2E5EJ69      VIYESRATIIVEFAGPTVS---------YDQNSRNDFRLMRFDILNTMAQTVGRREVIDR
A0A1T4WWY4      ATYESQALIRANSFLMS-----------SEAAVGNANADRTYRQMRALMDQLNSGYVILE
A0A3D3LEQ6      ATFESTALIRINQFVDA-----------AKAASG-AQRDNNIALMRSLSKQLTSDFYQLE
A0A3D3NW23      ATFESTALIRINQFVDA-----------AKAASG-AQRDNNIALMRSLSKQLTSDFYQLE
A0A2G4I5Z5      ------------------------------------------------------------
A0A2E7ALI1      ----------------------------RGKRALPETGSNTSNHQKKLVSLLKNRCEVTV
A0A178IDB9      PVYRSEVKLLFEPQKDQV----------IGIKEVVDTTTTSNLQLNLHIEQMLSTTFYEY
A0A290QD69      PIYKTEVKLLFENQKDNV----------IGMAGVVETTTNSGMQLQLHIEQMLSRTFYES
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      KVFQASATLLVDRAEKVLGNEM------TKVVDDSVGGSKNDPSFDTHLAQITSREMVQR
A0A357FSP9      ------------------------------------------------------------
A0A2A2R174      VVYQSKAVIELDFGEKKVL---------AIDDFEKRDKGGGVDFLNTIANNVRSSAIIKR
A0A1H1SWX2      PMYSSTATMQFERPERV-----------VQNEQVVDTAVRSEVDLGTYLQILQSGRLRTM
A0A290QE54      PMYQARATMQIEKPEKI-----------VTSQEIVDISINSDIELNTYLQVLGSAKLRGK
A0A1H2DTI1      PNYASTARLMINTK--------------INVTESSVSTTEVGNYMETQIALMTSQKVYTA
A0A1V5L462      DAWESSAQLIIQGN--------------IEIQEADRLREVATNFHDNQLHLMTGQWVSER
A0A2A2R3V9      PTYISSGKLIVSPR--------------MFLPENAVVSDESVNFIGTQLELMQSAEVRSR
A0A3D3LGD3      DNFMANSDVVVKNEFESI------------IKPETLYPVVDKLDLQLKWELPTRQAALGK
A0A350ARX4      PVYVSYAEMMVSG---------------RFALPDNVYREELSNFFGTQITLMLSDRVQKQ
B5JIS2          PEHTAVSTMLAQSPLDELLH--------SDQQARERKKDAQENFLQNHLSVMKSRRFSVE
A0A1H2GQN6      KQYGGTVDIRVFKQDKD-----------VQVFSQSDRNAFDPIFFESERSTIESKEILYP
A0A2A2RPW6      VVYQSKAVLYFDSGEVNV----------INIQEVEKREKAGIDLLNSIANNLKSSVILSR
B4D1I7          VVYVSTGRIMASGK--------------INLPEGVTYTEEMNLFISTQRELMQDEAVRQR
A0A353F286      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A354FSA6      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A3B9GA54      EKYESTSVVQVHPSTIAITPF-------RGQSAVNPGSQMTAQYLQNEFESIIAPETLAM
A0A2D7B7R6      AHYRSTALLVVDTQQF------------VESDADASNDVRDLDILTTLVGRISTTPVLSH
B1ZT68          PLYYSEVSLLFETRKDRV----------LNIQDVVDTGVRSTTELNVHAEQLRSQTFFEY
W0J7C2          PIYRTEVSLLFEARKDRV----------LNIQEVVDTTLQTAAELNTHIEQLRSKTFADY
A0A2E5K4P7      KEYKSVAELRMER---------------FGNTPIDTGNEKNQDNIGSHEDFNTWANILKS
A0A0R2XPB1      PFYKSTSQMIVSGR--------------IALPENDMYAEERDNFIGTQIELMLSDQVQAR
A0A348NQP1      -----------------------------------MYAEERDNFIGTQIELMLSDQVQAR
A0A357FV58      PFYKSTAQMIVSGR--------------IALPENDMYAEERDNFIGTQIELMLSDQVQAR
A0A2V6F9Q9      ---------------------------------------------------MQSAEVRRG
A0A2V6ME53      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6NZZ3      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6EBU2      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6EY06      PSFQSTSKMMLAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRA
A0A2V6NIJ1      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6C292      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V6D2X0      PSFQSTSKMMMAGK--------------LNINQGPVYSEDNVNFYGTQIQLMQSAEVRRG
A0A2V5ZUK1      PQYQSTSKMMLAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVKHS
A0A2V5XFN9      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A2V6EZC8      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A2V6I7Z5      PSYQSTSKMMMAGK--------------LNIAQGAVYSEDAVNFYGTQIQLMQSAEVRRS
A0A3B9LCP2      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A3C0R669      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2V6EID2      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2V6MHB0      PSFLSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKRS
A0A2W5YWL9      PSFLSTSKMMLAGK--------------LNVNSSAVYSEDNVNFYGTQIQLMQSTEVRRG
A0A2V5NH62      PSFESRSKMMLAGK--------------LNISQSAVYSEDSVNFYGTQIQLMQSQEVRKS
A0A2W6A620      PLFQSMSKMMLAGK--------------MNISQSAVYSEDSVNFYGTQIQLMQSAEVRRS
A0A2V5PIJ4      PSFLSRSKMMLAGK--------------LNISQNAVYSEDSSNFYGTQIQLMQSDQVKQG
A0A2V6K2G8      PSYQSTSKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVRHS
A0A2V5W206      PSYLSASKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVRHS
A0A2V6MW77      PSYLSASKMMLAGK--------------LNIAQGAVYSEDSVNFYGTQIQLMQSAEVKHS
A0A3C1VFY9      PEFISVGQMIVSIK--------------VNIQQGSLYTEELGNFLGTQAALMQGNEVLNR
A0A2G4GZN8      PEYRATGRLRVFRLSPNINGG--------SSAADDNFKIVSNDDFFTAIEAMRSANIIEG
A0A348NPT1      ------------------------------------------------------------
A0A2E1KV60      KLYTAYSTIELLRDDPTVMLS--------SSGNLEQNEIRTAEDLNTHISKLESITVIQG
A0A2D7F4D9      KLYTAYATIELLRDDPTVM-N--------SASNLEQNEIRSSEDLNTHISRLESVSIIQG
A0A3R7RBR8      KLYTAYATIELLRDDPTVM-N--------SASNLEQNEIRSSEDLNTHISRLESVSIIQG
A0A2E0NH28      KVYTAYVSVQLLRDDPSAMR---------DETEMEPNQILSAEDLNTQISVLESLSIIQA
A0A350AS32      KVYTAVAQVQLLRDDPSAMGNI-------PGMEMEPNQIRSAEDLNTQISVLESASIIVG
A0A368BGT4      KVYTAVSQVQLFRDDASALGAY------GQGAEMELNQILGAEDFNTQIIVFESLNIMQG
A0A1G3ZL71      PMYESRATLQFEREERV-----------MNQQKVVELAPQSEVDINTYVHQLNSGTLRSR
A0A2T6DX88      PLYQSQATMQIEKPEKI-----------VTSQEVVDLSVTNDIDLNTYLQVLNSTKLRTK
A0A3E1E5C8      KMYAATATMQFEKADTV-----------VTTQGVVDPSVRSELELRSNLEKLNSQRLRTK
B1ZZ74          PLYAAMATMQFEKPETV-----------VTSQVVVDPSVRSDIELNTNIQVLNSARMRSR
A0A2E0V4K6      ERFASTATLLVKQNLSGV----------ISSEEVEDLDLRSDNVMNTIAAQVTRVGILEK
A0A2E6NAH3      KVYTAASQVQLFRDDASALGAI------GQGMEMEQNQILSAEDLNTQISVMESLSIIQG
A0A2A5VZA5      KVYTSVAVVRLLRDDPSAMGV---------SVELAQNQIVGAEDLNTQISLLQSGKIIQG
A0A424R295      KVYTSVAVVRLLRDDPSAMGV---------SVELAQNQIVGAEDLNTQISLLQSGKIIQG
B4CZV9          PVYYAHALIHLE----------------YLARPLDTDKLYEDGRLSAFVAQFTEPQIMLR
A0A3B9FM17      -------------------------------------ESHLEGLISRHTEGLNSEKLRIN
R7E4L8          YLYQKTARIMLRDDKQKNAQV-------SEIILSDLGFKPGEANLANESYVVKSSEVMSR
A0A0E3YV65      KVYQSRSRLLVDRSERVV--DI------AQVVDQSVGGGKNDAMFDTYLAQITSPAMIVR
W0J900          KVFQASATLLVGRIEKVLGNEI------TNVVDDSVGGSKNDPAFDTHLAQITSREMIQR
A0A2T6DSN5      PVYWTEVQLLFEPKEKKV----------LNITEVVDTTTSSSLDLHTHLARLRSETFLDY
A0A2V2SMX4      PSYVSTGRMIVSMK--------------LSIPEGQLYTEEMGNFLGTQAALMQSDVVIHR
A0A317ZIW7      PNYRSNAQMMLSGR--------------ISLPENELYAEERANFFGTQIELMESSQVKSR
A0A2D7WMI4      EFYASSSSFRLIPPPAII----------N-LQKVD-REQQLQPLVSKHLDGLNSQELRAQ
A0A2D6VHX5      EMYQSSSSFVLIPPPKIL----------N-LQKVD-RDQQVNGLISKHLDGLNSQELRMN
A0A2D8I214      EFFQSSSSFRLIPPPAVL----------N-LQKVD-RDTQVQGLVAKHREGLNSQELKAS
A0A1Z8VL41      EFFRSESSFRLXPPPXII----------N-LQKVD-RXSXINTLXSRHLDGINSQXLRVN
A0A2E6TNA4      EFFRSESSFRLIPPVEVI----------N-LQKVD-RSSQINTLISRHLDGINSQELRVN
A0A1Z8RG47      EFYKSSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A1Z8RJJ5      EFYKSSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A2D7V631      EYYASSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRVN
A0A354RA24      EYYASSSSFRLIPPPAIL----------N-LQKVE-RDQHVQGLVAKHLDGLNSQELRAN
A0A2E9RV62      SIYQSSSSFRLIPPPAIL----------N-LQPVE-QANQLVDLVRKHTEGLNSQELRAR
A0A2E4AY96      EFFSSSSSFRLIPPPAII----------N-LQKVDQQEQQFQLLVGKHRDGLNSQELRMQ
A0A3B9B9P4      EFFSSSSSFRLIPPPAII----------N-LQKVDQQEQQFQLLVGKHRDGLNSQELRMQ
A0A2D5Y6N6      ELFRSSASFRLIPPPAIL----------N-LQKVD-RDQHVQGLVAXHLDGLNSQDLRLN
A0A2E7HSS8      EYYRSSSSFSLIPPPAIL----------N-LRSVD-RDQHVEGLIAKHTEGLNSQQLRTN
A0A2D8VCK3      DKFQSSCSFSLTPPPAIL----------N-LQSVE-RESHLEGLISRHTEGLNSEKLRIN
A0A350QVY4      DKFASSCSFSLTPPPAIL----------N-LQSVE-RESHLEGLISRHTEGLNSEKLRIN
A0A2E4ZYR7      ------------------------------MQPVD-RDKYSARIIGQHLEGLRSGELRNR
A0A2E6TCV1      ELFRSSATFVIQPPLSII----------DNMQPIE-RDKYSARIVGDHLHRLKEKELRQR
A0A3D4HHL8      PSYVSYSQMIVSGR--------------IALPEGAIYSEELSNFFGTQMSLMQSHRVKER
A0A366HV03      AVYHSRSLIDYKFFA-------------LPVAADGVDGSSVARAVRSVQGQLSSRQMIAW
A0A2V2SDN0      PAYQSDARMWLTGK--------------LDLSEGRLYTEELVNFLGTQADLLRSRVIQER
A0A1V6GL40      PSYVSVGRMIVSMK--------------LAIQPASLYSEELSNFLGTQAALMQCGVVVNR
A0A2V5X6Z6      PAYESKARMWLTGR--------------LDIYEGRLYTEELINFLGTQTELLRSPAIQGR
A0A2V5VGZ7      PAYESKARMWLTGK--------------LDIYEGRLYTEELINFLGTQAELLRSPAIQGR
A0A2V5U130      PAYESKARMWLTGR--------------LDIYEGRLYTEELINFLGTQAELLRSPAIQGR
A0A2V6C237      PAYESKARMWLTGR--------------LDIYEGRLYTEELINFLGTQTELLRSPAIQGR
A0A3R8L982      PMYQSTATMQIEKPERVVTS-----------QEVVDTAVSSDADLNTYLQIIGSQKLRDK
A0A2E7HPU9      KLYEATSTLLVKDSARAAFE--------GQRQDNADINLRSQEALGTIVEQIKNFELFEK
A0A388PR45      PEYRAAGRLRVYRLTPTIGT--------GNTGVDETQRIGSNDDFLTAIESMKSTAVIEG
A0A388QR61      PEYRAAGRLRVYRLTPNLGN--------NNSAVEEAQRIGSNDDFLTAIESMKSSTVIEG
A0A2A2RS01      PEYRAVGKLRVFRMAPDVTA--------NNTAANNNFNITTNDDFYTAVESMRSTGIIES
A0A2A2Y1A7      PEYRAVGKLRVFRMAPDVTA--------NNTAANNNFNITTNDDFYTAVESMRSTGIIES
A0A388PDH9      PEYRAIGKLRVFRMAPDVTV--------NNTTANNNFNITTNDDFFTAVESMRSTSIIES
A0A2G4H1E7      PEFQATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEEMRSANIIES
A0A2G4GZA6      PEYRATGRLRVFRLTPTING--------GSSAADDNFRIGSNDDFFTAVEAMRSANIIEG
A0A388P514      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
A0A2A2YG59      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
A0A2G4F7D5      PEYRATGRLRVFRLAPTING--------GSSAADDNFKIVSNDDFFTAVEAMRSANIIEG
D5EML0          KLYQASASMTVELTTANVMDIREV----MDTNVAHVNLL--NTLMNTHLERIKTRAIADA
A0A3C1C1M3      ATEIYQAEARIELSTRRPRIVNKQDAMIEDRGYGDAEEI-----LNTQIQKFNSPSILPF
A0A2E9EYJ1      SEXLGRVQIXVQREARDIEVFRXT----GSVGXXGSDQLPYMTXMQTQFEIXQSRETXKE
A0A258AXR6      RKYRGHVEMTIERITQDINVFDRN----RGDSLAFTQEY-----IKTQFETITKPTTLYP
A0A1T4WVZ9      RKYRGRVEMKIERLQNKVQVFQRN----TDDFMAPTDVV-----IKNEFESITKPETLYP
A0A3D3NZQ6      RKYRGRVEMKIERLQDKVQVFERS----SDNFMANSDVV-----VKNEFESITKPETLYP
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A3R5R793      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      QL----------------------------------------------------------
A0A2S7U0Z3      TAQSPEVRALRNAIPPEFSFKPRYMRTEEELAFKPASSVEVYELVSSFGSWITISGRR--
A0A2E0R252      IAASPKFAEREDVA--SEKFHMPWE---------DVPSVSGADMSPET--LGGMMRGWVT
A0A3E1EF48      VASNPLFANRPEVVPLSRRYVLPWEPFLAKKPNPEEKPAPGTKQGPAAGDLAGMMAGWVS
A0A2A2PVG8      AAKGQLFANRENIA--PAKKRFPWT---------KQMRFAGEDLSPEM--LGAMLKGWVT
A0A2E0R421      VAKSYLFENRDDVF--PDRFHLPWE---------KRQNPTREDISDVS--LGNMMRGWVS
A0A2N8IR72      DSK---------------------------------------------------------
A0A410ELH5      DAK---------------------------------------------------------
A0A2E5EJ69      AA--------------------------------------------------ELIVDREQ
A0A1T4WWY4      AA-------------------------------------------------RAIGVAGPS
A0A3D3LEQ6      AA-------------------------------------------------KKLGVATAS
A0A3D3NW23      AA-------------------------------------------------KKLGVATAS
A0A2G4I5Z5      ------------------------------------------------------------
A0A2E7ALI1      RR----------------------------------------------------------
A0A178IDB9      VQ--------SSFSSAEIEQIQAPYRNPDNPSAPPPSL-------------AGIIRPHIN
A0A290QD69      VQ--------SSFTPKEIEQIQNAYRNPDSPTAPPPSL-------------ADIIRPNVR
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      VV--------ASFTPEEKTRVLAAWLDKDDPPLSASQMDGRLSGLIT----SGVGVQRQG
A0A357FSP9      ------------------------------------------------------------
A0A2A2R174      VV-----------------------------------VGQSLTNHPYFTGGSNAPSEQMV
A0A1H1SWX2      VA--------QSLTPDEIRLLQRPYLKDLAPGANPPAVGGLLGSMSP----LSIR-----
A0A290QE54      VI--------QSLTPAEVKMLQQPFLATLEPGQPPPSIHEVVGSIGV----QAIK-----
A0A1H2DTI1      AI-------------------------------------------------NALKAKNPG
A0A1V5L462      AS-------------------------------------------------ERVRALHPE
A0A2A2R3V9      AR-------------------------------------------------ARVQALKPN
A0A3D3LGD3      LR--------SNLDTQSSI-----------------------------------------
A0A350ARX4      AK-------------------------------------------------DRVLMLYPE
B5JIS2          LA--------SEFTEDEKASIVRAFVKGDGVPSMSAF--------------EKILAGRMD
A0A1H2GQN6      VI--------KKLNLVEKWSQRYLHGERLLREDEVY---------------GILLGRHLK
A0A2A2RPW6      VV--------KANKLTNHVYFTQGTNAISEERLTRQLAYVVDARLRR-------------
B4D1I7          AA-------------------------------------------------NLVRSNNPE
A0A353F286      AAEKAQLPVQWGMDMDDV---------------------------------VSLLEGIVE
A0A354FSA6      AAEKAQLPVQWGMDMDDV---------------------------------VSLLEGIVE
A0A3B9GA54      AAEKAQLPVQWGMDMDAV---------------------------------VSLLEGIVE
A0A2D7B7R6      VI--------EISPELQEHYKVDLNDPRSITSASKKLGANITAKLRG-------------
B1ZT68          VL--------TSFNKEEAERIQRPYRDPTQP--------------------DKPVPSLAE
W0J7C2          VL--------ASFSTAEAELIRKAYADPLDP--------------------DAAPPPLDA
A0A2E5K4P7      PTITSMVETRLKASEVDYNNFMEPYQKMDKNGGRDEEDPIVAGPILH---------EKRR
A0A0R2XPB1      AV-------------------------------------------------ERIRLMDPD
A0A348NQP1      AV-------------------------------------------------ERIRLLNSD
A0A357FV58      AV-------------------------------------------------ERIRLLNSD
A0A2V6F9Q9      AA-------------------------------------------------ELVWSTHPD
A0A2V6ME53      AA-------------------------------------------------ALVRSTNPE
A0A2V6NZZ3      AA-------------------------------------------------ALVRSTNPE
A0A2V6EBU2      AA-------------------------------------------------ALVRSTNPE
A0A2V6EY06      AA-------------------------------------------------ALVRSTNPE
A0A2V6NIJ1      AA-------------------------------------------------GLVRSTNPE
A0A2V6C292      AV-------------------------------------------------GLVRSTNPE
A0A2V6D2X0      AV-------------------------------------------------GLVRSTNPE
A0A2V5ZUK1      AE-------------------------------------------------ALVRSSHPE
A0A2V5XFN9      AE-------------------------------------------------SLVRSAHPE
A0A2V6EZC8      AE-------------------------------------------------SLVRSAHPE
A0A2V6I7Z5      AE-------------------------------------------------SLVRSAHPE
A0A3B9LCP2      AE-------------------------------------------------ALVRSTHPE
A0A3C0R669      AE-------------------------------------------------ALVRSTHPE
A0A2V6EID2      AE-------------------------------------------------ALVRSTHPE
A0A2V6MHB0      AE-------------------------------------------------ALVRSTHPE
A0A2W5YWL9      AE-------------------------------------------------ALVRSTHPE
A0A2V5NH62      AE-------------------------------------------------QLVRSTHPE
A0A2W6A620      AE-------------------------------------------------ALVRSTHPE
A0A2V5PIJ4      AE-------------------------------------------------GLVHSTHPE
A0A2V6K2G8      AE-------------------------------------------------SLVRSAHPE
A0A2V5W206      AE-------------------------------------------------SLVRSAHPE
A0A2V6MW77      AE-------------------------------------------------SLVRSAHPE
A0A3C1VFY9      AR-------------------------------------------------ERVASQNPG
A0A2G4GZN8      VS--------KRLTVAERKQVLEPYQG----------GNIFSGPLTE----QEVFARQRG
A0A348NPT1      ------------------ERFMAPYAD----------ALSFTGPLTP----TQMLAQNRK
A0A2E1KV60      VE--------KRLQEDEFAQFMAPYKG----------VFSFSGPLTA----FEILAKNRK
A0A2D7F4D9      VE--------KRFQEDELAQFMAPYKG----------TFSFSGPLTA----FEILSINRK
A0A3R7RBR8      VE--------KRFQEDELAQFMAPYKG----------TFSFSGPLTA----FEILSINRK
A0A2E0NH28      VE--------RRLQDEERARFMAPYAD----------AFSLTGPLTP----VEMLAKNRK
A0A350AS32      VE--------QRIQDDVRERFMAPYSD----------ALSLSGPLSP----TEVLGRNRK
A0A368BGT4      VE--------KRLQDEMRERFMAPYMD----------TLSFSGPLTP----LEVLAENRK
A0A1G3ZL71      VY--------DSFTPEEKAILQRSFLKDLPPGAGPPATGDFMGQVVA----DAVR-----
A0A2T6DX88      VM--------ESFTPEEVKVIQRAYLKNLKPGDPLPGVGSMLGSTSV----QSVR-----
A0A3E1E5C8      VV--------ESFTPDEVKILQRPYLKNLPPGAGVPSAGEALGAVSI----DSTR-----
B1ZZ74          VV--------ESFTPEEVQILQRPYLANLAPGASPPSAGGALGGVSI----DAAR-----
A0A2E0V4K6      VA--------QRPEFAGSEDLVRKPASYMPDWASAFFAREGARESNSEPDTGANLTRVAA
A0A2E6NAH3      VE--------QRLQDELRLRFMAPYED----------TLSLSGPLTP----LEILAKNRK
A0A2A5VZA5      VN--------RRMSDEQRKRFLLPYEG----------AFSFSGPLTP----TEILGKYRK
A0A424R295      VN--------RRMSDEQRKRFLLPYEG----------AFSFSGPLTP----TEILGKYRK
B4CZV9          TA--------RALGIDTNS--------------------------------RDLERKYLF
A0A3B9FM17      VA--------HQLDNNPQY------------------KSVLLGPFLK----QGVRVGIAS
R7E4L8          VV--------KGLGLDVSY-----WEKRNIREVDLYHTTPLKAEFSEEVAFQPCSLAVTP
A0A0E3YV65      VV--------DSLSETEKLSAWRPYAEQDAPPPAAPVLRDTLLQIIG----SSVSAARQG
W0J900          VV--------ASFKPEEKARILAPWLDKDAPPLSDSQTDARLASLIA----DNVGVVRQG
A0A2T6DSN5      VQ--------QSFSPKE--------------------IEMIQNPYRDPQNANAPVPSVRN
A0A2V2SMX4      AH----------------------------------LLVIAQNPNFK----PQPVSLKVT
A0A317ZIW7      AI--------ERVKLTEPEVYESLEQK----------EEFLNEGLRS----LKIAAEVKD
A0A2D7WMI4      VV--------TKIENSPEL------------------KTEILAPYIQ----EGAVTSVAA
A0A2D6VHX5      VI--------ARINENSDY------------------KTELLAPYLS----DGTPMKIQN
A0A2D8I214      VI--------QKISDNPES------------------KSIMLAPFLR----EGIPVGVES
A0A1Z8VL41      VV--------QKISENPEX------------------KSIXLAPFLX----EGXPIGVAX
A0A2E6TNA4      VV--------QKISENPEY------------------KSILLAPFLQ----AGIPTGVAS
A0A1Z8RG47      VI--------QKVKDNPEY------------------KSALLEPYLK----EGISMDVGA
A0A1Z8RJJ5      VI--------QKVKDNPEY------------------KSALLEPYLK----EGISMDVGA
A0A2D7V631      VI--------QKIKDNPEF------------------KSTLLAPYLK----EGISMDVGA
A0A354RA24      VV--------QKIKDNPEF------------------KSTLLAPYLK----EGISMDVGA
A0A2E9RV62      VL--------EAIKDNSFK------------------KSTMLAPYVH----DQQLPEIAS
A0A2E4AY96      VI--------TKIENSPEL------------------KREMLKPYVE----SGIPTSVGS
A0A3B9B9P4      VI--------TKIENSPEL------------------KREMLKPYVE----SGIPTSVGS
A0A2D5Y6N6      VT--------QKIKDTPEL------------------KSELLSPYLK----DGISIDVGA
A0A2E7HSS8      VI--------LRLRESPEY------------------KSVLLAPYLK----DGVIVDLAS
A0A2D8VCK3      VA--------HQLDNNPQY------------------KSVLLGPFLK----QGVRVGIAS
A0A350QVY4      VA--------HQLDNNPQY------------------KSVLLGPFLK----QGIRVGIAS
A0A2E4ZYR7      IV--------RAINEDDHK------------------KATLLAPYVK----QGPPPPVAS
A0A2E6TCV1      VV--------KAIESDKAK------------------KSILLAPYVKDKKEQEVLPTVGQ
A0A3D4HHL8      AR--------LRVRAMQ----------------------------PE----LDPCVVRVS
A0A366HV03      TA--------HSLGVGRANASFEELRS---------------GPLRK----IELGLL---
A0A2V2SDN0      AL----------ATVEKQFSNAPPLKPVPGMADFLRHGSSVNAANAE----PSELFKLKV
A0A1V6GL40      AH--------ERVSAQ-KPEIG--------------------------------------
A0A2V5X6Z6      AL--------ARLRSELNPDLAVLLDG----------GGRQSELLHL----AKALCKRLF
A0A2V5VGZ7      AL--------AKLRSERN--LAVLHNG----------GGTQSELLHK----AKALCKKLI
A0A2V5U130      AL--------ARLRSELNPDLAVLLDG----------GGRQSELLHK----PKALCKRLF
A0A2V6C237      AL--------ARLRSELNPDLAVLLDG----------GGRQSELLHL----AKALCKRLF
A0A3R8L982      VA--------ESLKPDDIKILQRPYQQ---------DAIASGSPLPG----PSGLVGGIN
A0A2E7HPU9      IA--------KDPDVLALEGLIPPSVNWWPEWSGDLLGGDGEAAIEA----SKMETSQLA
A0A388PR45      VS--------RLLTPAERKLVLEPYQQ----------GNVFTGPLTE----QEVFARQRG
A0A388QR61      VS--------RLLTPAERKLVLEPYQQ----------GNVFTGPLTE----QEVFGRQRA
A0A2A2RS01      VS--------RQLTIDEKKRVIEPYQQ----------GNIFSGPLSE----QEVFGRQRA
A0A2A2Y1A7      VS--------RQLTIDEKKRVIEPYQQ----------GNIFSGPLSE----QEVFGRQRA
A0A388PDH9      VS--------RQLTIDEKKRVIEPYQQ----------GNIFSGPLSE----QEVFGRQRA
A0A2G4H1E7      VS--------KRLTTDERKQILEPYQN----------GNYFSGPLTE----QEVFAKQRS
A0A2G4GZA6      VS--------KRLTADERKLVLEPYQA----------GNIFSGPLTE----QEVFAKQRG
A0A388P514      VS--------KRLTADERKLVLAPYQA----------GNIFSGPLTD----QEVFVKQRG
A0A2A2YG59      VS--------KRLTADERKLVLLPYQG----------GNIFSGPLTE----QEVFARQRG
A0A2G4F7D5      VS--------KRLTADERKLVLLPYQG----------GNIFSGPLTE----QEVFAKQRG
D5EML0          VV--------AALSEDQIQQLVDPYYD----------PAIDGENKPD----PAVLLMRRM
A0A3C1C1M3      VV------------ASYRELY------------------------PD----DPAPEEELT
A0A2E9EYJ1      VIXNGVDXAGNXXDLKKSWGV------------------------PS----DEDAYRILK
A0A258AXR6      VI--------ETLELAKKWEL------------------------PN----RQAALGRLR
A0A1T4WVZ9      VV--------DKLDLQKRWSL------------------------PN----RQSALAKLR
A0A3D3NZQ6      VV--------DKLDLQLKWEL------------------------PT----RQAALGKLR
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      ------------------------------------------------------------
A0A2E6T1E0      ------------------------------------------------------------
A0A2V5U7A0      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A3R5R793      ------------------------------------------------------------
A0A2N8IV96      ------------------------------------------------------------
R7E1V8          ------------------------------------------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      ------------------------------------------------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A2E0R252      VRWRK-------------------------------------------------------
A0A3E1EF48      VSVRE-------------------------------------------------------
A0A2A2PVG8      VRWRT-------------------------------------------------------
A0A2E0R421      VRWRP-------------------------------------------------------
A0A2N8IR72      ------------------------------------------------------------
A0A410ELH5      ------------------------------------------------------------
A0A2E5EJ69      LSPDISQNDLRGQLGGVSSSLRK-------------------------------------
A0A1T4WWY4      TTFDGLRDDVMPVCRMAIL-----------------------------------------
A0A3D3LEQ6      TTAVDLRASLIPAIRIGFL-----------------------------------------
A0A3D3NW23      TTAVDLRASLIPAIRIGFL-----------------------------------------
A0A2G4I5Z5      ------------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      IYQQK-------------------------------------------------------
A0A290QD69      IEPQR-------------------------------------------------------
A0A2E7VDS1      ------------------------------------------------------------
A0A178IFJ2      ------------------------------------------------------------
A0A357FSP9      ------------------------------------------------------------
A0A2A2R174      VSSVSGAVDARLRR----------------------------------------------
A0A1H1SWX2      ------------------------------------------------------------
A0A290QE54      ------------------------------------------------------------
A0A1H2DTI1      FVESDVRIDVHPLG----------------------------------------------
A0A1V5L462      IQKDWVSLWAGRKG----------------------------------------------
A0A2A2R3V9      LVPIPVALSAYQQP----------------------------------------------
A0A3D3LGD3      ------------------------------------------------------------
A0A350ARX4      ITPSWVSLSVVQRS----------------------------------------------
B5JIS2          ATRQR-------------------------------------------------------
A0A1H2GQN6      VEPQR-------------------------------------------------------
A0A2A2RPW6      ------------------------------------------------------------
B4D1I7          LTPCPITLFVAPLP----------------------------------------------
A0A353F286      TIPRR-------------------------------------------------------
A0A354FSA6      TIPRR-------------------------------------------------------
A0A3B9GA54      TIPRR-------------------------------------------------------
A0A2D7B7R6      ------------------------------------------------------------
B1ZT68          IIRPNLTIFARR------------------------------------------------
W0J7C2          IIRPNVTVFARR------------------------------------------------
A0A2E5K4P7      IIPKR-------------------------------------------------------
A0A0R2XPB1      LHDALIATEAYQIDGLRALSIESNVKR---------------------------------
A0A348NQP1      LHDALMVTEAYQNDGLRALLIEADVKR---------------------------------
A0A357FV58      LHDALMVTKAYQIDGLRALSIEADVKR---------------------------------
A0A2V6F9Q9      ISPVPIELSVAQRP----------------------------------------------
A0A2V6ME53      LQPAPVELTVAQRP----------------------------------------------
A0A2V6NZZ3      LQPVPVELSVAQRP----------------------------------------------
A0A2V6EBU2      LQPVPVELSVAQRP----------------------------------------------
A0A2V6EY06      LQPVPVELSVAQRP----------------------------------------------
A0A2V6NIJ1      LQPVPVELSVAQRP----------------------------------------------
A0A2V6C292      LQPVPVELSVAQRP----------------------------------------------
A0A2V6D2X0      LQPVPVELSVAQRP----------------------------------------------
A0A2V5ZUK1      LQPVPVEIFVMQKP----------------------------------------------
A0A2V5XFN9      LQPVTVEIFVIQKP----------------------------------------------
A0A2V6EZC8      LQPVTVEIFVIQKP----------------------------------------------
A0A2V6I7Z5      LQPVTVEIFVIQKP----------------------------------------------
A0A3B9LCP2      MQPVPVDITVSQKP----------------------------------------------
A0A3C0R669      MQPVPVDITVSQKP----------------------------------------------
A0A2V6EID2      MQPMRVEITVVQKP----------------------------------------------
A0A2V6MHB0      MQPMRVEITVVQKP----------------------------------------------
A0A2W5YWL9      LHPVPVEINVLQRA----------------------------------------------
A0A2V5NH62      MQPVMVEISVVQKP----------------------------------------------
A0A2W6A620      LQPHLVEITVTQKP----------------------------------------------
A0A2V5PIJ4      MPTAPVEITVSQQS----------------------------------------------
A0A2V6K2G8      LQPVPVEIFVLQKP----------------------------------------------
A0A2V5W206      LQPVPVEITVLQKP----------------------------------------------
A0A2V6MW77      LQSVPVEITVLQKP----------------------------------------------
A0A3C1VFY9      VTPKPVALQVSVLP----------------------------------------------
A0A2G4GZN8      INPQR-------------------------------------------------------
A0A348NPT1      ILPQR-------------------------------------------------------
A0A2E1KV60      IIPRR-------------------------------------------------------
A0A2D7F4D9      IIPRR-------------------------------------------------------
A0A3R7RBR8      IIPRR-------------------------------------------------------
A0A2E0NH28      IIPRR-------------------------------------------------------
A0A350AS32      IMPKR-------------------------------------------------------
A0A368BGT4      VIPRR-------------------------------------------------------
A0A1G3ZL71      ------------------------------------------------------------
A0A2T6DX88      ------------------------------------------------------------
A0A3E1E5C8      ------------------------------------------------------------
B1ZZ74          ------------------------------------------------------------
A0A2E0V4K6      MLAQRCDATVRK------------------------------------------------
A0A2E6NAH3      IIPRR-------------------------------------------------------
A0A2A5VZA5      IMPQR-------------------------------------------------------
A0A424R295      IMPQR-------------------------------------------------------
B4CZV9          KFRASLN-----------------------------------------------------
A0A3B9FM17      AYSYRITQAGSK------------------------------------------------
R7E4L8          LNGREFSLSYRAKESGENVLHGKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVK
A0A0E3YV65      ------------------------------------------------------------
W0J900          ------------------------------------------------------------
A0A2T6DSN5      IVRSAIQIRDDK------------------------------------------------
A0A2V2SMX4      ILP---------------------------------------------------------
A0A317ZIW7      ------------------------------------------------------------
A0A2D7WMI4      AISYSVSVS--GE-----------------------------------------------
A0A2D6VHX5      IVTYNVSVSSPSE-----------------------------------------------
A0A2D8I214      TISYSISVSPPSE-----------------------------------------------
A0A1Z8VL41      TVSYSVSVTPPSA-----------------------------------------------
A0A2E6TNA4      TVSYSVGVTPPSA-----------------------------------------------
A0A1Z8RG47      TVSYGVSVSPPSE-----------------------------------------------
A0A1Z8RJJ5      TVSYGVSVSPPSE-----------------------------------------------
A0A2D7V631      TVTYSVGVSPPTE-----------------------------------------------
A0A354RA24      TVTYSVGVSPPTE-----------------------------------------------
A0A2E9RV62      IINYSVS--VGGE-----------------------------------------------
A0A2E4AY96      TVSYSIS--LSEE-----------------------------------------------
A0A3B9B9P4      TVSYSIS--LSEE-----------------------------------------------
A0A2D5Y6N6      TISYSISVSPPSE-----------------------------------------------
A0A2E7HSS8      TVSYRVD-QSGTK-----------------------------------------------
A0A2D8VCK3      AYSYRIT-QAGSK-----------------------------------------------
A0A350QVY4      AYSYRIT-QAGSK-----------------------------------------------
A0A2E4ZYR7      VVNYTVS--LAGE-----------------------------------------------
A0A2E6TCV1      VVNYKID--LIGK-----------------------------------------------
A0A3D4HHL8      VSQSP-------------------------------------------------------
A0A366HV03      ------------------------------------------------------------
A0A2V2SDN0      VESS--------------------------------------------------------
A0A1V6GL40      ------------RHA---------------------------------------------
A0A2V5X6Z6      ASGSTSSSNAPPRFP---------------------------------------------
A0A2V5VGZ7      ASGSSSSSNAPPRFP---------------------------------------------
A0A2V5U130      ASGSTSSSNAPPRFP---------------------------------------------
A0A2V6C237      ASGSTSSSNAPPRFP---------------------------------------------
A0A3R8L982      VQS--------VA-----------------------------------------------
A0A2E7HPU9      RLIRGWTEVSNRR-----------------------------------------------
A0A388PR45      VNP--------TR-----------------------------------------------
A0A388QR61      INP--------TR-----------------------------------------------
A0A2A2RS01      INP--------LK-----------------------------------------------
A0A2A2Y1A7      INP--------LK-----------------------------------------------
A0A388PDH9      VTP--------LK-----------------------------------------------
A0A2G4H1E7      INP--------QR-----------------------------------------------
A0A2G4GZA6      INP--------QR-----------------------------------------------
A0A388P514      INP--------QR-----------------------------------------------
A0A2A2YG59      INP--------QR-----------------------------------------------
A0A2G4F7D5      INP--------QR-----------------------------------------------
D5EML0          LSVERGE----NE-----------------------------------------------
A0A3C1C1M3      ARLANRGRFAIIK-----------------------------------------------
A0A2E9EYJ1      RKVETQD----VR-----------------------------------------------
A0A258AXR6      ANLETQS----ML-----------------------------------------------
A0A1T4WVZ9      GNLDTQS----SV-----------------------------------------------
A0A3D3NZQ6      SNLDTQS----SI-----------------------------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      ---------------------------------------NALMIEYIQYKKDIRKVVSGD
A0A258AXL1      ----------------------------------------EKLALLAKYRSA--------
A0A2E6T1E0      ----------------------------------------------LTYKRE--------
A0A2V5U7A0      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A3R5R793      ------------------------------------------------------------
A0A2N8IV96      ------------------ATDLVDVIVSGPDPKLVQNIAKAVPEAYKQDREMRENRLVET
R7E1V8          ------------------ATDLVDVIVSGPDPKLVQNIAKTVPEAYKQDREMRENRLVET
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------IVLQALKQAQADLDKARSDAAAAR
A0A353DI77      -------------------------------------------KQFINIREGVNEEGKKS
A0A1V6GCZ3      ------------------GTSLIEIVVYSEKPEEAARIANAIADAYKTHRQEQRAQLSRG
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ------------------GTSLIDVRVKHQDAEAARVIADTLLKVYLEKEESQLIGGSDD
A0A2E0R252      ------------------DTTLIDLYASHSDPEIARDTLEGLIEEYDRSVESKVAGSSEF
A0A3E1EF48      ------------------NTNLVDIFAAHTNPEVARDVLSCLLTEYEKLTAESIAGSEEN
A0A2A2PVG8      ------------------DTTLLDLYATHTDPAIARDSLAAVLSAYEQLSESRVEGSSEY
A0A2E0R421      ------------------DTKLLDIHVTHTNPEVARDVLVALLSEYERMTESKVADSSEY
A0A2N8IR72      ------------------ESSLLEMTLTSSNPQKAEDTLNHLIQVYNQISKDERNKASLK
A0A410ELH5      ------------------ESSLLEMSLTASNPQKAEDVLNHLIQVYNQISKDERNKAALK
A0A2E5EJ69      ------------------MTRFIDVSFRHRDRVFAMNANQAIVEAFVNWDIERKMGRGTN
A0A1T4WWY4      ------------------DQSHFQILVVSYDAEVVKKMPQALVDAYERIRLKIRSEYRDT
A0A3D3LEQ6      ------------------DQNHIQLRVISYRPRIVREFPQAMIEAYEGARKRLRNEYRDK
A0A3D3NW23      ------------------DQSHIQLRVISYRPRIVREFPQAMIEAYEGARKRLRNEYRDK
A0A2G4I5Z5      ------------------MTRLIDVTVELGDRVLSQTLAQAVVDEYIKQINEDRAGIGTN
A0A2E7ALI1      ------------------RTRLLDVRINHEDPKVSAELADTVVDEYLKELTEENRGTKNK
A0A178IDB9      ------------------GTTIVRIVVTNRDPEAAALIANRFSRKYIDFTVDKAMTSTNS
A0A290QD69      ------------------STTILRIMVWNKDPEAAALIANRFARQYIQYTIDRAMTKTSS
A0A2E7VDS1      ----------------------LRITAIARNGEGAAMIANLAQDEYERIHDVRKGKKHDM
A0A178IFJ2      ------------------TTFLIRITCKHREPAMAALVATRFAECYIVYLMDRNASANDS
A0A357FSP9      ----------------------------------AARVANLFADEFINYNLTLNIDGSMK
A0A2A2R174      ------------------MTRLIDVTVELGDRMLAQTVAQSVVDEYIKERNEVRAGVGTN
A0A1H1SWX2      ------------------NSFLITITVNNRDPEGAALLANRFVEQFMRYLMENVGGKNEF
A0A290QE54      ------------------NSFLISITATHRSGEGAALIANRYVDQFMQDLLMNVGGKNEY
A0A1H2DTI1      ------------------STPILIIRAMSSDAQFAKDFLQADIDAYIALQHDIKVDDKDR
A0A1V5L462      ------------------TTDIFQLVASGGNARYTQAYLAQIIQAYLEFRRQTRLETSDD
A0A2A2R3V9      ------------------RTSIFTLQASGSEPNYTQAFLDAVMEEYISRRKETRSEKSQS
A0A3D3LGD3      ------------------RSDFVIIEFFDKDPALAATIANAVADSYMTRRVEVESKQKES
A0A350ARX4      ------------------QASIFQLRAQGGSAEFTQKFLDAVMEEYQTFRSEMRSETTET
B5JIS2          ------------------DREFFTLSFRHPEAEIALMVADRMTAAYLKLVQREIKETNQA
A0A1H2GQN6      ------------------GSNIIQITGISEEMEEAPLLANTIAETYIGVRTKNEKDRINR
A0A2A2RPW6      ------------------FTRLIDVSVELGNAKLAQVIGQSVMEEFLKQNAEDRVGAGTN
B4D1I7          ------------------QTSIFNLSAIGTEPQYPQKFLDALMHEYIATRREMRTEKSED
A0A353F286      ------------------GTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKK
A0A354FSA6      ------------------GTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKK
A0A3B9GA54      ------------------GTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKK
A0A2D7B7R6      ------------------DSLFIDLTANSENRDLAYWSAKYVSTGYTNFLKVNSRSKAMG
B1ZT68          ------------------NTTILVVGVTNRNPENAALIANRFARRYIDYNLDRANSGTNS
W0J7C2          ------------------GTPILGIQVSNRSPEAAALIANRHARKYIDYNLDNASTRTNS
A0A2E5K4P7      ------------------LSLVIQIEYIHPNPEIAATVVNHFAQSFREYQLDQSLKKGIS
A0A0R2XPB1      ------------------DTSIFVLSAYTPHAEYTQAYLDAVMEEYINRRVEMRSKTSAR
A0A348NQP1      ------------------DTSIFVLTAYTPHAEYTQAYLDAVMEEYINRRVEMRSKTSAR
A0A357FV58      ------------------DTSIFVLTAYTPHAEYTQAYLDAVMEEYINRRVEMRSKTSAR
A0A2V6F9Q9      ------------------RTSIFELQAIGSSPEYTQLYLSAVMQKYLDFKRGMREGQTQT
A0A2V6ME53      ------------------RTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGMREGQTHT
A0A2V6NZZ3      ------------------RTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGMREGQTHT
A0A2V6EBU2      ------------------RTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGMREGQTHT
A0A2V6EY06      ------------------RTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGMREGQTHT
A0A2V6NIJ1      ------------------RTSIFELQAIGSSPDYIQAYLNAVMQKYLDFKRGMREGQTNT
A0A2V6C292      ------------------RTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGMREGQTNT
A0A2V6D2X0      ------------------RTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGMREGQTNT
A0A2V5ZUK1      ------------------RTSIFDLSAVGSSPEYTQAYLNAAMQKYLDFKRGMREDRGHE
A0A2V5XFN9      ------------------RTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRGMREGRGHE
A0A2V6EZC8      ------------------RTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRGMREGRGHE
A0A2V6I7Z5      ------------------RTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRGMREGRGHE
A0A3B9LCP2      ------------------RTSIFDLQAIGRTPDYTQAYLNAAMQKYLDFKKGMREGQGQT
A0A3C0R669      ------------------RTSIFDLQAIGRTPDYTQAYLNAAMQKYLDFKKGMREGQGQT
A0A2V6EID2      ------------------RTSIFDLQAIGRTPDYTQAYLNALMQKYLDFKKGMREGQGQT
A0A2V6MHB0      ------------------RTSIFDLQAIGRTPDYTQAYLNALMQKYLDFKKGMREGQGQT
A0A2W5YWL9      ------------------RTSIFELQAIGSSPDYTQAYLNAAMQKYLDFKRGMRQDQTHT
A0A2V5NH62      ------------------RTSIFDLVAIGTTPDYTQAYLNAVMQKYLDFKKGMRENQGST
A0A2W6A620      ------------------RTSIFDLVAIGSTPEYTQAYLNAVMQKYVDFKKGLRENQGST
A0A2V5PIJ4      ------------------RTSIFDLRAVGAVPEYTQAYLNALMQKYLDFKKGMREGQGHN
A0A2V6K2G8      ------------------RTSIFDLSAIGSAPEYTQAYLNATMQKYLDFKRGMREDRGHE
A0A2V5W206      ------------------RTSIFDLAAVGSAPEYTQAYLNAVMQKYLDFKRGMREDRGHE
A0A2V6MW77      ------------------RTSIFDLAAVGSAPEYTQAYLNAIMQKYLDFKRGMREDRGHE
A0A3C1VFY9      ------------------KTTIFILRATGGNPEYTKAYLQACMDEYRNLKKGMTEHASDT
A0A2G4GZN8      ------------------QTLVINVDFTHPNRDLARQVARLFCESIKKNSEDDRLMVTNP
A0A348NPT1      ------------------GTLMIGVGYNHPDPVMAARVANLFADEFINYNLTLNIDGSMK
A0A2E1KV60      ------------------MSLMVNISYTHPNPIVAAKIANLFGDEYINSMLSQNIDASMK
A0A2D7F4D9      ------------------MSLMVNIAYTHPNPIMAAKIANLFGDEYINTMLSQNIDASMK
A0A3R7RBR8      ------------------MSLMVNIAYTHPNPIMAAKIANLFGDEYINTMLSQNIDASMK
A0A2E0NH28      ------------------MSLMVNVGFTHPDPIIAARVANLFADEFIAYNLTKSVDASMD
A0A350AS32      ------------------MSLMINIAYTHPDPIIAADVANLFAKEFIDYNLKLNIDGSMK
A0A368BGT4      ------------------MSLMINLAYSHPDPLIAAEVSNLFAKEFIDYNLRLNIDGSMK
A0A1G3ZL71      ------------------GSRLIRITARHRDPAAAALVANRTYQQFVNQLIENAGGSSEF
A0A2T6DX88      ------------------NSFIIRIVVSHPDPEAAALIANRTVDQFMQYLLDSVSGKNEY
A0A3E1E5C8      ------------------NSLLISITVRHPDPVAAALVANQYVNQFVGYLMDYYGGKNET
B1ZZ74          ------------------NSLLITVRVVHPDPEAAALVANRYVNQFMTYLIERVGGVNES
A0A2E0V4K6      ------------------RTRLLDVTVTHEDPELARTLADAVVDEYLKELAEEDKGSADR
A0A2E6NAH3      ------------------MSLMVNFTYSHPDPFLAAEVANLFAKEFIDYNLKLNIDGSMK
A0A2A5VZA5      ------------------MSLMVNVAYTHPDAQIAADVANLFAQEFINYNLSENIDASMV
A0A424R295      ------------------MSLMVNVAYTXPDAQIAADVANLFAQEFINYNLSENIDASMV
B4CZV9          ------------------TEKNIDVEAWPYSADWAHRWTETMVQQFIAYRQERRNEEKNL
A0A3B9FM17      ------------------SRPRFIITSDARSALGAKYVADVVQKEYEKLHKSTKNEKVEF
R7E4L8          EATDGMLGRLSVTRPDSKESSLLELTLRLSHPQKAEDALNYLIEVYNDHSRREKQMAASR
A0A0E3YV65      ------------------NTFFISINVLQRDPDSAALLASRFASQFIIHLLDRNSAVNNS
W0J900          ------------------STFLVRVSYKHREPAVAALVATRFTECYIVYLMDRNTSSNDS
A0A2T6DSN5      ------------------ATTIVRIGAYHRDPEAAALIANRFARKYIDFMLDEAMSGTTS
A0A2V2SMX4      ------------------KTTIFLLVGTGDDPVYTQKFLQACMEEYANLKAEMRTQTSDK
A0A317ZIW7      ------------------DTSIFALSAITPDRKFSQEFLDAVMAEYINRRSEMRAKTSEK
A0A2D7WMI4      ------------------GRPVITISSNARSAQAAMIIAREVQTEYEILHRSRSNLKVES
A0A2D6VHX5      ------------------GRPRFKINSQSRTGKGAMIIADLVQKEYDKLNSIKKTEQVQT
A0A2D8I214      ------------------GRPRFVISSTSRSAKGAMLVADLVQSEYEKLHKSKKNQQVES
A0A1Z8VL41      ------------------GNPRFTISATSRSARGAQIIADTVQLEYEKLHKSRKSEKVES
A0A2E6TNA4      ------------------GNPRFTISAVSRSARGAQIIADTVQSEYEKLHKSRKSEKVES
A0A1Z8RG47      ------------------GRPRFTINSNSRSGKGAMIVADIVQSEYEKLHRSKKSQQVES
A0A1Z8RJJ5      ------------------GRPRFTINSNSRSGKGAMIVADIVQSEYEKLHRSKKSQQVES
A0A2D7V631      ------------------GRPRFTINSNSRSGKGAMIVADVVQSEYEKLHKSKKSQQVES
A0A354RA24      ------------------GRPRFTINSNSRSGKGAMIVADVVQSEYEKLHKSKKSQQVES
A0A2E9RV62      ------------------GRPVFTITATGRSPESVQLVADLVQQYYDESHKKGAGEIVRG
A0A2E4AY96      ------------------SRPRFTITSNARSAKSAMIIAREVQSEYEILHRSNSSLKVES
A0A3B9B9P4      ------------------SRPRFTITSNARSAKSAMIIAREVQSEYEILHRSNSSLKVES
A0A2D5Y6N6      ------------------GRPRFTINSTARSGRGAQIIADVVQSEYEKLHKSKKSLQVEN
A0A2E7HSS8      ------------------SRPRFIITSDSRSAKGAMIVADLVQKEYEKLHKSSKSEKVEF
A0A2D8VCK3      ------------------SRPRFIITSDARSALGAKYVADVVQKEYEKLHKSTKNEKVEF
A0A350QVY4      ------------------SRPRFIITSDARSALGAKFVADVVQKEYEKLHKSTKSEKVEF
A0A2E4ZYR7      ------------------GTPILRINSMARNGEGAAMVANLAQDEYERIHESRQGKKHDT
A0A2E6TCV1      ------------------GTPTLQITAEARNAEGAQLVANLVQIEYERAHKSRKGQNQTK
A0A3D4HHL8      ------------------DASIFILSAVGEKPEYTQAYLNALMNEYLSFKREMRSETADR
A0A366HV03      ------------------DGATMQLDVFSTNPNVVREFPQALINQYDSYTREKRFEFFEV
A0A2V2SDN0      ------------------KSSILELHATGAEPLSTRAFLNAVMAEYLSFKRESREKTSDR
A0A1V6GL40      ---------VALNVLVLPKTTIFVLQATGRDRDYTQAFLQACMDEYIALKKEMRSQTSDT
A0A2V5X6Z6      ---------FDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTTDR
A0A2V5VGZ7      ---------FDVKVLEGAKSSTLALRVIGAEPASTRAFLDCLMEEYLSFKKESREKTSDR
A0A2V5U130      ---------FDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTSDR
A0A2V6C237      ---------FDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTSDR
A0A3R8L982      ------------------RSYLISITAYNRDPDGAALIANRYVDQFITYLIDSVSGRNED
A0A2E7HPU9      ------------------KTRLVDVVVSHPLPEVASALADKISQTYANELGVERATGRTN
A0A388PR45      ------------------QTFVVNVDFTHPNRELARLVAQRFCDVIQKSSEDERLTITHP
A0A388QR61      ------------------QTFVVNVEFTHPNRELARMVAQRFCDVIQKSSEDERLTMTHP
A0A2A2RS01      ------------------STFVVTVEFTHPNRDLARQVAGIFCKAIQKNSEDERLTITNP
A0A2A2Y1A7      ------------------STFVVTVEFTHPNRDLARQVAGIFCKAIQKNSEDERLTITNP
A0A388PDH9      ------------------STFVVAVEFTHPNRELARQVASIFCKAIQKNSEDERLTITNP
A0A2G4H1E7      ------------------QTLVINVAFTHPTRDLSRKVAQLFCEAIKKNSEDGRLMMTNP
A0A2G4GZA6      ------------------QTLVINIDFTHPNRDLARQVARHFCDSIKKSSEDDRLMVTNP
A0A388P514      ------------------QTLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNP
A0A2A2YG59      ------------------QTLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNP
A0A2G4F7D5      ------------------QTLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNP
D5EML0          ------------------ESQVLNIIITHQNPRIAQQVANTYVDEYIAYKAGLRSSSTGE
A0A3C1C1M3      ------------------RTRLVSVTFTDPDPEFAMRACAAYAAGAEAAARAENRSGSNA
A0A2E9EYJ1      ------------------GTDLIDIEVYDTDPNLAADIANAVADAYRTRRQEEEQSRAQK
A0A258AXR6      ------------------RSDFVTIDYYDQDPQLAATIANEVAKSYMTQRNNIETGKKHK
A0A1T4WVZ9      ------------------RSDFVVIEYFDQDPGVAAEIANAVYQSYMTRRVEVETSQKQE
A0A3D3NZQ6      ------------------RSDFVIIEFFDKDPALAATIANAVADSYMTRRVEVESKQKES
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      TLASISEQVLRLERDLKSEQENLVAFQRTNNL---AIVQQEA-------------TIAGG
A0A258AXL1      ------PLPVGTIVRREPNPDPFLIKTAGPNV---VPGATGE-------------QVNGA
A0A2E6T1E0      ------NDIISLEESQNVTLKALIQAQTDFDM---ARSAEVT-------------AVAAA
A0A2V5U7A0      ------------------------------------------------------------
A0A355VK99      ------------------------------------------------------------
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      ------------------------------------------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A3R5R793      ------------------------------------------------------------
A0A2N8IV96      AIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKA
R7E1V8          AIKSLKDVLREQEDTVNEKMMSLKKLIAESSYLPTTWRNGENRSTLTAGMEEEDFRNAKS
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      KLDEEVERLLHAATSI--------------------------------------------
A0A353DI77      DLQHLLAAAKERESELETARRRAGSYTPALEA----------------------------
A0A1V6GCZ3      GIKALEERFAEQEAKVKAAQERVDNLRKELNISDAMASGDGPSP-----------LMTAE
A0A3C1UJT2      -------------------------------------------------------EIV--
A0A2S7U0Z3      AFKILKKEADGARLEMELAEKSLQFYVSAIKL----------------------------
A0A2E0R252      ALDYILESSDKVKEKMLNLERALRLYKRCLEL----------------------------
A0A3E1EF48      TINYIVEKCRELQEGIFKIESSLARYQGCVDL----------------------------
A0A2A2PVG8      VLEYILDSSAEIKERLLDLESTLQLYQRCLEL----------------------------
A0A2E0R421      ALDYILENTNRIRKGILDLERAIELYNNCQDL----------------------------
A0A2N8IR72      TKIFIRDRLKELGASLSDVDKKLTEFKTKSDI-----VKDADTTM----------SADFS
A0A410ELH5      TENFIQSRLKELGAALSDVDKKITEFKTKSDI-----VKDTDTTM----------SADFS
A0A2E5EJ69      TIAIHTTAAEELKVKWLEAQEIAHQYVKSNSL------------------AVGMTDMKRM
A0A1T4WWY4      AVKRYADEVTEIRKKVAEQLDSRLQFEEQSAL-----------------------ANAQI
A0A3D3LEQ6      AIARYVDELADVRAKVTSQLDSRLKFEEESAL-----------------------ASAQI
A0A3D3NW23      AIARYVDELADVRAKVTSQLDSRLKFEEESAL-----------------------ASAQI
A0A2G4I5Z5      TSQFLMGEEIRIKAGLLKAEVAVQEYLKTNSS---SLIQGQ--------------NIVTE
A0A2E7ALI1      RSEGLVKQAEEARVGLQEATSALAIYNRAIEA----------------------------
A0A178IDB9      AIIFLKNQSEEKRSEVESVERAMQDYRARHNM---AALGEAT-------------NIVRQ
A0A290QD69      AMLLLRGQAEEKRTELQLIERQKQDFRAKHNM---AALGENK-------------GVVQQ
A0A2E7VDS1      AITFLEEQMNKSRKLGQAIDANTRDFKRQHNL---AFIEDEK-------------KDVAD
A0A178IFJ2      AISFLRAQTEDLRKKAEASERALHAYREKSRM---VSLEESQ-------------NIVVD
A0A357FSP9      AVEDLRIRADQQKERVEELELKMAEYREDNNA---VSLESQE-------------NIAAT
A0A2A2R174      TSQFLMAEETRIKEKLLLAERAAEQYLRTNSS---SLIQSQ--------------NIVTE
A0A1H1SWX2      AVDYLRSRAKELQQESEAAEGKLQDYRRKHNL---VSLDNSM-------------NIVGE
A0A290QE54      AVQSLRTRAEQLRKEVEVADQRLQTYMKEQRL---VSLDSSV-------------NIVSD
A0A1H2DTI1      AIKDITDELTKAEATLQTDEDDVLGFQKANNI---VFLQEQG-------------SSLGS
A0A1V5L462      VMLSIGEELRELDVKIQQIQEAIRRFQQENNT---IAIKELS-------------EKAAG
A0A2A2R3V9      ALLTIKEQVDKSEKEINQVDEEMLSFQKENNV---IFMEEQG-------------NKNAT
A0A3D3LGD3      ALEMLNKQITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPN-------------STVPG
A0A350ARX4      TLIAVTEQLYRLEEEIENQENTVVDFQKENNL---IFLKEQD-------------SSTGA
B5JIS2          AAEMLRLQAEQLQAEISELEGKQRDFRERNNV---ISLEENQ-------------DLLAE
A0A1H2GQN6      GLDNVADQIEKQRTIVTDAKKKVDDMRLQLGVDIIPGTQNES-------------QLLDQ
A0A2A2RPW6      AGHALLASEAAIKQRLLKAEHAVAEYRRTKNI----SLQDTS-------------DIQTA
B4D1I7          AESSIEDEISRVQADVRKEEEKLVTFQRENNV---GFLEQGG-------------NSAGA
A0A353F286      ALDALDAESTEQEDLVDDYRKDLTVLIQQYGI---PYFDGGSAGNRLGLSEQAMFQSAKG
A0A354FSA6      ALDALDAESTEQEDLVDDYRKDLTVLIQQYGI---PYFDGGSAGNRLGLSEQAMFQSAKG
A0A3B9GA54      ALDALDAESTEQEDLVDDYRKDLTVLIQQYGI---PYFDGGSAGNRLGLSEQAMFQSAKG
A0A2D7B7R6      GLIQLERGRELSQKDLEDAQKALIRFQTKNRI---TNLKERK-------------EQLET
B1ZT68          AIIFLRNQAEELRAQVEAVESSLQEFRARNNI---AALGENQ-------------NVVLQ
W0J7C2          AIVFLRNQADETRAQVEAAEKALQNYREKNNL---AAIGETQ-------------NVVLQ
A0A2E5K4P7      DISKLGTEIQEKEKDVLVLEAKAVNYKTQFTS---LGLDSEE-------------NIFLR
A0A0R2XPB1      TYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNI---VFIQEQG-------------AAAST
A0A348NQP1      TYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNI---VFIQEQG-------------AAAST
A0A357FV58      TYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNI---VFIQEQG-------------AAAST
A0A2V6F9Q9      FTTGITEHLIQVEKDLRTAEDEMLEFQKENNI---GFIQEEG-------------NSAAQ
A0A2V6ME53      FTTGITEQLIQVEKDLRAAEDEMLDFQKQNNI---GFIQEEG-------------NSAAQ
A0A2V6NZZ3      FTTGITEQLIQVEKDLRAAEDEMLDFQKQNNI---GFIQEEG-------------NSAAQ
A0A2V6EBU2      FTTGITEQLIQVEKDLRAAEDDMLDFQKQNNI---GFIQEEG-------------NSAAQ
A0A2V6EY06      FTTGITEQLIQVEKDLRAAEDEMLDFQKQNNI---GFIQEEG-------------NSAAQ
A0A2V6NIJ1      FTTGITEQLIQVEKDLRAAEDEMLDFQKQNNI---GFIQEEG-------------NSAAQ
A0A2V6C292      FTTGITEQLIQVEKDLRAAEDEMLDFQKQNNI---GFIQEEG-------------NSAAQ
A0A2V6D2X0      FTTGITEQLIQVEKDLRAAEDEMLDFQKQNNI---GFIQEEG-------------NSAAQ
A0A2V5ZUK1      ITTGITEQLIQVEKDLRNSEDEMLEFQKQNNI---GFIQEDS-------------TSAAA
A0A2V5XFN9      VTTGITEQLVQVEKDLRNSEDEMLEFQKQNNI---GFIQEEG-------------NSAAA
A0A2V6EZC8      VTTGITEQLVQVEKDLRNSEDEMLEFQKQNNI---GFIQEEG-------------NSAAA
A0A2V6I7Z5      VTTGITEQLVQVEKDLRNSEDEMLEFQKQNNI---GFIQEEG-------------NSAAA
A0A3B9LCP2      VITGITEQLIQTEKDLRTAEDEMLEFQKQNNI---GFIQEEG-------------NSAAA
A0A3C0R669      VITGITEQLIQTEKDLRTAEDEMLEFQKQNNI---GFIQEEG-------------NSAAA
A0A2V6EID2      LITGITEQLIQTEKDLRTAEDEMLEFQKQNNI---GFIQEEG-------------NSAAA
A0A2V6MHB0      LITGITEQLIQTEKDLRTAEDEMLEFQKQNNI---GFIQEEG-------------NSAAA
A0A2W5YWL9      LTTGMTEQLIQVEKDLRAAEDEMLEFQKQNNI---GFIQEEG-------------NSAAQ
A0A2V5NH62      VTTAITEQLIQVEKDLRGAEDEMIEFQKQNNI---GFIQEEG-------------NSAAA
A0A2W6A620      VTTAITEQLIQVEKDLRNSEDEMLDFQKQNNI---GFIQEEG-------------NSAAQ
A0A2V5PIJ4      VTTAITEQLIEVEKDLRTAEDELLEFQKQNNI---GFIQEEG-------------NSAAA
A0A2V6K2G8      ITTGITEQLIQVEKDLRNSEDEITEFQKQNNI---GFIQEEG-------------NSAAA
A0A2V5W206      ITTGITEQLIQVEKDLRNGEDEMLEFQKQNNI---GFIQEQG-------------NSAAQ
A0A2V6MW77      ITTGITEQLIQVEKDLRNGEDEMLEFQKQNNI---GFIQEQG-------------NSAAQ
A0A3C1VFY9      TVAGLTDQMLRLDPEMRKVDDQVAVFLSTNDV----AFLEEA-------------SGVAN
A0A2G4GZN8      LIEKARIEIETLEDKVRRLNEQKNGLIKNQKL---LSIAKDT-------------NTLTA
A0A348NPT1      AVEDLRIRADQQKERVEELELKMAEYREDNNA---VSLESQE-------------NIAAT
A0A2E1KV60      AVEDLRKRAEQKKNRVEELELKLAEYRELKNA---ISLDKQE-------------NIAAE
A0A2D7F4D9      AVEDLRKRAEQKKNRVEELELKLAEYRELKKA---VSLDKQE-------------NIAAE
A0A3R7RBR8      AVEDLRKRAEQKKNRVEELELKLAEYRELKKA---VSLDKQE-------------NIAAE
A0A2E0NH28      AVEDLRIRADQQRQRVEELELKLAEYREEHNA---VSLDQQE-------------NIANE
A0A350AS32      AVEDLRIRADQQKERVEELDMKLADYREQNNA---VSLDSQE-------------NIARE
A0A368BGT4      AVEDLRIRADQQKDRVEELELKLAEYREQNNA---VSLQSDE-------------NIAGA
A0A1G3ZL71      TVEFLQLRATELRKELGEKEALLQDYKKRHNL---ISLDDSL-------------NIVAD
A0A2T6DX88      AVERLRLSAEQLRKEAEAADQKLQSYMREHNL---VSLDNSV-------------NIVSD
A0A3E1E5C8      GVEYLRAQADRLGKDAADAEQKLMAYKKEHNL---VSLGNST-------------NIVGT
B1ZZ74          AVEFLRNRADQLRKEAEQADVKLNAYMQAHNL---VSLDKNK-------------DIVSE
A0A2E0V4K6      RSAGLLGQADVARESLQEANSALAVYNRALET----------------------------
A0A2E6NAH3      AVEDLRIRADQQKNRVEELELKLAEYREQNNA---VSLQSDE-------------NIAAV
A0A2A5VZA5      AVEGLRIRADQQKERVEEIELKLAEYRERHNA---VSLDSQE-------------NIARE
A0A424R295      AVEGLRIRADQQKERVEEIELKLAEYRERHNA---VSLDSQE-------------NIARE
B4CZV9          IVNTYSEELKELVGRLDQQFSEKLDFQDQQDFTKTLILVNSI-------------NNLPA
A0A3B9FM17      VKQTLEDLLDTSLGKEKKIAADMANYKKEHNL---PFLEDEK-------------RDTGD
R7E4L8          AEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRI--VKDMDTTL-------------DATFN
A0A0E3YV65      AIAFLREQTQELRVKAESSERALQQYREKSGM---VSLDESR-------------NIVVD
W0J900          AISFLREQTEDLRKKAEASERALQAYREKTRM---VSLEESQ-------------NIVVD
A0A2T6DSN5      AILWLRNQAEETRSQLEAATRELQEFRERHNM---ASVGENK-------------GVIAQ
A0A2V2SMX4      TLSGLSEEVESLRKELKQSSVQLEAFQGSNSV---VVLDQQG-------------NSAGN
A0A317ZIW7      TYDAIAAKIKSLEDEINQNEDAIVDFQRKNNI---VFIQEQG-------------SAAGT
A0A2D7WMI4      AKQTLEGLLQKEIQKEENIKRQITALKIKRSV---PNLEDIK-------------RDNAT
A0A2D6VHX5      AKGILELLLDKSLMEEDRILKEISDIKESNDI---PFIEDAK-------------KINSS
A0A2D8I214      VRNLLEKLLAQSIEKESQLADEMSAYKKNLGL---PFIEDEK-------------RDTAD
A0A1Z8VL41      ARNLLELLLENRQSEEKRIAQEMSQFKKGKNI---PYLEDAK-------------NSIFA
A0A2E6TNA4      ARNLLELLLENRQSEERRIAQEMSQFKKGKNI---PYLEDAK-------------NSIFA
A0A1Z8RG47      VRNVLEVLLQKSIDEESRISGEMSGYKKNNQL---PFLEDEK-------------KDTAD
A0A1Z8RJJ5      VRNVLEVLLQKSIDEESRISGEMSGYKKNNQL---PFLEDEK-------------KDTAD
A0A2D7V631      VRNVLEVLLQKSIDEESRISGEMSEYKKANQL---PFLEDEK-------------KDTAD
A0A354RA24      VRNVLEVLLQKSIDEESRISGEMSEYKKANQL---PFLEDEK-------------KDTAD
A0A2E9RV62      ARSVLESLLEKSQSREDSILEEMTKYKGEREL---PFVEDER-------------LDNAA
A0A2E4AY96      AIKTLERLLDREMKKEKDIQAKISQYKAEKEA---PFLEDDK-------------KDISA
A0A3B9B9P4      AIKTLERLLDREMKKEKDIQAKISQYKAEKEA---PFLEDDK-------------KDISA
A0A2D5Y6N6      VKNVLQLLLDKSLQEEERISQEQSSFKKKYDL---PFLEDEK-------------QDTSA
A0A2E7HSS8      VKKTLEDLLENSLSKERKIAYDMSEFKKVNQL---PFLEDEK-------------RDTGT
A0A2D8VCK3      VKQTLEDLLDTSLGKEKKIAADMANYKKEHNL---PFLEDEK-------------RDTGD
A0A350QVY4      VKQTLEDLLDTELSKEKKIAADMANYKKDNNL---PFLEDEK-------------RDTGD
A0A2E4ZYR7      AIAFLEEQMTRSRNAETEIDNKVREFKRRHNL---AFIADEK-------------KDVAD
A0A2E6TCV1      SVAFLDIQMAESRKKEDAIIKQINSFKTNHNL---TYIEDDK-------------KDNAE
A0A3D4HHL8      TFLAITEEMMDLQKEIESGEDEKLNFQKENNI---VFIQEQG-------------SSVGA
A0A366HV03      ALKRYNEELGLLKKKIDESLQVKTSFERDNEINELLIKQNSL-------------AQIPL
A0A2V2SDN0      AVASLARQVNQLANELKAQQEKMYAFQMSNNV---VFLQEQG-------------SGAGS
A0A1V6GL40      TVAGLTEQVMRLEKDLRRAEAEMVQFQSTNSM---MLTQEQG-------------NSPAH
A0A2V5X6Z6      TATSLGVEVTQLKGELEAQQEKLHAFQASNNV---VFLQEQG-------------NSAGS
A0A2V5VGZ7      TAASLAAEVTQLKSELEAQQEKLHAFQASNNV---VFLQEQG-------------NSAGS
A0A2V5U130      TATSLGAEVTQLKGELEAQQEKLHAFQASNNV---VFLQEQG-------------NSAGS
A0A2V6C237      TATSLGVEVTQLKGELEAQQEKLHAFQASNNV---VFLQEQG-------------NSAGS
A0A3R8L982      AVSYLNTSADRLRDEANAAEQRLLDYMRRENL----------------------------
A0A2E7HPU9      SSSVLAQKSEEAEKLLN-------------------------------------------
A0A388PR45      LVEKARIEIESLEDKIRRLYEKKNGLVKSGDL----------------------------
A0A388QR61      LVEKARIEIESLEDKVRRLYEKKNGLVKSGEL----------------------------
A0A2A2RS01      LVEKLRSEIDLIEERLRKLSDKRSDLIKTQKL----------------------------
A0A2A2Y1A7      LVEKLRSEIDLIEERLRKLSDKRSDLIKTQKL----------------------------
A0A388PDH9      LVEKLRSEIDLIEERLRKLSDKRSDLIKSQKL----------------------------
A0A2G4H1E7      LVEKARIEIETLEDKVRRLFEQKNDLIKNQKL----------------------------
A0A2G4GZA6      LIEKARIEIETLEDKVRRLYEQKNDLIKSQKL----------------------------
A0A388P514      LIEKARIEIETLEDKVRRLYEQKNDLIKNQKL----------------------------
A0A2A2YG59      LIEKARIEIETLEDKVRRLYEQKNDLIKNQKL----------------------------
A0A2G4F7D5      LIEKARIEIETLEDKVRRLYEQKNDLIKNQKL----------------------------
D5EML0          AVNFLERQVAEMREELELQEVELQDYRQQHNL----VSVQQD-------------KGITA
A0A3C1C1M3      AVAWLEAQALAQRQELEKADQELFDARQTLQM-----------------------DVLAG
A0A2E9EYJ1      ALALLDQQIKSQEGRLEKARXNMIELMEELNIVD--LSLGEP-------------VWLRG
A0A258AXR6      ALEVLQQQISDQEGLRSQAQVRSQEARRKAGIVGDWIVGGGS-------------SLNPG
A0A1T4WVZ9      ALAMLAKQIAEQEQLRDQARLKMQEAKKKGGIVGEWFSSGTN-------------STAPG
A0A3D3NZQ6      ALEMLNKQITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPN-------------STVPG
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      SLARLSTELSDGILQTQLLESRALGLEANGPVGAGVSVGLNGPLLGADSE----------
A0A258AXL1      NTAR--------------------------RLSPEVG--AATPEASTTTI----------
A0A2E6T1E0      EEAA--------------------------RVFHETKQYGTIPEVATDTE----------
A0A2V5U7A0      ------------------------------------------------------------
A0A355VK99      -------------------ASTLADNLKESERKQGL------------------------
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      -----------DLDQNLDRAQNKTEAASGQGSDNQG------------------------
A0A2V6NH44      ------------------------------------------------------------
A0A432FDF6      ------------------------------------------------------------
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ------------------------------------------------------------
A0A3D0IZR7      ------------------------------------------------------------
A0A3R5R793      ------------------------------------------------------------
A0A2N8IV96      QAMDFERREKELASYVQELQRLPDDKLLDYVISSDL------------------------
R7E1V8          QAMQFEKDEKELASYVQELQRLPDDKLLDYVISSDL------------------------
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      ------------------------------------------------------------
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ------------------------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      TLRKIESLRIESQAEYVRQATRLDRLKNLGKELGPEGLA---------------------
A0A3C1UJT2      ------------------------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      ------------------------------------------------------------
A0A2N8IR72      TSQALEKEIFDLETQIKLASTLADNLKESERKHGL-------------------------
A0A410ELH5      TSQALEKEIFDLETQIKLAAILADNLKETERKQGL-------------------------
A0A2E5EJ69      ELESIGKELTVSKNEKLKLDTDWKMIQQYSNNVERL------------------------
A0A1T4WWY4      EMERLSNIPVDIVRAKYRLKEHEEISRILQEQQSSLDVIGKLSLISGFTDEEKDPLEAGR
A0A3D3LEQ6      ELERLSDVPVQQVRVRYKLQEMDGVRQVLKDQGGTLDTVGTLALLTSMTSDKDDPLSVGR
A0A3D3NW23      ELERLSDVPVQQVRVRYKLQEMDGVRQVLKDQGGTLDTVGTLALLTSMTSDKDDPLSVGR
A0A2G4I5Z5      EFKSLSERRSAATDERRDMERDFEMTRRVGGKVSEL------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      KVGLLGNDLAQAQLEQTTLQTLIQLIEDYRKRGQSL------------------------
A0A290QD69      KVTMLGNSLAEAELRQTNLRTLIESVEDYQKNNKNI------------------------
A0A2E7VDS1      RKSQYQGAITLAQVEKLRIQSTLRQIIAIQGRVEQSTRTTKDNEHARTNDEMEKIKEY--
A0A178IFJ2      RMKAISSALTEAQVALLAIEARLQQAESVIAKNSSP------------------------
A0A357FSP9      QLSSLNTIKIENKHLYDNLETRINLIESFRRAGRNL------------------------
A0A2A2R174      EFKALNERRAVATDERRDVERDFEMTRRVGVKVAEL------------------------
A0A1H1SWX2      RLRTVNATLTTARLARLDIETLLSQIEKMQKENPANL-----------------------
A0A290QE54      RLKTVNAALSSARLDRLQLEELNNQIASFKKD-ARNL-----------------------
A0A1H2DTI1      HLAQLNNQLVDRRNEYDLLVKLTAKQGDLQGLPVVAGASNSQQESRMR------------
A0A1V5L462      RLSELKTRLEDYRTQLRILESFDENVSLDQIQDV--------------------------
A0A2A2R3V9      YLINLSKQLDDLNTEFQLLSKLTLDQNIERRSTNTSKPQTTTKNPATTNTAEKRTPDSEE
A0A3D3LGD3      AELRTTGDSMAVTREQAIFQADLDVETLSAEIGQLQTLEGDELVARAGGLKLD-------
A0A350ARX4      YLARLTTQQAELKTQLLILENLKTGDITTSVVEQ--------------------------
B5JIS2          RLKGIDANRIEARLDRFRLETKLGNVKAALGEDGRP------------------------
A0A1H2GQN6      ELEGKQKQLDDARQDAVARRVRYEQLKNL-------------------------------
A0A2A2RPW6      DFKAMAEKLNEAKDEVRLLELEWGMSQKVGNSVDEL------------------------
B4D1I7          YLAKLNTQLAEFKKEAQLLDLFQLDQKIAADESRAGDKDGER------------------
A0A353F286      KLANFETQADQIKIQIGKLVQLTSEELISYAAG---------------------------
A0A354FSA6      KLANFETQADQIKIQIGKLVQLTSEELISYAAG---------------------------
A0A3B9GA54      KLANFETQADQIKIQIGKLVQLTSEELISYAAG---------------------------
A0A2D7B7R6      KNNSDRLVLDNLKLELSRIQNDLEDLESVGYVDAASEKARPDNLTNEQLEIV--------
B1ZT68          KVGTVGTALVRAQMEQVEMRSVLDKIDEYRKEGKDL------------------------
W0J7C2          KMSSLGTAVVAATLDQIDAKSLIDKIEEYQAGNRDL------------------------
A0A2E5K4P7      ELTVLREHLIKKDDVRKAVESRWQQLLAYEAEGRSL------------------------
A0A0R2XPB1      YLAELKRELAELNTENRVLTSILNVDAVKMSLLLDQWQGAEDTSSA--------------
A0A348NQP1      YLAELKRELAELNTENRVLTSILNVDAAKMSLLLDQWQGAEDTSIA--------------
A0A357FV58      YLAELKRELAELNTENRVLTSILNVDAAKMSLLLDQWQGAEDTSIA--------------
A0A2V6F9Q9      YLVKLNQDFARLKTEYELLQKLDLDQNLDRGEKTKTEASPG----ASPTDQAG-------
A0A2V6ME53      YLVKLNQDYARLKTEYELLEKLDLDQNLDRGEKTQTEASPN----PSANDQVG-------
A0A2V6NZZ3      YLVKLNQDYARLKTEYELLEKLDLDQNLDRGEKTQTEASPN----PSANDQVG-------
A0A2V6EBU2      YLVKLNQDYARLKTEYELLEKLDLDQNLDRGEKTQTEASPN----PSANDQVG-------
A0A2V6EY06      YLVKLNQDYARLKTEYELLEKLDLDQNLDRGEKTQTEASPN----PSANDQVG-------
A0A2V6NIJ1      YLVKLNQDYARLKTEYELLEKLDLDQNLDRGEK--TESSPG----ASPTDQVG-------
A0A2V6C292      YLVKLNQDYARLKTEYELLEKLDLDQNLDRGEK--TESSPG----ASPTDQVG-------
A0A2V6D2X0      YLVKLNQDYARLKTEYELLEKLDLDQNLDRGEK--TESSPG----ASPTDQVG-------
A0A2V5ZUK1      YLVKLNQQYAQLKTEYALLNLLDLDQNLDRAQT-KLDS-SS----GQASDNQG-------
A0A2V5XFN9      YLVKLNQQYAQLKTEYALLNLLDLDQNLDRAQN-RTETAAS----NQPVENGG-------
A0A2V6EZC8      YLVKLNQQYAQLKTEYALLNLLDLDQNLDRAQN-RTETAAS----NQPVENGG-------
A0A2V6I7Z5      YLVKLNQQYAQLKTEYALLNLLDLDQNLDRAQN-RTETAAS----NQPVENGG-------
A0A3B9LCP2      YLVKLNREYAGLKTEHDLLSLLDLDQNLDRAQI-KPESLAN----GQTAEDQG-------
A0A3C0R669      YLVKLNREYAGLKTEHDLLSLLDLDQNLDRAQI-KPESLAN----GQTAEDQG-------
A0A2V6EID2      YLVRLNRDYAGLKTEYDLLNLLDLDQNLDRAQN-KSEMNLG----GQSTEDQG-------
A0A2V6MHB0      YLVRLNRDYAGLKTEYDLLNLLDLDQNLDRAQN-KSEMNLG----GQSTEDQG-------
A0A2W5YWL9      YLVKLNQDYARLKTEYELLEKLDLDQNLDRGQS-TAKPEASPSASASEQT--G-------
A0A2V5NH62      YLVRLNQQYAQLKTEYDLLSLLDLDQNLDRAQG-KNDMPSAPNTQSNDDKPPG-------
A0A2W6A620      YLVRLNQQYAQLKTEYDLLSLLDLDQNLDRTSG-KNDGTTPPSTQSTDEKAPG-------
A0A2V5PIJ4      YLVKLNQSFAALKTEYDLLSMLDLDQNLDRKQV-QPDGAGSTNTQPSDDSA-G-------
A0A2V6K2G8      YLVKLNQQYAQLKTEYDLLNLLDLDQNLDRAQN-KMDSAGGAN--PGSDNQ-G-------
A0A2V5W206      YLVKLNQQYAQLKTEYDLLNLLDLDQNLDRAQN-KTEAASG----QGSDNQ-G-------
A0A2V6MW77      YLVKLNQQYAQLKTEYDLLNLLDLDQNLDRAQN-KTEAASG----QGSDNQ-G-------
A0A3C1VFY9      YLSVLYQRLAESKSEYDLLQSMTLDQNLLLEQGRSPALAGAGMPGGLGTGNGILANAALG
A0A2G4GZN8      ERSVLVRDREETRKQIDENEILVLVIASYESEGRPV------------------------
A0A348NPT1      QLSSLNTIKIENKHLYDNLETRINLIESFRRAGRNL------------------------
A0A2E1KV60      ELASLNQIKTAAKMELDQSETRWNLIQDYLRQNKDL------------------------
A0A2D7F4D9      QLASLNEIKTMAKMNLDQAEIRWNLTQDYQKQGKEL------------------------
A0A3R7RBR8      QLASLNEIKTMAKMNLDQAEIRWNLTQDYQKQGKEL------------------------
A0A2E0NH28      QLMTLNAIKSGNKNQFDAQETQWNLIESYRRDGRDL------------------------
A0A350AS32      QLASLNEMKLNAKNVYDMIETKWNLVESYRREQRDL------------------------
A0A368BGT4      QLAHLNEIVLTNKNTYDQFQTKWNQVETYRKEGRNL------------------------
A0A1G3ZL71      QLRRANEARTAARHERLRVENLFRQVEAYRQNGRDL------------------------
A0A2T6DX88      RLKSVNAALQTARLERLSIEEQVNQVASYKREGRDL------------------------
A0A3E1E5C8      RLTTVNDALTKARLARIDLETQYHQVEAYRKEGRNL------------------------
B1ZZ74          RLKTISSTLTSAQLVRLNFENQYALVEAYRKEGRNL------------------------
A0A2E0V4K6      ------------------------------------------------------------
A0A2E6NAH3      QLSHLNEIELTNKNIYDQFQTKWDQIETYRLEGRNL------------------------
A0A2A5VZA5      QLVTLNQIKLESKNNYDQLDTKWNLIETYKREERKL------------------------
A0A424R295      QLVTLNQIKLESKNNYDQLDTKWNLIETYKREERKL------------------------
B4CZV9          DLTKLQMRIDEIGRVRVRLQDPALDSVAKLSLIASADDNDTRLSVGQTVAQPQSGQS---
A0A3B9FM17      RKSQFSSEVTKSRLEQIRINSLLRQILAIKTRIGSNSNSV--------SSKDIKDDIAVI
R7E4L8          RVQEIGTELFSTRTELIQVKVLARLLADRSRQQDMIPAN---------------------
A0A0E3YV65      RMKALSSTVTGARVSRVTIEARLNQAEFIMAGGGDP------------------------
W0J900          RMKAISSALTEAQVARFAINARLQQAESIISKNSDP------------------------
A0A2T6DSN5      KVVQLGQSLVGIELEQTNLRTILETIETYQKNNRDL------------------------
A0A2V2SMX4      YLTALNQRLAGLKSELELLRTMSVEQTLERRQQGGGVLPAPEPVADVNNSASSSLSANDS
A0A317ZIW7      YLADLKRRLAELKTESRTLSSISDS---------------------------SEVEELIL
A0A2D7WMI4      RKSQYQSEITRCNIEQLRLDSTLSQIRSILKRINSNKE-------SSNS---IEERFELF
A0A2D6VHX5      KKSQFQAKITASKLDQIQINSILRQILDIRKRISSNKESSIDSTNTGVD---VESNIAQI
A0A2D8I214      RKSQYSAEVTTSKLEQIKIDSLLRQVLQIQARIGSRNSSS-----RSKD---IDNDIALI
A0A1Z8VL41      RXSQYQSEITRSKXXQXKITTLLKQIINVRVNIGVQNESL-----KSQD---IETDIAMI
A0A2E6TNA4      RKSQYQSEITKSKLEQIKITTLLKQIINVRXNXGXQNESX-----KSQD---XEXDXAXI
A0A1Z8RG47      RKSRYQAEITKCKLEQIRINSLLRQILQIQMRIGNETSSL-----QSAD---VAGDIAVI
A0A1Z8RJJ5      RKSRYQAEITKCKLEQIRINSLLRQILQIQMRIGNETSSL-----QSAD---VAGDIAVI
A0A2D7V631      RKSQYQAEITRCKLEQIRINSLLRQILQIQMRIGAQTSSL-----KSDD---VEGDIAVI
A0A354RA24      RKSQYQAEITRCKLEQIRINSLLRQILQIQMRIGAQTSSL-----KSDD---VEGDIAVI
A0A2E9RV62      RKSSYHSEITKAKVEKVRINSLLRQIIQIQASISSRIQND-----GASKD--VNANIDAI
A0A2E4AY96      KKSQYQAEITRCRIERLRIESLKSQVLAVDNKI----KSR-----KVES---IEERYALF
A0A3B9B9P4      KKSQYQAEITRCRIERLRIESLKSQVLAVDNKI----KSR-----KVES---IEERYALF
A0A2D5Y6N6      RKSQYQSEITSSKLEQIRINSLLRQILQIQVRIGSQSEST-----SSQD---IDDDIAVI
A0A2E7HSS8      RKSQYSEEVTKSRLEQIRINSLLRQILAIKTRIGSGSDSV-----SSKD---VNDDIAVI
A0A2D8VCK3      RKSQFSSEVTKSRLEQIRINSLLRQILAIKTRIGSNSNSV-----SSKD---IKDDIAVI
A0A350QVY4      RKSQFSSEVTKSRLEQIRINSLLRQILAIKTRIGSSTNSV-----SSKD---IKDDIAVI
A0A2E4ZYR7      RKSQYQSAITQAQVEKLKIQSTLRQIIAIQGRVERATNAV-----KDNEHARANAETDKI
A0A2E6TCV1      RKSQYQNAITTADVKLLEIDSHLVSIRGIHNKVVQSLKAL-----TATGPARTTAKIKII
A0A3D4HHL8      YLAELNQQLAELETQYRFLDTLSLD------------------AIGERAQAVAELAKAKR
A0A366HV03      DILRVQHRMRQYDEVRGIVQSRSQNSVIAPLEHLS--------LLESAKKSSLDENPVGQ
A0A2V2SDN0      YLALLNRQLATLRTELQLLQLVQPDQWVEIGSRTRPSGPGEPPAGEASPQDIMAGLTG--
A0A1V6GL40      YLTTLYQRLVTLKSEYALLQRLTLDQNLARRQAAGGTFSLGNEPLAEGNDSLPDTNAVAL
A0A2V5X6Z6      YLASLNKQLATLRTELRLLQSLQPEQ-----------------WIETGHKGVPSG-----
A0A2V5VGZ7      YLASLNKQLATLRTELRLLQSLQPEQ-----------------WIEAGHKVVPSSESLPD
A0A2V5U130      YLASLNKQLATLRTELRLLQSLQPEQ-----------------WIETGHKGVPAGESLPD
A0A2V6C237      YLASLNKQLATLRTELRLLQSLQPEQ-----------------WIETGHKGVPSGESLPD
A0A3R8L982      --VSLDNSTNIVRERLTSVNAALQ----------------------TARLERLAIENLNN
A0A2E7HPU9      ----------------------------------------------QKENALANYQIILL
A0A388PR45      --LDIAGTTNSIAAQRSKLIQDRE----------------------DYRKQLDEIGIVVA
A0A388QR61      --LDIAGTTNSIAAQRAKLIQDRE----------------------EYRKQVDEVGIVVA
A0A2A2RS01      --LSIAKDTTTLNTERGVLVRNRE----------------------DARKQIDELEIIWK
A0A2A2Y1A7      --LSIAKDTTTLNTERGVLVRNRE----------------------DARKQIDELEIIWK
A0A388PDH9      --LSIAKDTTTLNTERGVLVRNRE----------------------DARKQIDELEIIWK
A0A2G4H1E7      --LSIAKDTNTLTAERSVLVRDRE----------------------ETRKQIDENEILVL
A0A2G4GZA6      --LSIAKDTNTLTTERSVLVKDRE----------------------ETRKQIDENEILVS
A0A388P514      --LSIAKDTNTLTTERSVLVKDRE----------------------ETRKQIDENEILVS
A0A2A2YG59      --LSIAKDTNTLTTERSVLVKDRE----------------------ETRKQIDENEILVS
A0A2G4F7D5      --LSIAKDTNTLTTERSVLVKDRE----------------------ETRKQIDENEILVS
D5EML0          DRLARLNDAL----------TDAEIRQLS--------------VETRQRQIAAADGVI--
A0A3C1C1M3      RRKTIEESLLHFNESLSEVEAKASMEQ-------------------KMLDALSEGKLP--
A0A2E9EYJ1      SQPNTGTASLVMAAKQREFAAEEAIQNLR--------------STIKSLTQLEGAELI--
A0A258AXR6      GEMRSEKDSMVISREQALMIADQEILTLQ--------------SEIDQVSKLTPDELI--
A0A1T4WVZ9      ANLRTTEDSMVVTREQALLNTELEVQALQ--------------AEIAELSKLSDEELV--
A0A3D3NZQ6      AELRTTGDSMAVTREQAIFQADLDVETLS--------------AEIGQLQTLEGDELV--
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      ----------------IPS---TGTSERQGASRDLELLKL-------------QRERLSK
A0A258AXL1      ----------------VTPQVAKRANEWEYIEGQLHSSER-------------EYERLSN
A0A2E6T1E0      ----------------VRK-----------IRGDLALAEA-------------ELAELLK
A0A2V5U7A0      ------------------------------------------------------------
A0A355VK99      ----------------ISVETGLPDSGIARQIEHYNEAYL-------------EYQKIAG
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      ----------------MPFSDVGPEGDYLKAKQQIQLLKA-------------ERETLAK
A0A2V6NH44      -----------------PFSDVGPEGDYLKAKQQVQLLKA-------------ERDTLSQ
A0A432FDF6      -----------------------------------------------------TLANHGI
A0A353DCA1      ------------------------------------------------------------
A0A3C1AXQ2      ---------------------------------------------------------VNS
A0A3D0IZR7      ------------------------------------------------------------
A0A3R5R793      ------------------------------------------------------------
A0A2N8IV96      ----------------LNAETVGADALRKTYAEFSDKLKE-------------KENLKSQ
R7E1V8          ----------------LNAESVGAKALRETYAEFSDKLKE-------------KENLKAQ
A0A356FSV4      ------------------------------------------------------------
A0A3D3DET9      -----------------------------------MLLRV-------------EQQELGR
A0A355SVK9      ------------------------------------------------------------
A0A2E5D7I3      ------------------------------------------------------------
A0A2V5NYE2      ------------------------------------------------------------
A0A2V6FIP7      ----------------DAIPLVAGNPLIQDMRKSLAEREA-------------LLANLLK
A0A353DI77      -------------------------------EKEMAVAEK-------------AVQDLSI
A0A1V6GCZ3      ----------------QAITTDAPDTLLTSLLDQLTMAEQ-------------RLIALEA
A0A3C1UJT2      ----------------SLIPSVAKNEDFKSINGLYKAAKT-------------TVRNLEV
A0A2S7U0Z3      -------------------------------SEQIQEKRN-------------QVIILRQ
A0A2E0R252      -------------------------------SDEIRGSET-------------AIAQMEK
A0A3E1EF48      -------------------------------SKRIETTRI-------------AIIEMEK
A0A2A2PVG8      -------------------------------SKEIDEAER-------------QVAEMEK
A0A2E0R421      -------------------------------ITEIKLVES-------------RIAGMEK
A0A2N8IR72      ----------------ISVETGLPDSGIARQIEHYNEAYL-------------EYQKIAG
A0A410ELH5      ----------------ISVETGLPDSGIARQIEHYNEAYL-------------EYQKIAG
A0A2E5EJ69      ----------------LTVQSILDDKQVSALRTQELEKRS-------------EISQLEE
A0A1T4WWY4      VVRKGG---AVAPFTFSSPSTDKKFTQVVVQPNMVDGLKSWQELERTKRATEEKLRLIQT
A0A3D3LEQ6      IVRRTGDPRTSAPATFQTPEMAKEYNQIVVQPDMVEGIEPWRELDKKKRSLEEKMAQSRA
A0A3D3NW23      IVRRTGDPRTSAPATFQTPEMAKEYNQIVVQPDMVEGIEPWRELDKKKRSLEEKMAQSRA
A0A2G4I5Z5      ----------------LILASISRAPEVAALKEKLQVQEA-------------TLANHQL
A0A2E7ALI1      --------------------------------HKLLELEA------------IKVSDLAR
A0A178IDB9      ----------------YEISAIIGFGNVASLKTQYENILA-------------ERTALAE
A0A290QD69      ----------------LEISDIASYGNVSEMKTRIDTLRA-------------ERRQLDE
A0A2E7VDS1      ----------------FEISAVETYGNVQALRQKLLDLET-------------TRKAFEV
A0A178IFJ2      ----------------LELASITEFSSLASVQSQLDELVA-------------RKAVMAE
A0A357FSP9      ----------------SELPFIAEQGQVSQLLSQISAIKI-------------GISSSSK
A0A2A2R174      ----------------LTLSTVSRVPEVVALKEKLQAQEA-------------VLVNHQL
A0A1H1SWX2      ----------------LEIGYISAYGNIPVLKNNLAELNK-------------QQAILSE
A0A290QE54      ----------------LEIAAISNHGTIPAVSSQLSELTR-------------QQSVLAQ
A0A1H2DTI1      ----------------LAAATTEFFKAQQKAQERITELET-------------QMKEEEE
A0A1V5L462      ----------------VNLDTIESSQNYRNTKRQHQQLLA-------------MKEQFGI
A0A2A2R3V9      IKA-------------AAGDLLSPESEYRNSNQQIQLLLL-------------QRDELSQ
A0A3D3LGD3      ------------------------NANVAQMTGELQRLEV------------AREGLVNQ
A0A350ARX4      ----------------SPLIEAESVALLNKTQQEWTQLKA-------------QLEEYSL
B5JIS2          ----------------FDNPFLANFANNERLRQELDKLNG-------------QREVMAL
A0A1H2GQN6      ----------------STEDLIDTLPSLGLNDANIDQIRQ-----QELQGSANIQSLLKG
A0A2A2RPW6      ----------------LKLPMISRSPEVAALKEKLQSHEA-------------ALSNLQL
B4D1I7          ----------------NPRLTGQPEMEYTHARQQIEVLKS-------------ERAEYAK
A0A353F286      ----------------LDLPQNQVTAYALQNRSAVDRMLD----------------LEAQ
A0A354FSA6      ----------------LDLPQNQVTAYALQNRSAVDRMLD----------------LEAQ
A0A3B9GA54      ----------------LDLPQNQVTAYALQNRSAVDRMLD----------------LEAQ
A0A2D7B7R6      ----------------SLIPSVAKNEDFKSINGLYKAAKT-------------TVRNLEV
B1ZT68          ----------------FEIPAILGYGQVSALRTRYAELQA-------------QRKLLGE
W0J7C2          ----------------LEITQIRTSGQVADLNNSLISLLT-------------QRTLLAE
A0A2E5K4P7      ----------------LDLGFISNTTHVATLVARNSLKKE-------------ELGLLAA
A0A0R2XPB1      ----------------TTGGSAGDNQSYQLSKKQLQVLHA-------------QLDEFSI
A0A348NQP1      ----------------ASGGSDGDDQSYQYSKKQLQVLHG-------------QLDEFSI
A0A357FV58      ----------------ASGGSDGDDQSYQYSKKQLQVLHG-------------QLDEFSI
A0A2V6F9Q9      ----------------MPFSDVGPEGDYLKAKQQVQLLKA-------------ERDTLSQ
A0A2V6ME53      ----------------MPFSDVGPEGDYLKAKQQVQLLKA-------------ERDTLSQ
A0A2V6NZZ3      ----------------MPFSDVGPEGDYLKAKQQVQLLKA-------------ERDTLSQ
A0A2V6EBU2      ----------------MPFSDVGPEGDYLKAKQQVQLLKA-------------ERDTLSQ
A0A2V6EY06      ----------------MPFSDVGPEGDYLKAKQQVQLLKA-------------ERDTLSQ
A0A2V6NIJ1      ----------------MPFSDVGPEGDYLKAKQQVQLLKA-------------ERDTLSL
A0A2V6C292      ----------------MPFSDVGPEGDYLKAKQQVQLLKA-------------ERDTLSQ
A0A2V6D2X0      ----------------MPFSDVGPEGDYLKAKQQVQLLKA-------------ERDTLSQ
A0A2V5ZUK1      ----------------LPFADVGPEADYLKAKQQAQMLKA-------------ERDTLAK
A0A2V5XFN9      ----------------LPFSDVGPEADYLKAKQQVQLLKA-------------ERDTRAK
A0A2V6EZC8      ----------------LPFSDVGPEADYLKAKQQVQLLKA-------------ERDTLAK
A0A2V6I7Z5      ----------------LPFSDVGPEADYLKAKQQVQLLKA-------------ERDTLAK
A0A3B9LCP2      ----------------LPFAGVGPEGDYLKAKQQLQLLKA-------------ERDTLAK
A0A3C0R669      ----------------LPFAGVGPEGDYLKAKQQLQLLKA-------------ERDTLAK
A0A2V6EID2      ----------------MPFSGVGPEGEYLKAKQAVQLLKA-------------ERDTLAK
A0A2V6MHB0      ----------------MPFSGVGPEGEYLKAKQAVQLLKA-------------ERDTLAK
A0A2W5YWL9      ----------------MPFSDVGPEGDYLKAKQTVQLLKA-------------ERDTLAK
A0A2V5NH62      ----------------MAFSDVGPEGDYLKAKQALQLLKA-------------ERETLSK
A0A2W6A620      ----------------MAFSDVGPEADYLKAKQTLQLLKA-------------ERETLSK
A0A2V5PIJ4      ----------------MAFTDRGPEGDYLKAKQALQVVKA-------------ERDTLAK
A0A2V6K2G8      ----------------LPFSDVGPEGDYLKAKQQVQLLKA-------------ERDTLAK
A0A2V5W206      ----------------MPFSDVGPEGDYLKAKQQIQLLKA-------------ERETLAK
A0A2V6MW77      ----------------MPFSDVGPEGDYLKAKQQIQLLKA-------------ERETLAK
A0A3C1VFY9      GQS-------------TLFAPSTMGMQYLSIKQQILLLKA-------------EQDRFGE
A0A2G4GZN8      ----------------GDIPQIRADNDVAAAQTAISGSKI-------------RVSQMTE
A0A348NPT1      ----------------SELPFIAEQGQVSQLLSQISAIKI-------------GISSSSK
A0A2E1KV60      ----------------WELPFISQQIRVASLTEQISNIRI-------------AMSTMSK
A0A2D7F4D9      ----------------WELPFISEQIRVATLIEQISAIRI-------------AISTKSK
A0A3R7RBR8      ----------------WELPFISEQIRVATLIEQISAIRI-------------AISTKSK
A0A2E0NH28      ----------------WELSFIADQSRVAFMLQEVSKTKI-------------EISSLGK
A0A350AS32      ----------------WELSFISEQSRVASLLESISQAKI-------------QISSLSK
A0A368BGT4      ----------------WELAFVAEQLRVSSLLQQISSTRI-------------SISSASK
A0A1G3ZL71      ----------------LELSEITGYGNIPALRNQLSELLQ-------------TQKVLSD
A0A2T6DX88      ----------------LQISSIANHGTIPAIRTQLADLQR-------------QQSVLSE
A0A3E1E5C8      ----------------MEIAYIAGHATVPTLKNQLSNLHQ-------------NQSVLGE
B1ZZ74          ----------------VEIQFIAGHGTVPTLSAQLSSLLQ-------------SQSVLAE
A0A2E0V4K6      -------------------------------HAALEVEEV-------------KVADLAR
A0A2E6NAH3      ----------------WELPFVAEQSRVASLLQQVSSTRI-------------EISSLGK
A0A2A5VZA5      ----------------WQLTFVAEQSRVSRLLESISATRI-------------EISSYSK
A0A424R295      ----------------WQLTFVAEQSRVSRLLESISATRI-------------EISSYSK
B4CZV9          ----------------ADKKDAAANNSVVVVPSLLKSLHPWDELAQQQQQVKKEISEGLR
A0A3B9FM17      KEF-------------FEIDAIEQFGNIPALRQTLYDLEK----------TRRDYEETGS
R7E4L8          ----------------IGIQDAGIAKQIELFNDNFLQHKK-----------------LFA
A0A0E3YV65      ----------------LELAAATEFANLSAVQSQLDTLRT-------------QRATMGE
W0J900          ----------------LELASVTEFSSLASVQSQLDGLIA-------------KKAVMSE
A0A2T6DSN5      ----------------MEIPQIASFGGVGALRGELENLKA-------------ERRMLSE
A0A2V2SMX4      ----------------SQNDYFKAKQQIALMEA--------------------QKQDWSE
A0A317ZIW7      KDVPTPDDGSSDGTIVSAIGSKEDNEKYTEAKNQLDQLKA-------------DLEEFEI
A0A2D7WMI4      SEI-------------FKIDEIENFANIPALRSSLFELYK----------QRRDYQEVGT
A0A2D6VHX5      KQY-------------FEIDVIEGFGSIPSLRQELLEHEL----------QRKTYVETGT
A0A2D8I214      KDF-------------FEIDAIESFGNVPSLRKTLFDLEK----------TRMRYQEGSP
A0A1Z8VL41      KEF-------------FEIDAIESYGSVPALRKNLFDLEK----------TRRDYQELEP
A0A2E6TNA4      KEX-------------FXIDAIESYGXVPAXRKNLFDLEK----------TRRDYQELEP
A0A1Z8RG47      KEF-------------FELDAIESYGNIPSLRQTLYNLEL----------TRKNYQETGT
A0A1Z8RJJ5      KEF-------------FELDAIESYGNIPSLRQTLYNLEL----------TRKNYQETGT
A0A2D7V631      KEF-------------FELDAIETYGSIPSLRKTLYDLET----------TRKNYQETGT
A0A354RA24      KEF-------------FELDAIETYGSIPSLRKTLYDLET----------TRKNYQETGT
A0A2E9RV62      KEY-------------FKIDAIESFGNVPALQKRLFDLEQ----------SHKLY---GQ
A0A2E4AY96      GEF-------------FKIKEINQFGRIAFLREDLQKLYS----------TRKNYQEVGT
A0A3B9B9P4      GEF-------------FKIKEINQFGRIAFLREDLQKLYS----------TRKNYQEVGT
A0A2D5Y6N6      KEF-------------FEIDAIESYGSIPSLRQNLYDLES----------KRRDYQETGS
A0A2E7HSS8      KEF-------------FEIDAIEEYGNIPSLRQTLYNLEK----------TRRDYEETGS
A0A2D8VCK3      KEF-------------FEIDAIEQFGNIPALRQTLYDLEK----------TRRDYEETGS
A0A350QVY4      KEF-------------FEIDAIEQFGNIPALRQTLYDLEK----------TRRDYEETGS
A0A2E4ZYR7      KEY-------------FEISAIEGYGNVQTLRQKLLDLET----------IRKEHE---V
A0A2E6TCV1      EDF-------------FKISAIAEYGNVNSLRTELQEHEK----------TRKTYE---A
A0A3D4HHL8      KNNTEVVPAENHSGAALTSELYKLSEQYLVAKKELNLLKA-------------QRDEYLT
A0A366HV03      LVVPASGDLKDALLVPSNSPAPLAAPSIVVQPSMVEGLNSWQMLERDKRKVETEIAEASR
A0A2V2SDN0      ----------------PQSDLFRANQQIRLLKD--------------------KRDELSK
A0A1V6GL40      TAGGTPGQSSTAAGDRGDTAYLQAQQQLLLLRV--------------------EQQELGR
A0A2V5X6Z6      -----EMLASLAE---PQLELFKANQQMQLLKA--------------------KRDELSR
A0A2V5VGZ7      QATEKEMLASLAE---PQLELFKANQQMQLLKA--------------------KRDELSR
A0A2V5U130      PATEKEMLASLAE---PQLELFKANQQMQLLKA--------------------KRDELSR
A0A2V6C237      QAAEKEMLASLAE---PQLELFKANQQMQLLKA--------------------KRDELSR
A0A3R8L982      QVEAFRKDNKDL----IELNIISTYGTVPALRAQLAEHLR-------------TQAVLSE
A0A2E7HPU9      TLEDLEKREATF----SELDL---------------------------------------
A0A388PR45      LVAQYRAAGRDL----SEIPLVRSDADVAAARAKMTDAQT-------------RVRAMEE
A0A388QR61      LVKQYRVAGRDL----AEIPLVRADVEVTNTRNKVAEETA-------------KTRAMEE
A0A2A2RS01      LILEYKTAGKDA----YDIAQVRTDERVAALGPKVTELRV-------------LVSTMEK
A0A2A2Y1A7      LILEYKTAGKDA----YDIAQVRTDERVAALGPKVTELRV-------------LVSTMEK
A0A388PDH9      LILEYKKATKDV----YDIAQVRTDERVAALGPKVTELRV-------------LVSTMEK
A0A2G4H1E7      VIASYEQEGRSL----GDIPQIRADTDVATTLTALSASKI-------------RMSQMTE
A0A2G4GZA6      VIASYEKESRPL----GDIPQIRADTDVAAVQMVISASKI-------------RVSQMTE
A0A388P514      VIASYEKEGRPL----GDIPQIRADSDVAATQTAISASKI-------------RVSQMIE
A0A2A2YG59      VIASYEKEGRPL----GDIPQIRADSDVAATQTAISASKI-------------RVSQMIE
A0A2G4F7D5      VIASYEKEGRPL----GDIPQIRADSDVAATQTAISASKI-------------RVSQMIE
D5EML0          ---------DRL----MEIPYIGERDAVNAVYAQLSELKR------------ERL-VLDE
A0A3C1C1M3      ---------AEI----PG------AADVAASLDRWRQAMT------------ERDALLSR
A0A2E9EYJ1      ---------KSA----VDLGV--KNETLNSGWSEYQTLEL------------SRAALIXS
A0A258AXR6      ---------DQA----SGLRL--ENQNITAITVKLQDLKV------------AREGLVNE
A0A1T4WVZ9      ---------ARS----SGLKL--ENANVTNMLAELTRLQV------------TREGLVNA
A0A3D3NZQ6      ---------ARA----GGLKL--DNANVAQMTGELQRLEV------------AREGLVNQ
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      FLRPKHPKIAQLDTQIQRAEKLIELFRNQSREQIAAAQ--QVLKLKMNGIQTSIKE----
A0A258AXL1      SLLPGHEKMRELRKQIENYQFSLDAEWKKQIASFHLEK--EHLQQRLESLQDKLPE----
A0A2E6T1E0      RYLDKHPKVIEKRGKIESLIEGLASSQKRIFDSIINKA--ELAKATALNLKGVLEI----
A0A2V5U7A0      ------------------------------------------------------------
A0A355VK99      SAGSQNPITVSLKDRMNSTRAAANKALSNYRSNLDLKL--NQLIDKRNSLTERLTE----
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      DLRPNHPKILKLNDEITKQDKLIQLFRADALEKLKTRR--ESIGKQMENLQANIKE----
A0A2V6NH44      DLRPKHPKIIKLNDEISKQEKLIELFRSDAFEKLETRR--KSIGKQMENLQGNIKE----
A0A432FDF6      DLGEEHPRIKGLKKVVATLEGQIDNRIKGILAGLGLRV--NSSQAQVEQLQRDVDA----
A0A353DCA1      ------------------MKQMV-------------------------------RE----
A0A3C1AXQ2      GRGREHPEVEGVDSQILLSKQLILDAVKSHLSALQTRM--DFAIKRRASLQNSNED----
A0A3D0IZR7      ------------------------------------------------------------
A0A3R5R793      --------------------------MIGLRSSLKSKL--EMVAASRKHWEATVAQ----
A0A2N8IV96      NIGARHPKMLALLETERILGDKLNKELIGLRSSLKSKL--EMVAASRKHWEATVAQ----
R7E1V8          NIGARHPKMLALLETERILGEKLNKELIGLRSSLKSKL--EMVSASRKHWEATVAQ----
A0A356FSV4      --------MIQLLQRLQESEIELTEAVTNSTDKIYAAY--IEAKRNFEVSSQRLAE----
A0A3D3DET9      YLRPNHPKMIAMQEDIARREELLKILRTQSEEQLKNRK--ELLAVEIEILEKDLKA----
A0A355SVK9      -----EVELVSAVEN--------------SVGKVDSAY--AEAKTNFELASRRLAE----
A0A2E5D7I3      ------------------------------------------------VELKEVQS----
A0A2V5NYE2      -----HPKIIAATEEIAHLERLLPIYREQSNEQLTNKL--NSLDMQIKNRRKDIKE----
A0A2V6FIP7      RYKDKYPDVIRVREEIASLKESIQKESQKVRQAIRAEA--ELAKAKETTMASELKK----
A0A353DI77      RYGPKHPKIISATDHIDLKTKILLSAMMDVLSNDLETDYWRGFQDQIDDVKNEENF----
A0A1V6GCZ3      DYGPENTEVLKCKGLAEDLHKKIKSRVEGIMLGLDTRV--LSLSNSLVNLQQEVGR----
A0A3C1UJT2      DLKSKHPLMIDALRNVNNTRRVLLETISDVPKGLYAQI--KYQQEFIEELTQSIEN----
A0A2S7U0Z3      RYLPKHPARIQEEALYTDLLESFGGAIKRSSGKPSEKSYWLEYKDEMDALEKIIDGDGPD
A0A2E0R252      RYLPKWPALVEAKELGAILKKNFSKELDQVIRLSDEEK--AFWEQHSESFSSMDAD----
A0A3E1EF48      RYLPKWPDLIEAKELLALLLNRFSTELAQVIAGSAEEQ--RFWKENASVLAGLEGE----
A0A2A2PVG8      RYLPKWPALVEAKELLKILQDRFVQEFNQVMNLSEEER--KYWETSLASLQGAPME----
A0A2E0R421      RYLPKWPALVESKEHSKILKQRFSAELERVLRLSEEER--QFWEDAGTSIADVEGE----
A0A2N8IR72      SAGSQNPIAVSLRDRMNSTRAAANKALSNYRSNLDLKL--NQLIDKRNSLTERLTE----
A0A410ELH5      SAGSQNPITVSLRDRMNSTRAAANKALSNYRSNLNLKL--NQLISKRDSLTERLTE----
A0A2E5EJ69      RYREKHPKMIAARKEVVDLGARLQEAILAAPSKVHTTI--LTLSSQIDSQQGRLEA----
A0A1T4WWY4      KFLDDHPEVIKLKDELKQVESALDIELKVALTSFDLEK--ARLTEKLEELDGKLPE----
A0A3D3LEQ6      KFLDDHPEMIKLREELRETVSALELELQVARRAFDLEY--EKLKEQLVELEAKLPD----
A0A3D3NW23      KFLDDHPEMIKLREELRETVSALELELQVARRAFDLEY--EKLKEQLVELEAKLPD----
A0A2G4I5Z5      RYREKHPEMIKAKTELESIRQQFEVEVLKAPLRLNQQL--QAAIDKEKGLELAVKE----
A0A2E7ALI1      RYRAKHPKMISTVAKLEDSRKKFMSEFLVAASSAADKS--YWEGAGAELQQIANDE----
A0A178IDB9      RYLEEHPRMRQNALALADTRARLDAAVDLAIAETHARL--NLARQHEQRLRSEYAA----
A0A290QD69      RYLSEHPRMKQNQLAMEDAEAGFKSAVDLAIAELKNRF--NFAKQHELRLRTDYAE----
A0A2E7VDS1      KYLEKHPKMSANTRAVQELHRLLRLEVKTAIKDLTNRV--SEMASQESEFTKAMDA----
A0A178IFJ2      KYGRRHPAMIDQERSIQALEKLRGDLILTAVANLRNQR--EKALENERQLQRQLAD----
A0A357FSP9      RYREKHPVMIEQQQTLQESEVELAAAVKDSVDKLSSAL--VEAKSNFELASQRLAE----
A0A2A2R174      RYKEKHPEMIKARAELESIRQQFEAEVLKAPLRLGLQL--QAAIEKEKGLEAAFKE----
A0A1H1SWX2      RYLERHPKMIELANSIDVVTAQITRNIEQSISDLRTQY--VKLQDTEASYIKEYQA----
A0A290QE54      RYFERHPKMIELEKSIKAAREQLTRATDLAIADLHASL--EKSRANEKSLEQEYAL----
A0A1H2DTI1      YLRPAHPKRVALAAQIADLKRSITLSKEQNIEEANVRR--ETLALEIQHLEAMVKE----
A0A1V5L462      YLKPKHPRMMDIEAELEILSNRIRIFRAQAFGQIEEEK--SALRNRIDTLLPEINK----
A0A2A2R3V9      YLKPKHPKIIALNAEIQRQQTLLDMFKKQSIEQLNNRR--EGLRLQIQNLQELIKS----
A0A3D3LGD3      GRGRRHPEVLANDSQITKYKELIAAAAKDHLAGLQNRL--ESARKRKEALEASNQD----
A0A350ARX4      YLKPKHPKIIDLELNIERATNLIDILERQTTDSLDDRK--DQLRRQIQNLDAVIAQ----
B5JIS2          RYGRNHPKMRDLDSRIEAVEGNLNRNMEMALKDLEGQY--TNVVSLEKRLDDDFRK----
A0A1H2GQN6      GFGEEHPRVQSLRAAVGRAQEQLKSLAEGKRRALLIDL--NVSEEKLKLLEADVAS---L
A0A2A2RPW6      RYKDKHPTMIQARNELSTLKAQFEVEIRRAPERLKLMR--EGAMAKEKKLEQELRE----
B4D1I7          DLRSKHPIMVELDRQIAQQQQLIDAFRKQSAEDLQHRR--EATRLEIENLEKTIKE----
A0A353F286      GIGKKHPDMVTMKQRAEGALAKAHEEVISLKEVLKTKL--DLVEQQVLKMREMVDA----
A0A354FSA6      GIGKKHPDMVTMKQRAEGALAKAHEEVISLKEVLKTKL--DLVEQQVLKMREMVDA----
A0A3B9GA54      GIGKKHPDMVTMKQRADGALEKAHEEVISLKEVLKTKL--DLVEQQVLKMREMVDA----
A0A2D7B7R6      DLKSKHPLMIDALRNVNNTRRVLLETISDVPKGLYAQI--KYQQEFIEELTQSIEN----
B1ZT68          KYLRLHPKMTQNELETTETKRLLDEAAAQAIANLETRN--RIAAQHEIRLRAELEQ----
W0J7C2          HYLGEHPKMKQNEAETRETRRMLAESIAKAVADLRARY--DVSAHYLQRLQAETTG----
A0A2E5K4P7      RYRSKHPKMLQALQAQALVKKELDNAILMARNKAEAEH--LLATVHYKEAQRDVAI----
A0A0R2XPB1      YLQPKHPKIIGLKNQIERTENQLEIQRDQTLRRIRERQ--SVLNNTAANLTLEIAI----
A0A348NQP1      YLQPKHPKIIGLKNQIERTENQLEIQREQTLTRIRERQ--SVLNNTAANLSLEIAI----
A0A357FV58      YLQPKHPKIIGLKNQIERTENQLEIQREQTLTRIRERQ--SVLNNTAANLSLEIAI----
A0A2V6F9Q9      DLRPRHPKIIKLNDEISKQEKLIAVFRADAVEKLETRR--KSIGKQMENLQSNIKE----
A0A2V6ME53      DLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETRR--KSIGKQMENLRGNIKE----
A0A2V6NZZ3      DLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETRR--KSIGKQMENLQGNIKE----
A0A2V6EBU2      DLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETRR--KSIGKQMENLRGNIKE----
A0A2V6EY06      DLRPKHPKIIKLNDEISKQEKLIDLFRSDAVEKLETRR--KSIGKQMENLQGNIKE----
A0A2V6NIJ1      DLRPKHPKIIKLNDEISKQEKLIELFRSDAVEKLETRR--KSIGKQMENLQGNIKE----
A0A2V6C292      DLRPKHPKIIKLNDEISKQEKLIELFRSDAVEKLETRR--KSIGKQMENLQGNVKE----
A0A2V6D2X0      DLRPKHPKIIKLNDEISKQEKLIELFRSDAVEKLETRR--KSIGKQMENLQGNVKE----
A0A2V5ZUK1      DLRPNHPKILKLNDEVAKQDKLIELFRADTLERLKTRR--ESIGKQMENLQGNIKE----
A0A2V5XFN9      DLRPNHPKIIKLNDEITKQDKLIELFRADTLEKLKTRR--ESIGKQMENLQANVKE----
A0A2V6EZC8      DLRPNHPKIIKLNDEITKQDKLIELFRADTLEKLKTRR--ESIGKQMENLQANVKE----
A0A2V6I7Z5      DLRPNHPKIIKLNDEITKQDKLIELFRADTLEKLKTRR--ESIGKQMENLQANVKE----
A0A3B9LCP2      DLRPKHPKIVKLNDEISKQEKLIDLFRADTVEKLETRR--KSIGKQMENLRANIKE----
A0A3C0R669      DLRPKHPKIVKLNDEISKQEKLIDLFRADTVEKLETRR--KSIGKQMENLRANIKE----
A0A2V6EID2      DLRPKHPKILKLNDEISKQEKLIDLFRADTVEKLETRR--KSIGKQMENLQANIKE----
A0A2V6MHB0      DLRPKHPKILKLNDEISKQEKLIDLFRADTVEKLETRR--KSIGKQMENLQANIKE----
A0A2W5YWL9      DLRPKHPKILKLNDEITKQEKLIQLFRSDAVEKLETRR--KSIGKQMENLLGNIKE----
A0A2V5NH62      DLRPKHPKIIKLNDEVTKQEKLIELYRQDTVEKLDTRR--KSIGKQMENLQTNIKE----
A0A2W6A620      DLRPKHPKIIKINDEITKQEKLIELYRQDTVEKLETRR--KSIGKQMENLQTNIKE----
A0A2V5PIJ4      DLRPRHPKILKLNDEIAKQENLIKLFREDSIEKLDTRR--KSIGVQMENLEKSIAE----
A0A2V6K2G8      DLRPNHPKIIKLKDEISKQEKLIELFRADTLEKLKTRR--ESIGKQMENLQTNVKE----
A0A2V5W206      DLRPSHPKILKLNDEITKQDKLIQLFRADALEKLKTRR--ESIGKQMENLQANIKE----
A0A2V6MW77      DLRPNHPKILKLNDEITKQDKLIQLFRADTLEKLKTRR--ESIGKQMENLQANIKE----
A0A3C1VFY9      FLKPKHPKMVAMNEESEKMGRLLGIYRDQSVEQLEAKK--SALALQIKNLENQTKQ----
A0A2G4GZN8      TYTDQHPKLVAEREALKQLERQLKEATTQAIKSRRSSL--DNAKARHEAILRNLLA----
A0A348NPT1      RYREKHPVMIEQQQTLQESEVELAAAVKDSVDKLSSAL--VEAKSNFELASQRLAE----
A0A2E1KV60      RYREKHPEMRSLLQQLQESQSELDYAVQNAVDNLNASF--KEAKDNFAQASKRLVE----
A0A2D7F4D9      RYREKHPEMRSLLQQLQESQSELEYAVQNAVDNISGYF--AESRDNFKQASKRLLE----
A0A3R7RBR8      RYREKHPEMRSLLQQLQESQSELEYAVQNAVDNISGYF--AESRDNFKQASKRLLE----
A0A2E0NH28      RYRSKHPVMIQLLQRLQESEIELTEAVTNSTDKIYAAY--IEAKRNFEVSSQRLAE----
A0A350AS32      RYREKHPVMIQLLQQLQESEAELSSAVQNAVNKLDSSF--SESKSNYEVASQRLAE----
A0A368BGT4      RYREKHPAMIELLQTLQEGELELELAVQNSVDKIYAGY--SESKSNFEMASLRLAE----
A0A1G3ZL71      RYLERHPRMIELARQIATVRADLEKSIQLAVADLSASL--EKARDGEQTFEKEYAQ----
A0A2T6DX88      RYFERHPKMMDLARAIKVSQDQLASAIDLAIADLQASL--EKARANEKSLEQEYQL----
A0A3E1E5C8      RYLERHPKMVDLANQVTVVQDQLEKAVDLAVADLATQL--SEARQSEANLQTEYDR----
B1ZZ74          RYLERHPKMIDLANSIAIVQEQLGKALDLAIADLGTRL--NEARENERTLQEQFAK----
A0A2E0V4K6      RYRGKHPKMIAASAKLAAAKGSFLEEFLVAARSPVDKS--YWEGVSDQLGTIKDGG----
A0A2E6NAH3      RYREKHPAMIQLLQTLQEGELELSRAVQNSVDKIYAGY--SESKSNYEVASLRLAE----
A0A2A5VZA5      RYREKHPIMIQLLQTLQESEIELQEAVTNSVDKLYASY--IEAKSNFELSSKRLAE----
A0A424R295      RYREKHPIMIQLLQTLQESEIELQEAVTNSVDKLYASY--IEAKSNFELSSKRLAE----
B4CZV9          KYLPTAGAMKPLYQQLDVINQRLDAEVEVATNRFNLEY--QELLNKKHDLEAKLPE----
A0A3B9FM17      GYLERHPKMLENARSVQQVKSALRQSVTSAIEDLRDKH--IQLSAQEKEFADEMEK----
R7E4L8          SAGRQNPMVSSLAENMKEMRESIGRSIANYCNALEVRM--GELEKERNELNRLLSD----
A0A0E3YV65      RYGVRHPSMIENDRSREALERLRTELITAAMSNLRNQR--AKALNEETQLQSQLAQ----
W0J900          KYGRRHPAMVEQERSIQALEKLRGDLVRAALSTLRNQR--EKAVENERQLQEKLAD----
A0A2T6DSN5      TYLDEFPKMKENALATENTEKRLQANIELAIAELRSRY--EVAGQHEKRLRQDFAD----
A0A2V2SMX4      FLRPKHPKMVALDEDISRRRRLLGIFKDQSSEQLQTLQ--KTLELQIANMERDVRE----
A0A317ZIW7      YLKPKHPKIIGLKDQIERTSNQLEILRRQAFERIGERK--LVIERRIDNLNDEIAI----
A0A2D7WMI4      GYLSKHPKMLSNARQIQDTYGRINKQVKDAIFDMDNRK--LQLQALANDFTVAMTT----
A0A2D6VHX5      GYGPNHPKMIENARQVQEVQELLRKEVTLAIEDLRDRH--IQLDAQEREFMGAMDK----
A0A2D8I214      GYLERHPKMLENARQVNEVKNSLIKEVTSAIEDLKDKR--VQLTAQEKEFQQAMEK----
A0A1Z8VL41      GYLERHPKMLSNAKQVKDVKKALALEVKSAIDDSRDKL--LELQHQEGEFTMAMQE----
A0A2E6TNA4      GYLERHPKMLXNAKQVKDVKKELAXEVKSAIDDSRDKL--LELEHQEGEFTKAMQK----
A0A1Z8RG47      GYLERHPKMMENARQVLEVKQSLNLAVKSAIEDLRDKY--IHLVAQENEFAKAMQK----
A0A1Z8RJJ5      GYLERHPKMMENARQVLEVKQSLNLAVKSAIEDLRDKY--IHLVAQENEFAKAMQK----
A0A2D7V631      GYLERHPKMMENARQVSEIKTTLNLEVKSAIEDLRDKH--IQLNAQEKEFATAMQK----
A0A354RA24      GYLERHPKMMENARQVSEIKTTLNLEVKSAIEDLRDKH--IQLNAQEKEFATAMQK----
A0A2E9RV62      KYLANHPKMIETARQIKDVERILQLEVKASIEDLKNSY--HQLEAQEQEYANEMDK----
A0A2E4AY96      GYLEKHPKMLANARQIRDTNMQILSEIRNAISDLYERE--NQLLALEDKFSIAMND----
A0A3B9B9P4      GYLEKHPKMLANGRQIRDTNMQILSEIRNAISDLYERE--NQLLALEDKFSIAMND----
A0A2D5Y6N6      GYLERHPKMIENARQVQLVKQALNKEVKSAIEDLRDKH--IQLTAQEKEFASAMAK----
A0A2E7HSS8      GYLEKHPKMLENARNVLQVKNALKDEVTSSIEDLRDKH--IQLSAQEKEFGDEMAK----
A0A2D8VCK3      GYLERHPKMLENARSVQQVKSALRQSVTSAIEDLRDKH--IQLSAQEKEFADEMEK----
A0A350QVY4      GYLERHPRMLENARSVQQVKSALRQSVTSAIEDLRDKH--IQLSAQEKEFADEMAK----
A0A2E4ZYR7      KYLELHPKMSSNTRAIMELHRLLRLEVKTAIEDLTNRV--SELASQEREFTKAMLA----
A0A2E6TCV1      KYLENHPKMKENALAIGELHKILLNEVQVAIEDLTNQK--NELNVQKAKFVYLREK----
A0A3D4HHL8      YMKGKHPKLAAVNLEIERKENEMSVLKRQALHELKDEK--EVLQSKISHLKDVIDE----
A0A366HV03      VYLEDHEILKALRTKQRQIDESLTTELEVERKRFEVER--LRLGDQLKELEAKLPE----
A0A2V2SDN0      GLRPMHPKILKLNEDIAAQEKLVEGSRSEVMKQLVNRR--DGLQLEVKNLEKVFRE----
A0A1V6GL40      YLRPNHPKMIAMQEDIARREELLKILRTQSEEQLKNRK--ELLAVEIEILEKDLKA----
A0A2V5X6Z6      FLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHRR--QAIELQVQNLEAAFKE----
A0A2V5VGZ7      FLRPLHPKILKLDEQIATQEKLVEISRDEALKQLAHRR--RAIELQVQNLEVAFKE----
A0A2V5U130      FLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHRR--QAIELQVQNLEAAFKE----
A0A2V6C237      FLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHRR--QAIELQVQNLEAAFKE----
A0A3R8L982      RYLDRHPRMIEIDNSIRVTRQQLAAAIALAIADLQATL--EKARAREASLAIEYTA----
A0A2E7HPU9      RYLSKHPKLIAAKNALEEYAFRFLREFDQVRKAAADKS--YWDKNKSEWDKQDLDQ----
A0A388PR45      IYTDLHPKMIAERQALAQLSAEFQRAVKTKADSLAAAQ--VDLRAKLDNAVEILRQ----
A0A388QR61      IYTDLHPKMINQRQVLAQCVAEFKRSVNTKADSMQTTW--LDLQAKLANSVEILRQ----
A0A2A2RS01      KYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQASV--QNARSSYDAIVANLER----
A0A2A2Y1A7      KYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQASV--QNARSSYDAIVANLER----
A0A388PDH9      KYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQASV--QNARSSYDAIVANLER----
A0A2G4H1E7      KYTDQHPTLVAEREALNQVDRQLREAVVQAVKSRRASL--ENAKARHEAILRNLVA----
A0A2G4GZA6      TYTDQHPKLVAEREALKQLDLQLKESISQAIKSRRSSL--ENAKARHEAILRNLVA----
A0A388P514      TYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSSL--ENAKARLEAILRNLLA----
A0A2A2YG59      TYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSSL--ENAKARLEAILRNLLA----
A0A2G4F7D5      TYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSSL--ENAKARLEAILRNLLA----
D5EML0          RYLRKHPKIVENEAAMKSVSTELSRAIRQAEQQSTIEY--QTVQKEVSDLTARIQE----
A0A3C1C1M3      -YTPEHPAVEAQDKAVALYKEQANQALNRAKNTAAANL--ALYQEQAGSLQKKNEELLET
A0A2E9EYJ1      GVGVKHPKIVNIDSQLNLRMNQLLDAVETHKKALTTQL--AMAEQQYENSKESKER----
A0A258AXR6      GRGRLHPQVLSVDSQMAEYQSLILGAAKAHVAGLQNRL--DASRKKRESLKIYNDD----
A0A1T4WVZ9      GRGRRHPEVMGVDSQIALSKQLILDAVKAHLAALQTRL--DFSIQRRETLRSSNEE----
A0A3D3NZQ6      GRGRRHPEVLANDSQITKYKELIAAAAKDHLAGLQNRL--ESARKRKEALEASNQD----
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ------------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      SLGKV-----LAANDR--IADAERMKMNISRIQFHYDRVVNLLQNVDISRNI---DQGTL
A0A258AXL1      YRKLI-----AGYDDF--RRDYKLQSSGHLAWEAAYVGMKGRLAAMDYTGPE---VQVEF
A0A2E6T1E0      RKSEQ-----QAMNQK--SIQYFALEREAKQSETLYNLALQRLKETELQEKD---IVQNM
A0A2V5U7A0      -------------------------------NRALYESVLKRLSETNVSNDIAV-SNMQI
A0A355VK99      TAIK--------------EQEIIPLIREHKVKEELYLMLLSKEQENALAMAVTE-SNARV
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTTNLKDIDVSQVTGSEDQVSI
A0A2V6NH44      WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYDRLTNDLKSVDVSQVIDTGDQISI
A0A432FDF6      AKKRE-----SDMRKT--GREYFDAKRELSNTTRIRDTILFRIMQEEVDLALPKESTVEI
A0A353DCA1      KKDGT-----VDLSMR--QHQYNSAKEEYEQSRMMYREMSVKQQQQRVLLKMPR-TPITL
A0A3C1AXQ2      AKKGM-----LDQQSA--QNDYKTAADEVAYIESLLLQLKSTYFQTKAELELVK-SPATI
A0A3D0IZR7      -MRGQ-----LRADRSDRLAPYNEARRDFETQSQLLEVLMSRYRQQSVESRIET-RPVQV
A0A3R5R793      KEEDL-----QKHVLQ--VPMYEQASRDYDAALDQLKELDSRYKDEIARLRVPR-EVIEM
A0A2N8IV96      KEEDL-----QKHVLQ--VPMYEQASRDYDAALDQLKELDSRYKDEIARLRVPR-EAIEM
R7E1V8          KEEAL-----QKHVLQ--VPMYEQASRDYDAALDQLKDLDSRYKDEIARLRVPR-EAIEM
A0A356FSV4      KENEL-----IQLSKT--RVDYNTLYREFEVQQGFLTAIVSRMTMQKAQINLKN-PNARI
A0A3D3DET9      WDARN-----QEFQHK--NAEYQALKANVQRIRALYDQLLATMQTLDVNKEISP-ESVET
A0A355SVK9      KESEL-----IQLSKT--RVEYSSLERELNVQQGFLQALVSRLTEEKAQVTLKN-PNSRV
A0A2E5D7I3      NESEG-----LATARRLLLARTQVLDGETKSRMSVFNSILVALEESKVNSIDEE-VIAEL
A0A2V5NYE2      QEEQV-----LEINRK--TAEWQRLKDNKQRIQAAHDSLQATMDKLDVGKEAAP-ESVTI
A0A2V6FIP7      KEQES-----FELSQL--RIQYDVLSRQADQSKLLYNIVLQRMKETDLTS---KDKAQNM
A0A353DI77      RELRN---------AM--KLRASLLTNSVETKNELYNTLLSRVGVLKTDA---EGVEAEV
A0A1V6GCZ3      ATTND-----VTQANL--TRPYFEAKRALEELQRFRQVLDAKIAFEKIDVELPKTLMVEV
A0A3C1UJT2      QTSKL-----FEWEQL--YMQQAALEQDLEIGTKLIDNIKDQIQSIEFTAES-EGTTIEL
A0A2S7U0Z3      KSDAADKWVLLSQGAL--ASRAKLLNNTSEQTRDKYQSISQRMTEIDVADNQ-SMNNLKV
A0A2E0R252      -TRID-----SQIQIA--STRASVLERELEAEQQIYDNLITKLKEGNVSKGF---DSKQF
A0A3E1EF48      -ALIA-----AQLRTV--ASRASILSKALETEQGIFENLNTKLKEADVTRGI---ATRQF
A0A2A2PVG8      -ALTN-----AKRQVV--STRSNVLERELEAEKAVYDNLILQLKEGNVTRGF---ASRQF
A0A2E0R421      -ELAT-----DQMQIV--ATRSRSLGRELESEQDIYNNLIAKLKEGNVTKNF---AGKQF
A0A2N8IR72      ------------TAIK--EQEIIPLIREHKVKEELYLMLLSKEQENALAMAV-TESNARV
A0A410ELH5      ------------TASR--EQEIIPLIREHKVKEELYLMLLSKEQENALAMAV-TESSARV
A0A2E5EJ69      QEKKV-----AADQQK--EIEYKHLKAQAESLQAMYQRVLGAKQESSVTEGI---QNRTV
A0A1T4WWY4      YHKAI-----KSYDTK--KLDYDLMEKSQLAWDKAYEKLSQRIESLEFDG---DKAPLSL
A0A3D3LEQ6      YYKAA-----KSYDEK--KLAYELMEKGQLAWDKAYEQLSRQIEGLEFGS---DESAVSL
A0A3D3NW23      YYKAA-----KSYDEK--KLAYELMEKGQLAWDKAYEQLSRQIEGLEFGS---DESAVSL
A0A2G4I5Z5      QEKKL-----SLLNSQ--RSGFDHLQAEVMQNRKLHDTVIQRLKELDIVSG--NKNKNEV
A0A2E7ALI1      EAGLA-----SARRLL--LARTQVLDGETKSRMSVFNSILVALEETKVNS---IDDEVIA
A0A178IDB9      AEKQA-----QDLDRI--TIDYKFLEEDAVSKRQAYNSILSRLNETTIVSQL---ENVNI
A0A290QD69      TEKQA-----QELDKI--TSEYKYIEDESNIKSKNYQDILSRLSEISIISQL---DNVNI
A0A2E7VDS1      VQRES-----QKLDDI--ETRINEMTREKEIHEKTHDIMLNRLNEVKVTRAL-PQEDDPL
A0A178IFJ2      SEKAS-----LALDRQ--AVEYNVLRREAETNRATYTQVLSRLNEASLTAQL---GNSNI
A0A357FSP9      KELEL-----IKLSKT--RVAYSSLQREMDVQQGFLQALVQRMTQERAAVNL-KNPNSRV
A0A2A2R174      QEKKL-----SDLNAR--RSGYEHLQADVTLHRSLHDAVIKRLRELDIVSG--DKSKSEV
A0A1H1SWX2      AEKDN-----LRLGDL--SVDFKSLENQAQVAKSNYLEILNRLNQVTTSKNL---ENIPV
A0A290QE54      NEKEQ-----IRLRDL--SIDFKSLENQAAVAKGNYTQILDRLSQATTSSNL---ERISV
A0A1H2DTI1      YEPKA-----ISLGAK--LAEFERLKSKRSMDQSLYESLLQSVQKIDLNRRL----DEQR
A0A1V5L462      WEEEV-----IQYSLG--VADLETMNSNLSRLLSTRESLIRRKERLDIGRNV----DTEL
A0A2A2R3V9      EEVKA-----LDVNRR--MADYQRMKSKRQRLQAFYERLVSSVQSVDLSQNI----DQEM
A0A3D3LGD3      AKSEL-----LGQQSA--FNEYKTAKDDVTDIEAILRTLKTRYFETKAGLEI---FKSPA
A0A350ARX4      WEKQA-----LSISRK--SAEFERLQYRLDRSRNTYQRLLDSIQAIQSNQNI-EQDTIGI
B5JIS2          KFTES-----IEVGRL--ADQFLVIGSEVDAKREALTSLLRRVSNANVVSNL----PVDV
A0A1H2GQN6      RDKLR-----QEKSDK--MAPFQEAVKERDRQQYILDQYEIRYKQENLDQQSPSQPATVI
A0A2A2RPW6      QEKKL-----GQLSLL--RIEYDRLQREAASERKLYDTVINRLREIDLTGNI--EKKSEF
B4D1I7          WEAKA-----LDLSQR--LAEYGSLQANVTRARAQLESLSRSKGNVEINRNV----DQDI
A0A353F286      RQEDA-----ITLSLK--QTSYTQAKEQYEQARGMLREMKFKHSEAKILLKM---PRDPI
A0A354FSA6      RQEDA-----ITLSLK--QTSYTQAKEQYEQARGMLREMKFKHSEAKILLKM---PRDPI
A0A3B9GA54      RQEDA-----ITLSLK--QTSYTQAKEQYEQARGMLREMKFKHSEAKILLKM---PRDPI
A0A2D7B7R6      QTSKL-----FEWEQL--YMQQAALEQDLEIGTKLIDNIKDQIQSIEFTAES-EGTTIEL
B1ZT68          AERSA-----HELDKT--SVDYKFLEQDAATKRATYSRIVDRLNEASVASQM---ENTNI
W0J7C2          SEAQA-----RELDKI--SIDYKFLEQDANAKRATYARIMDRLTEAGITSRM---ANTNI
A0A2E5K4P7      KEQEY-----LALEKN--REEYGGLTRKLEQARKSLEHLRMLKFKEDVRTDT-KNSSVNI
A0A0R2XPB1      WEKSA-----LEHGRL--IAEFERLQSRLERSKAASVNSQDSLQAIDTNQNL-QQETVSI
A0A348NQP1      WEESA-----LDNGRL--IAEFERLQSRLERSKAASVNSQDSLQAIDTNQNL-QQESVSI
A0A357FV58      WEESA-----LDNGRL--IAEFERLQSRLERSKAASVNSQDSLQAIDTNQNL-QQESVSI
A0A2V6F9Q9      WETKA-----LDLSQR--LAQFNRIKGKMDRTKQLYDRLTNDLKAVDVSQVVDAGDQISI
A0A2V6ME53      WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVVDTGDQISI
A0A2V6NZZ3      WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVIETGDQISI
A0A2V6EBU2      WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVIETGDQISI
A0A2V6EY06      WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVIETGDQISI
A0A2V6NIJ1      WEVKA-----LDLSQR--LAQFNRIKGKVDRTKLLYDRLTNDLKSVDVSQVVDSGDQISI
A0A2V6C292      WEVKA-----LDLSHR--LAQFNRIKGKVDRSKLLYDRLTNDLKSVDVSQVVDSGDQISI
A0A2V6D2X0      WEVKA-----LDLSHR--LAQFNRIKGKVDRSKLLYDRLTNDLKSVDVSQVVDSGDQISI
A0A2V5ZUK1      WEAKA-----LDLSQR--LAQFNRIKGKSDRLKQLYDRLTNNLKEIDVSQVVGGEDQVSI
A0A2V5XFN9      WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGEDQVSI
A0A2V6EZC8      WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGEDQVSI
A0A2V6I7Z5      WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGEDQVSI
A0A3B9LCP2      WEAKA-----LDLSQR--LALFNRVKGKVDRLKTLYDRLTNNLKEVDVSQVVDSGDQVGI
A0A3C0R669      WEAKA-----LDLSQR--LALFNRVKGKVDRLKTLYDRLTNNLKEVDVSQVVDSGDQVGI
A0A2V6EID2      WEAKA-----LDLSQR--LAQFNRVKGKVDRLKVLYDRLTNNLKEVDVSQVVDSADQVSV
A0A2V6MHB0      WEAKA-----LDLSQR--LAQFNRVKGKVDRLKVLYDRLTNNLKEVDVSQVVDSADQVSV
A0A2W5YWL9      WEAKA-----LDLSQR--LGQFNRIKGKVDRTKQLYDKMTNDLKSVDVSQVVDTGDQISI
A0A2V5NH62      WETKA-----LDLSQR--LAQFNRIKGKAERLKTLYDRLTNSLKDVNVSQSVDSGDQVSI
A0A2W6A620      WEAKA-----LDLSQR--LAQFNRIKGKAERLKTLYDRLTNNLKDINVSQSVDSGDQISI
A0A2V5PIJ4      WEKKA-----LDLSQR--LAQFNRIKGKADRLKTLYDRLTNNLKEVNVSQVVDTGDQIAI
A0A2V6K2G8      WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTNNLKDIDVSQVTGSEDQVSI
A0A2V5W206      WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTTNLKDIDVSQVTGSEDQVSI
A0A2V6MW77      WEAKA-----LDLSQR--LAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGEDQVSI
A0A3C1VFY9      WGRQN-----IELGHK--SAEYASLKAKSQRLQALYDQLLATFQTLNVNKDA-SPETVTI
A0A2G4GZN8      KEEEI-----SRLQAA--NVDLERVDKEIRASEEFLGRMKLSYEDAKLRSST-SGTSTSI
A0A348NPT1      KELEL-----IKLSKT--RVAYSSLQREMDVQQGFLQALVQRMTQERAAVNL-KNPNSRV
A0A2E1KV60      KERDM-----IELSKT--RVEFNSLIRDLEVEQMTYQKLISLMAEEKIQVNI-KNANARI
A0A2D7F4D9      KEREM-----IELSKT--RVEFNSLIRDLEVEQMTYQKLTALMAEEKIQVNI-KNANARI
A0A3R7RBR8      KEREM-----IELSKT--RVEFNSLIRDLEVEQMTYQKLTALMAEEKIQVNI-KNANARI
A0A2E0NH28      KENEL-----IQLSKT--RVDYNTLYREFEVQQGFLTAIVSRMTMQKAQINL-KNPNARI
A0A350AS32      KEQEL-----IELSKT--RVEYNSLLRDLDVQQSFFIALTSRMTQEKAQVNL-KNPNARI
A0A368BGT4      KEREL-----IELGKT--KIEFNSLLRDLEVQQSFFQALNLRMTTEKAQVNL-KNPNARI
A0A1G3ZL71      HEKDQ-----IKLNEL--KPEYGSLENEALAKRTAYLQVLDRLNQTTTSKNL--DSRVPL
A0A2T6DX88      HEKEQ-----MHLRDL--AVDFRSLENQATVAKSNYSQILDRLSQTTTSSKL--E-KIPV
A0A3E1E5C8      AEKES-----LHLGDL--SVEYNSLENQANVAKSNYVQILNRLNETTTTRNL--E-KIPL
B1ZZ74          AEKES-----LDLGAL--APEFNSLQNQAQVSKANYLSILDRLNQTTTTKNL--E-KIPL
A0A2E0V4K6      EAEVA-----IARRLL--LARTQVLDGETKSRMSVFNSILVAMEESKVNQ---IDDEVIA
A0A2E6NAH3      KEKEL-----IELGKT--KIEFNSLLRDLEVQQSFFQALNQRMTTEKAQVNL-KNPNARI
A0A2A5VZA5      KESEL-----IALSKT--RVEYNTLLRDLDVQQSFFQALNSRMTQEKAQVSL-KEANARV
A0A424R295      KESEL-----IALSKT--RVEYNTLLRDLDVQQSFFQALNSRMTQEKAQVSL-KEANARV
B4CZV9          YQELS-----RKHAKL--LSQLSIFDASRVPYDTYLANMQREINEVEFAG---EKERINL
A0A3B9FM17      VQKQS-----EQLSEI--EETLKNFERELAVVQRSTDSIHSRLNDVNIEQALPSEQDEPL
R7E4L8          ------------MASK--DEGLVPLLREQKVMEELYLMLLKKREENALALAT---TEPSA
A0A0E3YV65      AEKES-----FRLDEM--AVQFNVLRREAETNRATYAQLLNRLNETSITAQL---ANSNV
W0J900          AEKAS-----LGLDRL--AVEYNVLRREAETNRATYTQVLGRLNETSLTAQL---GNSNI
A0A2T6DSN5      AEKRL-----QELDRA--TDRYKFLEDDYNRKNQALNSIEGRLQEATIVSRL---ENVNI
A0A2V2SMX4      WDAKC-----LEISRK--TAEYQRLKNDSQRVQGLYDRLLATMQTLDVNKQI-NPESVTI
A0A317ZIW7      WEQSA-----LENGRL--IAEFERLQSRLERSKAAYERNQEALRAIDTGQSL-SQETVSV
A0A2D7WMI4      VQDEA-----NFLSKI--DDNISSMERELEIVQTSSGQMQKRLNDVTIEQAFPQDQDDPL
A0A2D6VHX5      VQTES-----RRLGHI--EEAISKAERTLAVVRSSTDIIRKRLDDVRIEAALPSEQDDPL
A0A2D8I214      VQQDS-----MKLSEI--EEWLINKERELTVVRTSTDQIQKRLNEVRIEQALPSEQEEPL
A0A1Z8VL41      VQSQS-----NELSEI--EERLEDYKRELSVVRASTDQIHKRLNDVKIEQSLPSEQDDPL
A0A2E6TNA4      VQLQS-----NELSEI--EERLEDYKRELSVVRASTDQIHKRLNDVKIEQSLPSEQDDPL
A0A1Z8RG47      VQEDS-----RKLSEI--EEKLINFERQLAVVRKSTDQIHDRLNDVRIEQALPSEQEEPL
A0A1Z8RJJ5      VQEDS-----RKLSEI--EEKLINFERQLAVVRKSTDQIHDRLNDVRIEQALPSEQEEPL
A0A2D7V631      VQEDS-----RKLSEI--EETLTNFDRQLAVVRKSTDQIQSRLNDVRIEQALPSEQEEPL
A0A354RA24      VQEDS-----RKLSEI--EETLTNFDRQLAVVRKSTDQIQSRLNDVRIEQALPSEQEEPL
A0A2E9RV62      VQVEA-----VELSEM--EKDLEVLDRKLQIQRGSTDTIQRRLQDVVIQIELPQEQDDPL
A0A2E4AY96      VQIEA-----KDVSLI--DDTLRNFERELQIVQTSSAQMQKRLNDVTIEQAFPQEQDNPL
A0A3B9B9P4      VQIEA-----KDVSLI--DDTLRNFERELQIVQTSSAQMQKRLNDVTIEQAFPQEQDNPL
A0A2D5Y6N6      VQEES-----RTLSEI--EEKLKNLDRQLAVVTRTTDQIHNRLNDVRIEQALPSEQEEPL
A0A2E7HSS8      VQLES-----EKLSEI--EDRLKNFTRELAVVQRSTDGIQSRLNEVKIEQALPSEQDEPL
A0A2D8VCK3      VQKQS-----EQLSEI--EETLKNFERELAVVQRSTDSIHSRLNDVNIEQALPSEQDEPL
A0A350QVY4      VQKQS-----EKLSEI--EETLKNFERELAVVQRSTDSIHARLNDVKIEQALPSEQDEPL
A0A2E4ZYR7      VQKES-----QKLDDI--EVQILGMTREGLVHRTTYDQMLKRLNEVKVTRELPQDEDDPL
A0A2E6TCV1      IKKQA-----QQLGQK--EQQIARLEQDLTLERQTFSSLHKRKKEVEVTGALPEAQTDPL
A0A3D4HHL8      QEVKA-----LDYSRR--LAEFERINSRLDRQKSLLENLTASIQSIDINLNL-DQEFLTI
A0A366HV03      YSEMT-----EKLNKL--RQDYKLGHEGDLAWTKAYTDLSKMIATINFGGDK-DRVDLQF
A0A2V2SDN0      WEGKA-----LEASRK--MVDYDRLRQDVQRTQAAYDKLLSVISTVDVGKSV-DQENVSV
A0A1V6GL40      WDARN-----QEFQHK--NAEYQALKANVQRIRALYDQLLATMQTLDVNKEI-SPESVET
A0A2V5X6Z6      WDAKA-----IESSRK--MADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV-EQENVGI
A0A2V5VGZ7      WDAKA-----IESSRK--MADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV-EQENVGI
A0A2V5U130      WDAKA-----IESSRK--MADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV-EQENVGI
A0A2V6C237      WDAKA-----IESSRK--MADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKV-EQENVGI
A0A3R8L982      NEKEH-----LRLRDL--SVEYKSLENTAAVAKSNYAQILDRLSQVNTSRNL-EKLPVRR
A0A2E7HPU9      LSRLQ-----VARRLL--TARATVLTSGIASQREVYNSLNTQLAE--LNAKK-GETAVEV
A0A388PR45      KDEAI-----NRLQAA--AVELEKIDKDIRANEEFLGRMKLNYEEAKLRTAT-SGISTSI
A0A388QR61      KDEAI-----NKLQAA--AVELEKIDKDIRANEEFLGRMKLNYEEAKLRTAT-SGISTSI
A0A2A2RS01      KDDEI-----YRLQAA--NNELERVDKEIRGQEEFLARQKQNYEEQKLRSST-SGTSTSI
A0A2A2Y1A7      KDDEI-----YRLQAA--NNELERVDKEIRGQEEFLARQKQNYEEQKLRSST-SGTSTSI
A0A388PDH9      KDDEI-----YRLQAA--NNELERVDKEIRGQEEFLARQKQNYEEQKLRSST-SGTSTSI
A0A2G4H1E7      KEEEI-----SKLQAA--NVELERVDKDIRASEEFLGRMKLSYEDAKLRSST-SGTSTSI
A0A2G4GZA6      KEEEI-----SKLQAA--NVELERVDKDTKASEEFLSRMKLSYEEAKLRSSN-SGTSTSI
A0A388P514      KEEEF-----SKLQAA--NVELERVDKDIKASEEFLGRMKLSYEEAKLRSST-SGTSTSI
A0A2A2YG59      KEEEF-----TKLQAA--NVELERVDKDIKASEEFLGRMKLSYEEAKLRSST-SGTSTSI
A0A2G4F7D5      KEEEF-----SKLQAA--NVELERVDKDIKASEEFLGRMKLSYEEAKLRSST-SGTSTSI
D5EML0          TEGRV-----LVAERS--LLEYKRMERDVDQKREMFNKLMNRYRETRIAQQM-NLNNMLV
A0A3C1C1M3      ASKLD-----RDILEG--EMRITALNRTRSAADASYLGLLTRIQEARLSADE-NTATVKL
A0A2E9EYJ1      TEKMS-----LQERKQ--NVRYIEAKKEYELSKEMLNGMQSQLAKETIDSAG-QRTPLVI
A0A258AXR6      AKQEL-----QNMSSL--YTEYKTAKDEVTYLEDLLVKMRSRYFEEKAGIEL-VKSPATI
A0A1T4WVZ9      AKSEM-----LDQQSA--QNDYKTAADDVAYIENLLLQLKSSYFETKAGLEL-VKSPATL
A0A3D3NZQ6      AKSEL-----LGQQSA--FNEYKTAKDDVTDIEAILRTLKTRYFETKAGLEI-FKSPATI
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      DLATA-------------------------------------------------------
A0A3D4CZT6      ------------------------------------------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      AILD--PASEAVRSYKQDVSLLAMTLVAGLLAGFGCVFLVAVRDDRFITLTDVIEKLGDA
A0A258AXL1      QFKGFTDVRDDIPVSPNKQKLLTYALALSIGLGLGGPVLTERLRFTSSFVGEAEKYCQYP
A0A2E6T1E0      HVIDLATAQMS-PIKPKKLLTLFLGIVGGLGAGFGLAFFVNFLDDSIKSQDDVETYLNLP
A0A2V5U7A0      MQSAERPRSPDAPN---IPINLTMYAALGLFLGVGMAFALEYIDSHLNTPEHVWRAVDLN
A0A355VK99      LEAAHGPNLPISPK---TIKYVAGGTAGGALLSILAFMGVAMLNNKVNNKHDLPSVNRQP
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      MEMATPPIS-VRPG---LIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSEN
A0A2V6NH44      MEPATPPVS-VRPG---LLKSLLLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSEN
A0A432FDF6      TDDADLPIKAVRPN---IPLNIALGVVVGLVLGVGLAFFIEYLDTSVKTIDDVERALNAA
A0A353DCA1      HERAKKAKAPAYPN---VTLNLLLGAGVGLIFGIGIAFLLEHLDTSVKSLEDVERYLQVP
A0A3C1AXQ2      YAIATPEGKPAKPN---VALNLALGGVLGLMLGVGLAFFLEYMDTSVKSLDDVERFLGVP
A0A3D0IZR7      VNRAEPAVRPVKPS---LKLNLALSMVVGLILGLSLAFFIEYLDTSIKTMDDVERFLGIS
A0A3R5R793      YQLPTYPVAPYKPN---VTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVP
A0A2N8IV96      YQLPTYPAAPYKPN---VTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVP
R7E1V8          YQLPTYPAAPYKPN---VTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVP
A0A356FSV4      VDEALPPLRHSSPN---LFLNIALGAFGGVVVGLGLVFGIAFLDDRVKSAFDIEGTIGLP
A0A3D3DET9      IEAASPA----YAARLDLWKGAVNGALLGLALGLGLLLVLDRLDDRVGSFTELQDLFDEN
A0A355SVK9      IDEALPPMRHSSPN---IPMNLAAGFLGGLAAGAGFVLLIAFLDDRVKSAFDIEGAIGLP
A0A2E5D7I3      HSRAAPSDSAVFPNRLRVQ---AVGGIGGVASGLGLVLLLLXLDNRFXTVSQVEXETGMP
A0A2V5NYE2      HQKASPA----VPNRPQLSRKLATGALVGLALSVVLLLILDRLDDRVNSVTELQDLFDEP
A0A2V6FIP7      RVVDKAVV-PMNPIKPRVVLTLFLGVIGGLGVAMGLAFFVNYLDDSIKSQDDVETYLRLP
A0A353DI77      IKHEDAPR-AWAPFSPNRKKIMVKTTMLGLCGGLALAFMFQFVDNKIHGVADIEQTFGIS
A0A1V6GCZ3      VDRAMPGL---RPVRPNKPLNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERALQCP
A0A3C1UJT2      AEKATEPS----TIEPNKTQRIILGVLLGLGLAYGYLYLMNMMDQSIKSVEQAEKILQLP
A0A2S7U0Z3      VEPAF----IGLAKESVRLIYLAAGSIFGIFTGFAAAFGLSILDYKIYDVRSAEEATGLT
A0A2E0R252      DVVQPPSL-PANPTGPNKKKITMKYLFGGAALGVGIILLLGFLDPTVRTVADLEVLTGTP
A0A3E1EF48      EIIQPPTL-PGGPIAPSMNDIVGRFSGGGFLLGIACIFLIGFLDPSIRTVGELERDARLP
A0A2A2PVG8      EVVQPPTM-PAAPVAPIKTRMLVQFAGGGAALGIAIIMLLGFLDPTLRTVAEVEQFCGIP
A0A2E0R421      DIVQPASL-PGGPIGPNKKSIMSKYTMGGVAVGVALILLMGFLDLTIRTVSELEGMTGKP
A0A2N8IR72      LETAHG---SNLPISPKTIKYVAGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAANRQP
A0A410ELH5      LETAHG---PNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQP
A0A2E5EJ69      EVYNPASL-PGAPVSPRKSVIMMVAMIVGCGLSFMLVFIVQQLDKTVKSIDEAERLFGVP
A0A1T4WWY4      EFRGFTNLRSEMPVSPNKSKLFMMGCLLGLGLAGGVPFLLRRFDSSVVELSEFEGTLGIN
A0A3D3LEQ6      EFRGFTDIRSEAPVSPNKSKLLMLGCLLGLGMAGGVPFLLKQMDSTVTDLNEFEETLGIP
A0A3D3NW23      EFRGFTDIRSEAPVSPNKSKLLMLGCLLGLGMAGGVPFLLKQMDSTVTDLNEFEETLGIP
A0A2G4I5Z5      RIIEPASL-PLTPIRPNKKMLLIYALALGTALSVGLIWLLVQLDTTIKSVDHAERLLGIP
A0A2E7ALI1      ELHSRSAV-PSSPVFPNRLRVKAVGGLGGIAGGLGLVFLLLRLDNRFRTVSQVEEETGMP
A0A178IDB9      KVLDKALV-PGAPSNSPSSQILLQAGAFGFILFLGLPIGIGLMDTRVKSSHDVETGLDHP
A0A290QD69      TIHDKALV-PGFPDTGTPKEVIKQAAALAFVLFFGIPVGLGFLDTRVKSSHDVESGLNQT
A0A2E7VDS1      KRDSPAVT-PTSPFEPDKSSIHRTGALIFLACFILIPMAFEFIDNRVKSPWDIEVFLGRD
A0A178IFJ2      KIAERARP-PTVPLEPNPKKILLSIGFLGVLIVIGYPVGMELLFNRIKTWTDVERYIGLP
A0A357FSP9      IDEALPPL-RH--SSPNIVMNLAAGFFGGLAVGAGLIFVVAFLDDRVKSAFDIEGTVGLS
A0A2A2R174      RVIEPANL-PLTPIRPNKKMLLLYALAAGTALSVGVIWLLVQLDTTIKSVDHAERILGLP
A0A1H1SWX2      KPLDRALP-KGSPDTPNIRNIVKTSIGLGLVVFAGVAIGLSFLDDRVKSAWDIEGFIGAH
A0A290QE54      RPLDPATP-AGAPYTPDIRSIAKTSIGLFVLVFVGVAIGLSFIDDRIKSSWDVEHFIGVH
A0A1H2DTI1      FTLMEPPS-DATSIKDQYQVRLLSAGLGGLIVGMAILFIIDRFDDRINSTTELRDYFSER
A0A1V5L462      ISVLVPAT-SAVLRQVDKRREIAKGGALGLGMGAAIVFLLAALNNRITSADDLRRMFSSK
A0A2A2R3V9      ISIMEHPG-LAQPVHVGMSGMLLNGFLLGLLAGVGILFLLDRIDDRINSFTELRDHFEEP
A0A3D3LGD3      TIYAKAEP-EGRPAKPNVALNLALGGILGLMFGFGLAFALEFMDTSIKSLDDVERFLGVP
A0A350ARX4      LAHASRAG-V---QPPQVGKKVAEGAAFGLAVGIVIIAAISFLDVRIRNSDELAKRFDHP
B5JIS2          MRVVDPAF-IAKPKLAKRKLVAAFTVLLAGGAFFGVPLGMQLFDQRLKCATDIEKEFGKG
A0A1H2GQN6      SPANTNP----NPVRPILWLNITLSGVAGLLLGLSVAFFIEYLDTSVKSLNDVEKTLGVP
A0A2A2RPW6      RIIEPASL-PSIPIRPNKKMILLYALMVGMAASVGLIWLLVQVDSSIKSVDHAERVFGLP
B4D1I7          ISIRQRAS-AATPQKPGAVKTVGTGIGLGLFVGLLLLVLIDQLDDRVASYTEFQSYFRER
A0A353F286      TLHEKPKK-ASKPVFPNFTMNLLLGAGVGLIFGIAIALLLEHLDTSVKSLEDVERYLQVP
A0A354FSA6      TLHEKPKK-ASKPVFPNFTMNLLLGAGVGLIFGIAIALLLEHLDTSVKSLEDVERYLQVP
A0A3B9GA54      TLHEKPKK-ASKPVFPNFTMNLLLGAGVGLIFGIAIALLLEHLDTSVKSLEDVERYLQVP
A0A2D7B7R6      AEKATEPS-T---IEPNKTQRIILGVLLGLGLAYGYLYLMNMMDQSIKSVEQAEKILQLP
B1ZT68          KIFDPAYV-PGGPIGDALAILIAKASFIGVGLFVLIPLGMGLMDTRIKTVSHVEDALGEV
W0J7C2          AIFDPAWV-PDAPSDTGALEIAVKAGAAGLGLLFVLPLGIGLLDSRLRTPAQVEDSLQEP
A0A2E5K4P7      YVDGVAPT-KH--FTPSLTLNLAFGTIGGAGFGLFMVFFTAFIDNRVKSPFDIEQVIKLP
A0A0R2XPB1      LVNARKPI-P---AGVGLVQQFAMGALFGVVLAAGILFVLAAIDNRILTASELSAQFKDP
A0A348NQP1      LVNARKPI-P---AGVGLVRRFAMGGLFGLILAAGVLFVLAAMDSRILTASELSAQFKDP
A0A357FV58      LVNARKPI-P---AGVGLVRRFAMGGLFGLILAAGVLFVLAAMDSRILTASELSAQFKDP
A0A2V6F9Q9      MEPATPPV-S---VRPGLIKSLLLGFGGGAVAGILILLVLDRIDDRMASYGEFQRHFLEN
A0A2V6ME53      MEPATSPV-S---VRPGLLKSLFLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSEN
A0A2V6NZZ3      MEPATTPV-S---VRPGLLKSLLLGFGGGALVGIMVLLLLDRIDDRMASYGEFQRHFSEN
A0A2V6EBU2      MEPATTPV-S---VRPGLLKSLLLGFGGGALVGIMVLLLLDRIDDRMASYGEFQRHFSEN
A0A2V6EY06      MEPATTPV-S---VRPGLLKSLLLGFGGGALVGIMVLLLLDRIDDRMASYGEFQRHFSEN
A0A2V6NIJ1      MEPATPPV-S---VRPGLLKSLLVGFGGGALVGIVILLLLDRIDDRMASYGEFQRHFSEN
A0A2V6C292      MEPATSPV-S---VRPGLLKSLLLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSEN
A0A2V6D2X0      MEPATSPV-S---VRPGLLKSLLLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSEN
A0A2V5ZUK1      MEMATTPV-S---VRPGLIKSLLIGFGAGALLGLGILILLDRIDDRMASFSEFQHHFSEN
A0A2V5XFN9      MEMATAPI-S---VRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSEN
A0A2V6EZC8      MEMATAPI-S---VRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSEN
A0A2V6I7Z5      MEMATAPI-S---VRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSEN
A0A3B9LCP2      MDMATPPI-S---VRPGLIKSLLIGLGCGLLAGIGILILLDRIDDRMASFGEFQRQFSEN
A0A3C0R669      MDMATPPI-S---VRPGLIKSLLIGLGCGLLAGIGILILLDRIDDRMASFGEFQRQFSEN
A0A2V6EID2      MEMATPPI-S---VRPGLIKSLLIGLGCGLLAGIGILFLLDRIDDRMASFGEFQHQFSES
A0A2V6MHB0      MEMATPPI-S---VRPGLIKSLLIGLGCGLLAGIGILFLLDRIDDRMASFGEFQHQFSES
A0A2W5YWL9      MEAATAPI-S---VRPGLLKSLLIGLGCGALAGFGILLLLDRIDDRMASFSEFQHHFTEN
A0A2V5NH62      MEMASGPV-S---VRPGLIKSLLIGLGIGALAGIAILLLLDRIDDRMASFGEFQHHFSEN
A0A2W6A620      MEMAGAPI-S---VRPGLLKSLLIGLGCGALAGIGILLLLDRIDDRMASFGEFQHQFSEN
A0A2V5PIJ4      MENATAPV-S---VRPGLIKSLLMGLGAGILGGLAVLFLLDRIDDRMASFGEFQHQFSEN
A0A2V6K2G8      MEMATAPI-S---VRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSEN
A0A2V5W206      MEMATPPI-S---VRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSEN
A0A2V6MW77      MEMATSPV-S---VRPGLIKSLLIGFGIGALAGLAILVLLDRIDDRMASFSEFQHHFSEN
A0A3C1VFY9      Y---QPAS-DAFPDTTLLKKGLMFAGLLGLGLGLAILILMDRVDDRMSSFTELEELFDED
A0A2G4GZN8      SILDAPSV-SDKPINKNYYFSALVGIGSGLLFGVVLIIVIGTLDDRIKSAKDVEGSLGLP
A0A348NPT1      IDEALPPL-RH--SSPNIVMNLAAGFFGGLAVGAGLIFVVAFLDDRVKSAFDIEGTVGLS
A0A2E1KV60      IDKAFPPP-EDQPSSPNVFLNLAGGFFGGIFFGLGLVFAVALLDDKVKSVFDIEASIGLP
A0A2D7F4D9      IDKAFPPR-EDRPSSPNVFLNLAGGFFGGMIFGLGLVFAVALLDDKVKSVYDIEASLGLP
A0A3R7RBR8      IDKAFPPR-EDRPSSPNVFLNLAGGFFGGMIFGLGLVFAVALLDDKVKSVYDIEASLGLP
A0A2E0NH28      VDEALPPL-RH--SSPNLFLNIALGAFGGVVXGLGLVFGIAFLDDRVKSAFDIEGTIGLP
A0A350AS32      VDEAFPPM-KH--SSPNVVMNLAAGLFGGVAVGMGLVFIVAFLDDRVKSAFDIEGTIGLP
A0A368BGT4      VDEAFPPP-EDQPSSPNIVLNLFAGFFGGIAFGVGLIFSVAFLDDRVKSAFDIEGTIGLP
A0A1G3ZL71      RVIDRATP-SHAPYTPNLARVVRTSTIVGLLIFFGVAFGLSVVDDRIKSAWDVESYLGVH
A0A2T6DX88      RPLDRATP-TPAPYTPNMTRVIRLSVIVGLLVFVAVAFGLSIVDDRIKSAWDVESFIGVT
A0A3E1E5C8      HPLDAAVV-PGGPYEPDLARIIRTCLGVGLLVFFAAGLGLAFLDDRIKSAWDVESYIGAN
B1ZZ74          HPLDHAVV-PGAPFTPNLNAIIRLCVGVGVMVFFGVAFGLSFIDDRIKSAWDVESFIGAS
A0A2E0V4K6      DLHSRAST-PETAVYPNRIRSYFAGGAGGAACGVGLILLLLRIDNRFRTVAQVEEETALP
A0A2E6NAH3      VDEAFPPR-EDQPSSPNVVLNLAAGFFGGIATGVGLIFAVAFLDDRVKSAFDIEGTIGLP
A0A2A5VZA5      VDDAFPPL---RHSSPNITVNLLVGVFGGLAVGGGLVFIVAFLDDRVKSAFDIEGTIGLP
A0A424R295      VDDAFPPL---RHSSPNITVNLLVGVFGGLAVGGGLVFIVAFLDDRVKSAFDIEGTIGLP
B4CZV9          KYSGLLEV-RDDPVSPNRLRIMLLSFVGGLVLALGIPFLIEYLDHTMTNLEEVEHSFRLR
A0A3B9FM17      RVDSVAYE-PGGPYAPDKNRIREEGMMIFAVLFILIPVCLEFIDNRVKSPWDIEVFVGND
R7E4L8          RILEPAFG-SNAPVAPRLSLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTDLP
A0A0E3YV65      RVADGGTP-AGLPLEPDPRKIAITLLVLGLGVFVAYPVALELIFNRVKGWSDVENYLGLP
W0J900          KISERAQI-PTFPIEPDPKKIFRALGFLGLLIIIGYPVGMELIFNRVKTWTDVERYIGLP
A0A2T6DSN5      RILDRANV-PSVPANGTPKDTALQASALGLFLLFGIPLGLGLLDTRVKSPSDVEAGLEQV
A0A2V2SMX4      YEKATQ----AYPDRVNLPMKLALGAVAGLGLSLLVMLFVDRLDDRMASFTELQELFDEE
A0A317ZIW7      LEDASP----AYPAGQGTVIRLAEGAAYGIVLAIGVLALISFLDNRIFSAADITNHFDEP
A0A2D7WMI4      QKEQFAFV-PGGPYSPDKNGIYKKSFGIFVGIFFVVPFLLEFIDNRIKSPWDIEVFLGRE
A0A2D6VHX5      QKDQLAFT-PXSPYSPDYNKIKQQGVLIFVGIFLVIPIALEVIDNRIKSPWDIETFVGED
A0A2D8I214      HKEQYAFL-PGGPYTPDKAKIKRTGIYIFLGLFILIPVSLELVDNRVKSPFDVEVFIGKD
A0A1Z8VL41      HKENFASL-PGGPFSPDKNAIKQKGLXIFFAVFIIVPILLEFVDNRVKSPWDVDVFIGKD
A0A2E6TNA4      HKEQFASL-PGGPFSPDKNAIKQKGLIIFFVVFIIVPILLEIVDNRVKSPWDVDVFIGKD
A0A1Z8RG47      HKEQFATQ-PSAPYTPDKNQIRQSGFMIFFSVFFALPILLEFVDNRVKSPWDVEVFVGHD
A0A1Z8RJJ5      HKEQFATQ-PSAPYTPDKNQIRQSGFMIFFSVFFALPILLEFVDNRVKSPWDVEVFVGHD
A0A2D7V631      HKEQFAYQ-PFAPYTPDKNKIRKSGFIIFFAVFFALPILLEFVDNRVKSPWDVEVFVGHD
A0A354RA24      HKEQFAYQ-PFAPYTPDKNKIRKSGFIIFFAVFFALPILLEFVDNRVKSPWDVEVFVGHD
A0A2E9RV62      HKGNIAY--PGIQISPNLPEIHKTGFMIFAALFVLIPFGFEFIDNRIKSPWDIEVFLGQD
A0A2E4AY96      QKEQFASL-PASAYSPDKAAIQKKAATVFLAIFILFPFLLEFIDNRIKSPWDIQVFLGRD
A0A3B9B9P4      QKEQFASL-PASAYSPDKAAIQKKAATVFLAIFILFPFLLEFIDNRIKSPWDIQVFLGRD
A0A2D5Y6N6      NKEQFAYL-PGAPFTPDKNKIKRDGTMLGLAIFVIIPFLLEFIDNRVKSPWDVEVFIGRD
A0A2E7HSS8      RMESFANE-PGGPYSPDKQKIKEQGIMIFSVLFILIPICLEFIDNRVKSPWDVEVFIGND
A0A2D8VCK3      RVDSVAYE-PGGPYAPDKNRIREEGMMIFAVLFILIPVCLEFIDNRVKSPWDIEVFVGND
A0A350QVY4      RVDSVAYE-PGGPYAPDKNRIREEGMMIFAVLFILIPVCLEFIDNRVKSPWDIEVFVGND
A0A2E4ZYR7      RRGDVAMT-PATPISPDKAAIRRTGILIFVACFILIPIGFEFIDNRIKSPWDVEVFIGRD
A0A2E6TCV1      QISDVATV-PYLPVSPDKAAIKTKGILIFFACFVLIPIAFEFIDNRVKSPWDIEVFIGRD
A0A3D4HHL8      LENASP----AYAVRISIVKNLVMGVVAGVFMGVGILFIISILDSRIISVEDVENRFDQP
A0A366HV03      REFALLRD-VD-PVSPTKSKLAILAAVLGLGLAIGVPLGLEQLNDKITSLAALEKLTGLK
A0A2V2SDN0      LEPASPAG-RAS----KLVRNLALAFAMALVLGAGLLWVLSKLDDRFVSSTELAEDLPEK
A0A1V6GL40      I---EAAS-PAYAARLDLWKGAVNGALLGLALGLGLLLVLDRLDDRVGSFTELQDLFDEN
A0A2V5X6Z6      L---EPAS-VAAPTH-RLFRNMAIALVGSLLLGFGLLYCIGLFRDDFASLAELTHQLSEE
A0A2V5VGZ7      L---EPAS-VAAPTH-RLFRNMAIALVGSLLLGFGLLYCIGLFRDDFASLAELTHQLSEE
A0A2V5U130      L---EPAS-VATPTH-RVLRNMAIALIGSLLLGFGLLYCIGLFQDDFASLAELTNQLCEE
A0A2V6C237      L---EPAS-VATPTH-RRLRNMAIALVGSLLLGFGLLYCIGLFQDDFASLAELTNQLCEE
A0A3R8L982      LDRALPA---GAPYSPNPRSITQTSVALGLLVFFGVAFGLNLIDDRIKSAWDVEHFIGAN
A0A2E7HPU9      ELDSFSEL-PRKPSSPKQLTTLGAGTILGSVLGFALAFLLANLDNKFHTVSQVELMSGLP
A0A388PR45      RVMDKPSV-SDKPVNKNFSVNALAGLALGFFAGVGLVLLLGTLDDRLKSVRDLEGGLGIP
A0A388QR61      RVMDKPSV-SDKPVNKNFTFNALAGLLLGLFSGVGLVVLMGMLDDRIKSVKDIEAGLGVQ
A0A2A2RS01      KIQEMPSV-ADRPVNKNYYMNALTGMGLGLLVGFGLIVLMGSFDDRVKSAKDVEMGLGLP
A0A2A2Y1A7      KIQEMPSV-ADRPVNKNYYMNALTGMGLGLLVGFGLIVLMGSFDDRVKSAKDVEMGLGLP
A0A388PDH9      KIQEMPSV-ADRPVNKNYYMNALTGMGLGLLVGFGLIVLMGSFDDRVKSAKDVEMGLGLP
A0A2G4H1E7      SILDAPSV-SDRPINKNYYYAALIGFGSGLLFGIVLVFVLGALDERIKSAADIEGSLGLP
A0A2G4GZA6      NILDAPSV-SDKPINKNYYLNALVGMGSGLLFGVVLIVVIGTLDSRIKSAKDVEGSLGLP
A0A388P514      SILDQPSV-SDKPINKNYYFNALVGVGSGLLFGVVLIVVIGTLDSRIKSAKDVEDSLGLP
A0A2A2YG59      SILDAPSV-SDKPINKNYYFNALVGVGSGLLFGVVLIVVIGTLDSRIKSAKDVEDSLGLP
A0A2G4F7D5      SILDQPSV-SDKPINKNYYFNALVGVGSGLLFGVVLIVVIGTLDSRIKSAKDVEDSLGLP
D5EML0          LDRANLP---MQPLTMSRTQMVAAAIVLGAVFLVGCPLVIELIDGRLTSFQDVEQGSHKA
A0A3C1C1M3      ASEVAP----ARQIFPRPARVLLMALLLGLAVGFGLAILTEILEDRVGGIDDIEIGTGVK
A0A2E9EYJ1      HELAEPQD-VDKPARPNXKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLP
A0A258AXR6      YSDAEPE---GKPAKPNVPLHLALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVEHYLGVP
A0A1T4WVZ9      YAKAEPE---GKPAKPNVALNLALGGVLGLMLGVGLAFFLEYMDTSVKSLDDVERFLGVP
A0A3D3NZQ6      YAKAEPE---GRPAKPNVALNLALGGILGLMFGFGLAFALEFMDTSIKSLDDVERFLGVP
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      ---------QMAPIKPKKMLTLFLGIVGGLGAGFGLAFFVNFLDDSIKSQDDVESYLKLP
A0A3D4CZT6      ---------------------LSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVP
A0A1Z9KB52      -----------------------------MGXXLVIPIALEVIDNRIKSPWDIETFVGED
A0A2D5W0Q9      ------------------------------------------------------------
                                                                            

A0A2V5UAD5      VLGQVP--EVR---KRRRKSPLPL-----------------------LEIDDDRHVY---
A0A258AXL1      ACGIVP--LME---IDDRRL-VPQ-----------------------LPDGKESDAKVTT
A0A2E6T1E0      FLGYIP----------NIKT-TSI-----------------------IERDLQAHLHPQS
A0A2V5U7A0      TLGVVPDLDSLGHRPLISYAPASRAKLLPTRMGQTQLDDISTRGKDLIVAHNPLSI----
A0A355VK99      VIAELP---------------------QMSKKE-------SRNTKLFIQDEHSV------
A0A257LYL4      ------------------------------------------------------------
A0A2V6N5E0      ILGQIP------------------------KEK-------TKGKVDLLQPDDARHV----
A0A2V6NH44      VVGQIP------------------------KEK-------VKGRMALLQPDDPRHI----
A0A432FDF6      VLGVIP------------------------------------QNVGSLLDEGDESP----
A0A353DCA1      VLAVIP------------------------------------KDVGVLHKQSGMSP----
A0A3C1AXQ2      VLAVIP------------------------------------KDVAVLHRASGFNP----
A0A3D0IZR7      VLAVIP------------------------------------KGAKFLTSDDPNSR----
A0A3R5R793      VLGIIP------------------------------------KNVPILHSSDAMGP----
A0A2N8IV96      VLGIIP------------------------------------KNVPILHSSDVMGP----
R7E1V8          VLGIIP------------------------------------KNVPILHSSDVMGP----
A0A356FSV4      LIGIIP---------------------QIKKLD-------STTKAQAVASNVDRH-----
A0A3D3DET9      VLGQVP---------------------REKLVA-------SKRQPSLILPEDTRHS----
A0A355SVK9      LLGVVP---------------------QIKKLD-------AHSKAQAVASNVDRH-----
A0A2E5D7I3      VLAAVPVLEAKKLEAAEXSESXSXAKTXEGEGA-------PREMVSLARDVVFRDGLHSS
A0A2V5NYE2      ILGQVP---------------------QERAPA-------RRAEIKLIEPEDSRHS----
A0A2V6FIP7      FLGYVP--NIK---TNSVLERDLQ-----------------------AHLHPQSNA----
A0A353DI77      ILSAIQ--KLP------------------------------------PEEELLKEMESIR
A0A1V6GCZ3      VLGVIP------------QNVGLL-----------------------VDEGTESPH----
A0A3C1UJT2      VLAAVPVSEIN---GKPTDSRLVM-----------------------IESPNSTC-----
A0A2S7U0Z3      CMAAIP--ASS---KFGRQDKWQS-----------------------ILSHDPHSAN---
A0A2E0R252      VIGAMP--ASK---NTERKGSLAL-----------------------DAEDEQSQS----
A0A3E1EF48      VIGAVP--SSSSKGDGTKRELVLL-----------------------SRKD--PHA----
A0A2A2PVG8      VVAGLP--AFK---KRESRAESLE-----------------------LARDAQSKP----
A0A2E0R421      VLGAIP----D---EKNPGEGVLV-----------------------LNCKDTPLQ----
A0A2N8IR72      VIAELP--QMS---KKESKNTKL------------------------FIQDEHSVI----
A0A410ELH5      VIAELP--QMN---KKESRNTGL------------------------FIQDEHSVI----
A0A2E5EJ69      VVGAVP--KNP---EIKDDQGRLF-----------------------VTKAPNSSC----
A0A1T4WWY4      GIGLVPLSDPK---ELESLNRAPT-----------------------VGANVPNAL----
A0A3D3LEQ6      GIGLVPLTDPE---VLEEVNRSQT-----------------------VGSKVPNAL----
A0A3D3NW23      GIGLVPLTDPE---VLEEVNRSQT-----------------------VGSKVPNAL----
A0A2G4I5Z5      VLGAVP--KNK---LIKNGKGRLF-----------------------ISDDPQSLC----
A0A2E7ALI1      VLSAVP--VLE---LRKIEAAEK------------------------SHKKKEKEDSGAE
A0A178IDB9      LLGGIK--TMK---KLTEAERPNV-----------------------FRLHKDDAL----
A0A290QD69      LLGGIK--AMK---KLSETERPNV-----------------------FRLGKDEAL----
A0A2E7VDS1      LIAGIP--KIS---TIKEAERPLI-----------------------VGNELDDGL----
A0A178IFJ2      LLSEFP--VLK---NLPGDTLNHL-----------------------VLQDRDPDA----
A0A357FSP9      MLGVVP--RIK---KLDSNSKAQA-----------------------VASNIDRHV----
A0A2A2R174      VLGAVP--KNK---LIRDGKGRLF-----------------------ISDDPQSLC----
A0A1H1SWX2      LLGIIP--ELG---DVPDTEKHSL-----------------------VNSNRTSPG----
A0A290QE54      LLGIVP--DLS---GLKDDDKYSL-----------------------VLKNREAPG----
A0A1H2DTI1      ILGQMP--FEV---SLGDRSNRRL-----------------------IQPGDDRHTY---
A0A1V5L462      VIGLIP--QTK---AKITV----------------------------LRKEADDVF----
A0A2A2R3V9      VLGQIP--MDP---TLARKKGGPSL----------------------LVQDDRRHVY---
A0A3D3LGD3      VLAVVP--KNV---GILHRATG-------------------------FNPD---------
A0A350ARX4      VIGVIP--EEL---QNANGQIDL------------------------LQVNDSRHRF---
B5JIS2          LLGGIP--KLS---RVKVADRPHV-----------------------VRDNLDLAK----
A0A1H2GQN6      VLGIIP--RGV---KP-------------------------------LNKEPKDTPH---
A0A2A2RPW6      VLGAIP--KNK---LITDGKGRLF-----------------------ITDDPQSLC----
B4D1I7          VFAQIP--HSP---SDGRSESPAI-----------------------LMPEDERHAF---
A0A353F286      VLAVIP--KDV---GVLHKQSG-------------------------MSPD---------
A0A354FSA6      VLAVIP--KDV---GVLHKQSG-------------------------MSPD---------
A0A3B9GA54      VLAVIP--KDV---GVLHKQSG-------------------------MSPD---------
A0A2D7B7R6      VLAAVP--VSE---INGKPTDSRL-----------------------VMIESPNSTC---
B1ZT68          LLGAVK--TID---GLGEIERAHV-----------------------YRLHKDDGL----
W0J7C2          LLGVVK--HMG---KLGETERARI-----------------------FLSHASHDL----
A0A2E5K4P7      LVGVIP--QIR---KLDSFKKARI-----------------------IESAKDNHV----
A0A0R2XPB1      LIGVIP--FEV---NHDGDVNSVL-----------------------LRKNDDRYVF---
A0A348NQP1      LIGAIP--FEA---SNDGDENSVL-----------------------LRKNDDRYVF---
A0A357FV58      LIGAIP--FEA---SNDGDENSVL-----------------------LRKNDDRYVF---
A0A2V6F9Q9      VVGQIP--KEK---AKGKMPL--------------------------LQAEDPRHIF---
A0A2V6ME53      VVGQIP--KEK---VKGTMAL--------------------------LQPDDPRHIF---
A0A2V6NZZ3      VVGQIP--KEK---VKGTMAL--------------------------LQPDDPRHIF---
A0A2V6EBU2      VVGQIP--KEK---VKGTMAL--------------------------LQPDDPRHIF---
A0A2V6EY06      VVGQIP--KEK---VKGTMAL--------------------------LQPDDPRHIF---
A0A2V6NIJ1      VVGQIP--KEK---VKGTMAL--------------------------LQPDDPRHIF---
A0A2V6C292      VVGQIP--KEK---VKGTMAL--------------------------LQPDDPRHIF---
A0A2V6D2X0      VVGQIP--KEK---VKGTMAL--------------------------LQPDDPRHIF---
A0A2V5ZUK1      VLGQIP--KEK---AKGRVEL--------------------------LQPDDQRHVF---
A0A2V5XFN9      VLGQIP--KEK---TKGKVDL--------------------------LQPDDARHVF---
A0A2V6EZC8      VLGQIP--KEK---TKGKVDL--------------------------LQPDDARHVF---
A0A2V6I7Z5      VLGQIP--KEK---TKGKVDL--------------------------LQPDDARHVF---
A0A3B9LCP2      VLGQIP--KDK---TKGEVTL--------------------------LQPDDARHVF---
A0A3C0R669      VLGQIP--KDK---TKGEVTL--------------------------LQPDDARHVF---
A0A2V6EID2      VLGQIP--KEK---TKGKLTL--------------------------LQPDDARHIF---
A0A2V6MHB0      VLGQIP--KEK---TKGKLIL--------------------------LQPDDARHIF---
A0A2W5YWL9      VLGQIP--KEK---SKGKVQL--------------------------LQADDPRHTF---
A0A2V5NH62      VLGQIP--KEK---TKGRVSL--------------------------LQPDDARHVF---
A0A2W6A620      VLGQIP--KEK---TKGRVTL--------------------------LQPDDARHVF---
A0A2V5PIJ4      VLGQIP--REK---VKGDVML--------------------------LQQDDARHVL---
A0A2V6K2G8      VLGQIP--KEK---TKGRVDL--------------------------LQPDDMRHVF---
A0A2V5W206      ILGQIP--KEK---TKGKVDL--------------------------LQPDDARHVF---
A0A2V6MW77      ILGQIP--KEK---TKDKVDL--------------------------LQPDDARHVF---
A0A3C1VFY9      VLGNVP--REK---SPDKNTVLPL-----------------------LQPDDLRHPF---
A0A2G4GZN8      LIGTIP--RAT---VTSGPDRALL-----------------------ARQDKDRIA----
A0A348NPT1      MLGVVP--RIK---KLDSNSKAQA-----------------------VASNIDRHV----
A0A2E1KV60      MLGIIP--KVK---KLDSVSKSHI-----------------------VASSSDRHV----
A0A2D7F4D9      ILGIIP--KVK---KLDSVSKSHI-----------------------VTSTTNRHV----
A0A3R7RBR8      ILGIIP--KVK---KLDSVSKSHI-----------------------VTSTTNRHV----
A0A2E0NH28      LIGIIP--QIK---KLDSTTKAQA-----------------------VASNVDRHV----
A0A350AS32      MLGIVP--RIK---KLDTNSKAQA-----------------------VASNVDRHV----
A0A368BGT4      MLGVIP--RIK---KLDSNAKAQA-----------------------VASNVDSHV----
A0A1G3ZL71      LLGIIP--ELA---HVATDSLHTL-----------------------AILSKATPG----
A0A2T6DX88      LLGIVP--DLS---SLKDDEKYSL-----------------------VRRSEEAPG----
A0A3E1E5C8      LLGIIP--DLS---AVTDDDKYSL-----------------------LLKGPQTPG----
B1ZZ74          LLGIIP--DLA---ALKDDEKYSL-----------------------LLSGKQAPG----
A0A2E0V4K6      VLAAVP--VLS---AKRLS----------------------------AAEKSNKERQGEG
A0A2E6NAH3      MLGVIP--RIK---KLDTSTKAQA-----------------------VASNVDRHV----
A0A2A5VZA5      LLGVIP--RIK---KLDSSTKAQA-----------------------VAANVDRHV----
A0A424R295      LLGVIP--RIK---KLDSSTKAQA-----------------------VAANVDRHV----
B4CZV9          GLGVVP--QTE---ATDMFLPATA-----------------------VASDDTTKHGL--
A0A3B9FM17      LIGGIP--KIS---EVEERERPLI-----------------------VGNDLDDGL----
R7E4L8          LAGELP--LLS---GKERKKLPLV-----------------------VTNGRSFM-----
A0A0E3YV65      LLAELP--LLN---KIKTEFLPHL-----------------------LTRAADQDA----
W0J900          LLSEFP--VLK---KLPDDKLNHL-----------------------VLQDTDPDA----
A0A2T6DSN5      LLGGIK--TMK---KLSETERPNV-----------------------FRLGKDDSL----
A0A2V2SMX4      ILAQIP--REG---KAREVSGLPL-----------------------ITQNGSPHSF---
A0A317ZIW7      LLGAIP--FEK---NHDGDHTMVL-----------------------LRKSDERYIF---
A0A2D7WMI4      LISGIP--KIS---NIIENERPLI-----------------------VGNDLDDGL----
A0A2D6VHX5      LLTGIQ--KIS---EIDELRRPKI-----------------------VGDDLDDSL----
A0A2D8I214      LIGGIP--KIS---DVEEAHRPLI-----------------------VGNDLDDGL----
A0A1Z8VL41      LIGGIP--QIS---QVEETKRPLI-----------------------VGNDLDDGL----
A0A2E6TNA4      LIGGIP--QIS---QVEETKRPLI-----------------------VGNDLDDGL----
A0A1Z8RG47      LIGGIP--KIS---EVDERERPLI-----------------------VGNDLDDGL----
A0A1Z8RJJ5      LIGGIP--KIS---EVDERERPLI-----------------------VGNDLDDGL----
A0A2D7V631      LIGGIP--KIS---EVEERQRPLI-----------------------VGNDLDDGL----
A0A354RA24      LIGGIP--KIS---EVEERQRPLI-----------------------VGNDLDDGL----
A0A2E9RV62      LIAGIP--KIS---EVKEVDRPLI-----------------------VGNELDDGL----
A0A2E4AY96      LISGIP--KIS---NIDEQERPLI-----------------------VGNDLDDGL----
A0A3B9B9P4      LISGIP--KIS---NIDEQERPLI-----------------------VGNDLDDGL----
A0A2D5Y6N6      LIAGIP--KIS---EVEENQRPLI-----------------------VGNDLDDGL----
A0A2E7HSS8      LIGGIP--KIS---EIEERERPLI-----------------------VGNDLDDGL----
A0A2D8VCK3      LIGGIP--KIS---EVEERERPLI-----------------------VGNDLDDGL----
A0A350QVY4      LIGGIP--KIS---EVEERERPLI-----------------------VGNDLDDGL----
A0A2E4ZYR7      LIAGIP--KIS---TIKEADRPLI-----------------------VGNELDDSL----
A0A2E6TCV1      LVAGIP--KIS---TIKEADRPLI-----------------------VGNELDDSL----
A0A3D4HHL8      LMGIIP----F---QKYDGDILNP-----------------------IKADDDRIIF---
A0A366HV03      GLGIVP--TSS---STFLESVTRG-----------------------IESDPRKPNHV--
A0A2V2SDN0      VIGQVM--DIQ---LVKPEGELRR-----------------------EALAAQRFEF---
A0A1V6GL40      VLGQVP--REK---LVASKRQPSL-----------------------ILPEDTRHSF---
A0A2V5X6Z6      VVGQIP--AIS---IKKPKRRLGV-----------------------EALEKQRFEF---
A0A2V5VGZ7      VVGQIP--AIS---IKKPKRRLGV-----------------------EALEKQRFEF---
A0A2V5U130      VVGQIP--AIS---IKKPRRQLGV-----------------------EALEKQRFEF---
A0A2V6C237      VVGQIP--AIS---IKKSKGRLCV-----------------------EGLEKQRFEF---
A0A3R8L982      LLGIIP--SLG---DIKDHDRYKLFAVGPNAADESGGGNNNSEGAPDRRRDPERDPHTND
A0A2E7HPU9      ILATIQ--HI---------DLKVL-----------------------AQLKDEKEKQLKV
A0A388PR45      VLGTVP--KVS---ETAGPDRALL-----------------------ARQDKDRQA----
A0A388QR61      VLGTVP--KVA---ETTGPDRALL-----------------------ARQDKDRLA----
A0A2A2RS01      LLGTVP--KVT---EAVGPDRALL-----------------------ARQDKDKVA----
A0A2A2Y1A7      LLGTVP--KVT---EAVGPDRALL-----------------------ARQDKDKVA----
A0A388PDH9      LLGTVP--KVI---EAVGPDRALL-----------------------ARQDKDKVA----
A0A2G4H1E7      LIGTIP--QVV---RASGPDRALL-----------------------ARQESDRIA----
A0A2G4GZA6      LIGTIP--RVA---NVSGPDRALL-----------------------ARQDKDRIA----
A0A388P514      LIGTVP--RVA---NVSGPDRALL-----------------------ARQDKDRIA----
A0A2A2YG59      LIGTVP--RVA---NVSGPDRALL-----------------------ARQDKDRIA----
A0A2G4F7D5      LIGTVP--RIA---NVSGPDRALL-----------------------ARQDKDRIA----
D5EML0          LLGDVR--FYG-------QKKGDA-----------------------VYQAVLQKD----
A0A3C1C1M3      ILAVLP--HVK---TRKRKEIATT-----------------------SLTHQFGEL----
A0A2E9EYJ1      VLAVIP------------KDINVL-----------------------XXEXGLSPD----
A0A258AXR6      VLAVVP------------KEVGVL-----------------------HRSSGFNPD----
A0A1T4WVZ9      VLAVVP------------KDVAVL-----------------------HRTSGFNPD----
A0A3D3NZQ6      VLAVVP------------KNVGIL-----------------------HRATGFNPD----
A0A1Z8SVB5      ----------------------------------------------------------MY
A0A2V5W3Y0      ------------------------------------------------------------
A0A432FAS4      FLGYIP-----------NIKTTSV-----------------------IERDLQSHLHPQS
A0A3D4CZT6      VLAVIP----T---DVGVLHKQSG-----------------------MSPD---------
A0A1Z9KB52      LLTGIQ--KIS---EIDELRRPKI-----------------------VGDDLDDSL----
A0A2D5W0Q9      ----------------PNIKSQSL-----------------------VERDLQAHLHPQS
                                                                            

A0A2V5UAD5      ------------------------AESYRNLRSA--LL-YQGTDGQRPRV-----LLVTS
A0A258AXL1      HA----------------------NESFRIIRSS--LP-FYALPDNPKQV-----IMVTS
A0A2E6T1E0      NS----------------------AESFRTVRAA--IA-LSQRAGD-LHL-----MAVTS
A0A2V5U7A0      -Y----------------------SEAYRTIRTA--LL--LSQPGGNRKV-----ILLTS
A0A355VK99      -I----------------------AECFHILRNN--VDSMLPRPEQGGHV-----ILVTS
A0A257LYL4      -------------------------------RTN--IE--FNRKNPEDNA-----ITVVS
A0A2V6N5E0      -F----------------------AESYRNIRSS--IF-FMPYDGPRPKS-----FLVTS
A0A2V6NH44      -F----------------------AESYRNIRSS--LL-FMPYQGPRPKT-----ILVTS
A0A432FDF6      -H----------------------AEAYRVLRTN--IL-FAGRQSEKQTT-----FSVVS
A0A353DCA1      -D----------------------AEAYRILRTN--IE-F-NRKNPEDNS-----ITVVS
A0A3C1AXQ2      -D----------------------AEAYRILRTN--IE-F-NRRNPDANC-----ITVTS
A0A3D0IZR7      -F----------------------AEGYRILCAK--LN--LTGARASART-----ITVLS
A0A3R5R793      -D----------------------AEAYRILRTN--IE--FNKKGLEEIS-----LTFVS
A0A2N8IV96      -D----------------------AEAYRILRTN--IE--FNKKGLEEIS-----LTFVS
R7E1V8          -D----------------------AEAYRILRTN--IE--FNKKGLEEIS-----LTFVS
A0A356FSV4      -V----------------------TETFRSIHSA--IR--LNEESKNAKV-----FLTTS
A0A3D3DET9      -F----------------------VEAYRNLRSS--LL-YMTEAGNRPKT-----ILVTS
A0A355SVK9      -V----------------------TETFRTIHSS--LR--LNEESKNAKI-----LVTTS
A0A2E5D7I3      LY----------------------AESYRILRAA--VM--LLGDEKKRKI-----SAFSX
A0A2V5NYE2      -F----------------------LEAYRNLRSS--LL-YMVKASERPRT-----LLVTS
A0A2V6FIP7      ------------------------AEGFRTIRAA--IA--LAPKSDQYHL-----LAITS
A0A353DI77      DLPVSMKHICPTLAVPGWKTDFVHSEMFRVLRAS--IS--LLGDTNQRKI-----TMITS
A0A1V6GCZ3      ------------------------AEAYRVLRTN--LL--FSRKDDKLNT-----IAIVS
A0A3C1UJT2      ------------------------SEAFRSLRVN--IE--SMTRKKSHKV-----VLFTS
A0A2S7U0Z3      ------------------------AESIRNLRAS--VI--LLGKHDNNKV-----LLVTS
A0A2E0R252      ------------------------AEAIRTLRAG--LT--FLGTSEERRT-----FLITS
A0A3E1EF48      ------------------------SEAIRTLRTG--LT--LLGDSEERRI-----FVVTS
A0A2A2PVG8      ------------------------AESIRTLRTG--LT--FLGTAEERCT-----FLIAS
A0A2E0R421      ------------------------AEAIRTLRAG--LT--FLGTPESKRT-----FLITS
A0A2N8IR72      ------------------------AECFHILRNNVDSM--LPRPEQGGHV-----ILVTS
A0A410ELH5      ------------------------AECFHILRNNVDSM--LPRPEQGGHV-----ILVTS
A0A2E5EJ69      ------------------------AEAFRTLRAS--IS--LLGREEERRV-----ILFTS
A0A1T4WWY4      ------------------------LENFRLIRSS--IL-LNGSPKGDGRV-----IMLTS
A0A3D3LEQ6      ------------------------LENFRLIRSS--IL-LNRSPMGEARV-----IMLTS
A0A3D3NW23      ------------------------LENFRLIRSS--IL-LNRSPMGEARV-----IMLTS
A0A2G4I5Z5      ------------------------AEAFRSMRAS--LG--LLGRDEDRKV-----VFFTS
A0A2E7ALI1      ASSEKALNFSQDVVFRDGLYSSLYAESYRILRAA--VM--LLGDEKERKI-----TAFSS
A0A178IDB9      ------------------------AEAYRGIFSE--IE--IRSPVPFPKR-----ILITS
A0A290QD69      ------------------------SEAYRGVFSE--VE--IRSIVPYPKR-----ILFTS
A0A2E7VDS1      ------------------------MESFRSMFSR--IQ--MNSTADGPKS-----ILITS
A0A178IFJ2      ------------------------GEVVRGLYAQ--LK--LSSRLDAPKT-----LLVTS
A0A357FSP9      ------------------------TEAFRSIHSA--LK--ISEESKNAKV-----IVTTS
A0A2A2R174      ------------------------AEAFRSMRAS--LG--LLGREEDRKV-----VFFTS
A0A1H1SWX2      ------------------------SEAFLSVYSA--VK--IQSKLDFPKS-----ILVTS
A0A290QE54      ------------------------VESFLSVYSS--AK--IHSKLDYPKS-----ILVTS
A0A1H2DTI1      ------------------------SESFRNLRSA--LM-FMEVDGARPRT-----ILFTS
A0A1V5L462      ------------------------AESFRALRSS--IL-LHRQDSKEPRQ----VFLVTS
A0A2A2R3V9      ------------------------AESFRNVRSS--LL-FMAIDGTRPKT-----LLITS
A0A3D3LGD3      ------------------------AEAYRILRTN--IE--FNRKNRDANC-----ITVTS
A0A350ARX4      ------------------------AEACRTLRSTILLK-QSDAVHTSSQS-----ILITS
B5JIS2          ------------------------VESFMAVVAQ--LE--LTSKQEGPKS-----FVVTS
A0A1H2GQN6      ------------------------AESYRILRAR--ID--LQAHSGPGNT-----LTMIS
A0A2A2RPW6      ------------------------AEAFRTLRAA--LS--LLGRDEDRKV-----VLFTS
B4D1I7          ------------------------AEAFRSLRSS--IA-FLPVAGAPPKV-----ILITS
A0A353F286      ------------------------AEAYRILRTN--IE--FNRKNPDNNS-----ITVVS
A0A354FSA6      ------------------------AEAYRILRTN--IE--FNRKNPDNNS-----ITVVS
A0A3B9GA54      ------------------------AEAYRILRTN--IE--FNRKNPENNS-----ITVVS
A0A2D7B7R6      ------------------------SEAFRSLRVN--IE--SMTRKKSHKV-----VLFTS
B1ZT68          ------------------------TESYRGIYSA--ID--IHSTEPFPKA-----IISTS
W0J7C2          ------------------------SEAYRGIFSE--IE--VRSPLAFPKA-----LLVTS
A0A2E5K4P7      ------------------------KEAFRSIFST--LG--VNDASKDAQV-----ILNTS
A0A0R2XPB1      ------------------------AEACRNLRTS--VF-FMGDEHVKPSV-----FAVTS
A0A348NQP1      ------------------------AEACRNLRTS--VF-FMGDEHEKPSV-----FAVTS
A0A357FV58      ------------------------AEACRNLRTS--VF-FMGDEHEKPSV-----FAVTS
A0A2V6F9Q9      ------------------------AESYRNIRSS--IL-FMSYEGPRPKT-----ILVTS
A0A2V6ME53      ------------------------AESYRNIRSS--LL-FMPYEGPRPKT-----ILVTS
A0A2V6NZZ3      ------------------------AESYRNIRSS--LL-FMPYEGPRPKT-----ILVTS
A0A2V6EBU2      ------------------------AESYRNIRSS--LL-FMPYEGPRPKT-----ILVTS
A0A2V6EY06      ------------------------AESYRNIRSS--LL-FMPYEGPRPKT-----ILVTS
A0A2V6NIJ1      ------------------------AESYRNIRSS--IL-FMPYEGPRPKT-----ILVTS
A0A2V6C292      ------------------------AESYRNIRSS--IL-FMPYAGPRPKT-----ILVTS
A0A2V6D2X0      ------------------------AESYRNIRSS--IL-FMPYAGPRPKT-----ILVTS
A0A2V5ZUK1      ------------------------AESYRNIRSS--IF-FMPYEGPRPKS-----FLITS
A0A2V5XFN9      ------------------------AESYRNIRSS--IF-FMPYEGPRPKS-----FLVTS
A0A2V6EZC8      ------------------------AESYRNIRSS--IF-FMPYEGPRPKS-----FLVTS
A0A2V6I7Z5      ------------------------AESYRNIRSS--IF-FMPYEGPRPKS-----FLVTS
A0A3B9LCP2      ------------------------AESYRNIRSS--IF-FMPYEGPRPKT-----LLVTS
A0A3C0R669      ------------------------AESYRNIRSS--IF-FMPYEGPRPKT-----LLVTS
A0A2V6EID2      ------------------------AESYRNVRSS--IF-FMPYEGPRPKT-----LLVTS
A0A2V6MHB0      ------------------------AESYRNVRSS--IF-FMPYEGPRPKT-----LLVTS
A0A2W5YWL9      ------------------------AESYRNVRSS--IF-FMPYDGPRPKT-----LLITS
A0A2V5NH62      ------------------------AESYRNVRSS--IF-FMPYEGPRPKT-----MLVTS
A0A2W6A620      ------------------------AESYRNIRSS--IF-FMPYEGPRPKT-----LLITS
A0A2V5PIJ4      ------------------------SESFRNVRSS--IF-FMPYEGPRPKT-----FLVTS
A0A2V6K2G8      ------------------------AESYRNIRSS--IF-FMPYEGPRPKS-----FLVTS
A0A2V5W206      ------------------------AESYRNIRSS--IF-FMPYDGPRPKS-----FLVTS
A0A2V6MW77      ------------------------AESYRNIRSS--IF-FMPYDGPRPKS-----FLVTS
A0A3C1VFY9      ------------------------VESYRNLRSS--LL-YMAETGTRPHT-----LLITS
A0A2G4GZN8      ------------------------TEAVRSIYSA--LK--VNPAVSKTRV-----FLVTS
A0A348NPT1      ------------------------TEAFRSIHSA--LK--ISEESKNAKV-----IVTTS
A0A2E1KV60      ------------------------IENFRSMLSY--LK--ISEHSKNSNV-----FLITS
A0A2D7F4D9      ------------------------TENFRSMLSY--LK--INDQTKNSNV-----FLLTS
A0A3R7RBR8      ------------------------TENFRSMLSY--LK--INDQTKNSNV-----FLLTS
A0A2E0NH28      ------------------------TETFRSIHSA--IR--LNEESKNAKV-----FLTTS
A0A350AS32      ------------------------TETFRSIHSA--LK--LNDESKNAKV-----IVTTS
A0A368BGT4      ------------------------TETFRSIHSA--LK--LNDQSKNAKI-----ILATS
A0A1G3ZL71      ------------------------VESFLSVYSA--VK--IQSKIDYPKV-----ILVTS
A0A2T6DX88      ------------------------TESFLSIYSS--VK--IHSKLDFPKA-----ILVTS
A0A3E1E5C8      ------------------------AEAFLSVYSS--VK--IHSKLDFPKS-----ILITS
B1ZZ74          ------------------------VEAFLSVYSS--VK--IHSKLDFPKT-----VLVTS
A0A2E0V4K6      ASRDEEHLWDSGIVFRPGLQSSLYAESYRILRAS--VV--LLGDEKERKV-----SLFFS
A0A2E6NAH3      ------------------------TETFRSIHSA--LK--LSDHSKNAKV-----ILTTS
A0A2A5VZA5      ------------------------TETFRSIHSS--LK--LNDESKNAKI-----ILATS
A0A424R295      ------------------------TETFRSIHSS--LK--LNDESKNAKV-----ILATS
B4CZV9          ------------------------VENFRVIRTN--IL-SMGELSKPPHV-----VMVTS
A0A3B9FM17      ------------------------TEAFRSMYSR--IQ--MNSQTDYPKL-----ILVTS
R7E4L8          ------------------------EECFHILRNNAELM-LLPNPEEAPRI-----LFLTS
A0A0E3YV65      ------------------------AETIRNLYGQ--LK--AGSRLDLPKI-----LLVTS
W0J900          ------------------------GEIIQTLYSQ--LR--LNSRLDAPKT-----LIVTS
A0A2T6DSN5      ------------------------SEAYRGVFSE--IE--IRSVVPFPKR-----LLVTS
A0A2V2SMX4      ------------------------VEAYRNLRSS--LL--YMGNGSRPRT-----LLITS
A0A317ZIW7      ------------------------AEACRNLRTS--VF-FMGDESWKPSV-----FAVTS
A0A2D7WMI4      ------------------------GESFRSMFSK--IQ--MYSKTDYPKI-----ILVTS
A0A2D6VHX5      ------------------------TESFRSMYGK--IQ--MNSHVTGSKS-----ILVTS
A0A2D8I214      ------------------------TESFRSMFSR--IQ--MNSQTEYPKT-----ILITS
A0A1Z8VL41      ------------------------TESFRSMYSR--IQ--MNSNADYPKI-----ILVTS
A0A2E6TNA4      ------------------------TESFRSMYSR--IQ--MNSNADHPKI-----ILVTS
A0A1Z8RG47      ------------------------TESFRSMYSR--IQ--MNSNADYPKV-----LLVTS
A0A1Z8RJJ5      ------------------------TESFRSMYSR--IQ--MNSNADYPKV-----LLVTS
A0A2D7V631      ------------------------TESFRSMYSR--IQ--MNSNSDYPKV-----LLVTS
A0A354RA24      ------------------------TESFRSMYSR--IQ--MNSNSDYPKV-----LLVTS
A0A2E9RV62      ------------------------TEAFRSMYSR--IQ--MNSKTDYPKT-----ILITS
A0A2E4AY96      ------------------------AESFRSMFSK--IQ--VNSLVDFPKV-----ILVTS
A0A3B9B9P4      ------------------------AESFRSMFSK--IQ--VNSLVDFPKV-----ILVTS
A0A2D5Y6N6      ------------------------TESFRSMFSR--IQ--MNSLNDYPKT-----ILVTS
A0A2E7HSS8      ------------------------TESFRSMYSR--IQ--MNSLSDYPKL-----ILVTS
A0A2D8VCK3      ------------------------TEAFRSMYSR--IQ--MNSQTDYPKL-----ILVTS
A0A350QVY4      ------------------------TEAFRSMYSR--IQ--MNSQTDYPKL-----ILVTS
A0A2E4ZYR7      ------------------------MESFRSMFSR--IQ--MNSHVEYPKS-----MLITS
A0A2E6TCV1      ------------------------MESFRSMFSR--MQ--MNSHIDYPKS-----MLITS
A0A3D4HHL8      ------------------------AEACRNLRSS--VL-FGGDENEAHQV-----VAVTS
A0A366HV03      ------------------------LECYRVLRAH--LG-LQLGNREGAKV-----VMFTS
A0A2V2SDN0      ------------------------LESFRNIRSC--LW-FMHQNGNKPKS-----LLIGS
A0A1V6GL40      ------------------------VEAYRNLRSS--LL-YMTEAGNRPKT-----ILVTS
A0A2V5X6Z6      ------------------------LEAFRSIRSS--LL-FMSNGGTKPKT-----IVVAS
A0A2V5VGZ7      ------------------------LEAFRSIRSS--LL-FMSNGGTKPKT-----IIVAS
A0A2V5U130      ------------------------LEAFRSIRSS--LL-FMSNGGTKPKT-----IIVAS
A0A2V6C237      ------------------------LEAFRSIRSS--LL-FMSNGGTKPKT-----IIVAS
A0A3R8L982      GQGEHA------------------TEAFLSIFSA--VK--IHSRLDFPKS-----ILVTS
A0A2E7HPU9      SDPPGIELWDSRLIFRPALLQTLYTEAYRILRAS--VT--LLGKEDERKV-----SLFTS
A0A388PR45      ------------------------TEAVRAIYSA--MK--INPASAAGRV-----FLVTS
A0A388QR61      ------------------------TESVRAIYSA--MK--INPATAAGRV-----FLVTS
A0A2A2RS01      ------------------------TEAVRAIYSA--MK--VSPATANSRV-----FLVTS
A0A2A2Y1A7      ------------------------TEAVRAIYSA--MK--VSPATANSRV-----FLVTS
A0A388PDH9      ------------------------TEAVRSIYSA--MK--VSPATANSRV-----FLVTS
A0A2G4H1E7      ------------------------TEAIRSIYSA--LK--VNPAVSKARV-----FLLTS
A0A2G4GZA6      ------------------------TEAVRSIYSA--LK--VNPAVSKARV-----FLVTS
A0A388P514      ------------------------TEAVRSIYSA--LK--VNPAVSKARV-----FLVTS
A0A2A2YG59      ------------------------TEAVRSIYSA--LK--VNPAVSKARV-----FLVTS
A0A2G4F7D5      ------------------------TEAVRSIYSA--LK--VNPAVSKARV-----FLVTS
D5EML0          ------------------------ADLLESFRSI--YS--SIRMRADLSAKRKASFVITS
A0A3C1C1M3      ------------------------AEAFAGLRSV--LD--SPLYRDHSQI-----VLVAS
A0A2E9EYJ1      ------------------------AEAYRILRTN--XE--FNRKNADAXA-----ITLVS
A0A258AXR6      ------------------------AEAYRILRTN--IE--FNRKTPDANC-----LSVVS
A0A1T4WVZ9      ------------------------AEAYRILRTN--IE--FNRKNPDANC-----ITVTS
A0A3D3NZQ6      ------------------------AEAYRILRTN--IE--FNRKNRDANC-----ITVTS
A0A1Z8SVB5      GK----------------------IQMNSNVRGS--------------RS-----ILVTS
A0A2V5W3Y0      ------------------------AESYRNVRSS--IF-FMPYEGPRPKT-----MLVTS
A0A432FAS4      NS----------------------AESFRTIRAA--IS-LSQRAGDL-QV-----MAVTS
A0A3D4CZT6      ------------------------AEAYRILRTN--IE-FNRNNPED-NS-----ITIVS
A0A1Z9KB52      ------------------------TESFRSMYGK--IQ-MNSHATGS-KS-----ILVTS
A0A2D5W0Q9      NA----------------------AEGFRTVRAA--VS-LVHKSDKF-KV-----LSMTS
                                                                            

A0A2V5UAD5      AVPNEGKSTVAANLARILALGGSRVLLVDGDLRKGALHELMGMNH---E---P-GLSEML
A0A258AXL1      ARPNDGKTTVAAHLAKSFSDSGERVLLIDADLRRGTLHKAFNLGN---K---NLGLMEIL
A0A2E6T1E0      TVPSEGKSLVASNHAIVMAQTGVKTLLVDFDLRRPSVHKAFQLQS---P---R-GLSSYL
A0A2V5U7A0      PSPGEGKTATTLNLGIALAQDGYRILIIDADLRRGSCHSRIGLRN---H---R-GLSNVL
A0A355VK99      TLPGEGKTFTSANLAAAFAYAGKKVLLIDGDLRKSSLTRRLGGSG---R---K-GLTSIL
A0A257LYL4      GGAGEGKSTTLVNLAYICAQGGYTTLMIDGDLRRPRLHTFFDINN---S---V-GLTNYL
A0A2V6N5E0      AVPSEGKSTLSANLAITMALSGARTLLIDCDLRRGALRETFGISS---K---I-GFSEVL
A0A2V6NH44      AVPNEGKSTVSANLAIALALSGARILLIDGDLRRGALREQFGSDS---R---L-GFSEVL
A0A432FDF6      GGAGEGKTTTMFNLAVVFAQQGDRVLVVDSDLRRPSMHRFFKLSN---K---I-GLTNYL
A0A353DCA1      GGAGEGKSTTLVNLAYVCSQGGYTTLMVDADLRRPRLHSFFDINN---S---V-GLTNYL
A0A3C1AXQ2      GGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMHTLFDVSN---S---V-GLTNFL
A0A3D0IZR7      GGPGEGKSTTTFNLGWVCAQSGMKVLLIDGDIRRPNMHNALQIEN---T---L-GLGEYL
A0A3R5R793      GSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDN---E---V-GLTSYL
A0A2N8IV96      GSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDN---E---V-GLTSYL
R7E1V8          GSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDN---E---V-GLTSYL
A0A356FSV4      TVPSEGKSFVSSNLALTFANNGDKTLLLDGDLRLPNIARSLQVSN---D---N-GLIDYI
A0A3D3DET9      SVPNDGKSITAANLAITMANAGSRVLLVDADLRKGTLHRLFGVSP---E---P-GLSDVL
A0A355SVK9      TVPGEGKSFVSSNLALTFANHGERTLLLDADLRLPNVAKSLQLEN---D---Y-GLLNHV
A0A2E5D7I3      ALPGEGKTTTSVNYALALASQGKKTLLMDMDLRKPKVHRQFNLRR---GDLET-GMSEVL
A0A2V5NYE2      SEPNEGKSLTSANLAITMANSGSRVLLVDADLRKGVLHTLFGLPS---G---P-GLSEAL
A0A2V6FIP7      TIPAEGKSLVASNLAIVTAQTGLKTLLVDADLRRPSVHKVFRLQS---P---V-GLSSYL
A0A353DI77      SVPGEGKTFCAANLALAYAKQGTRTLLVDFDLRKPAVHKIFNEERA--A---RPGIVNVL
A0A1V6GCZ3      AGAGEGKSTTVFNLAAVFAQSGQRTIIVDSDLRRPTLHKMLRVTN---A---I-GLTNYL
A0A3C1UJT2      SIPSEGKTFTSINYASSLAQQGHRTLLVDMDLRKPAVGPEFKLGE---E---YVGVSDLL
A0A2S7U0Z3      AIPGEGKTTVAAELAAAFAMNKERTLLVDLDLRRPALSGTFPDLD---G---GPGIVEVL
A0A2E0R252      AVPGEGKSWVASNLALSFASQGDRTLLIDGDLRKPVQSQVFDYDK---E---HPGLSDHL
A0A3E1EF48      SLPGEGKSWISANLACGFAQQGERTVLIDADLRKGVLHSTFNLSR---E---APGVTNLL
A0A2A2PVG8      SVPGEGKSWVASNLAHSFALQGDRTLLIDADMRRPVQGEVFGYGR---E---PKGLADVL
A0A2E0R421      SVPNEGKSWVASNLALAFAKQNERTLLIDGDLRRPRIHKIFGFDR---D---EAGLSDHL
A0A2N8IR72      TLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGGSG---R---K-GLTSIL
A0A410ELH5      TLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGGSG---R---K-GLTSIL
A0A2E5EJ69      AVPSEGKTFCSVNYAIANASQGKKTLIMDFDLRRPSVGDTFHIDR---K---TPGVTDLL
A0A1T4WWY4      ARPSEGKTTVSSNVAWAFSSLGEKTLLIDCDLRRGRVHEVIGASN---A---V-GMTDLL
A0A3D3LEQ6      ARPGEGKTTVSANVAWAFSSMGEKTLLIDCDLRRGRVHNVAGVPN---L---P-GLTRLL
A0A3D3NW23      ARPGEGKTTVSANVAWAFSSMGEKTLLIDCDLRRGRVHNVAGVPN---L---P-GLTRLL
A0A2G4I5Z5      AVPSEGKSFCCVNYAVCYAQQGRRTLIIDFDLRKPTLAESFGVEG---E---HFGVSDVL
A0A2E7ALI1      ALPGEGKTTTSINYALATASQGKKTLLLDMDLRKPKVHRQFNLRRSELE---K-GMSEVL
A0A178IDB9      SVPGEGKSLTASNMAAVFAAHGRRTLLVDCDFRRPSLRRYFGTAP---G---T-GLLSWL
A0A290QD69      SIPSEGKSLTASNMAAVFAAHGKKTLLVDCDFRRPTLRRYFGTQS---G---V-GLLPWL
A0A2E7VDS1      AIPSEGKSLLAANLAYSCANHGRRTILLDFDLRRPGLHKFCGVSN---D---K-GLLTLI
A0A178IFJ2      TIPGEGKSFVASNLATAFAAHGLRTLIIDGDLRRPVQHRLADAPN---T---H-GLLRWL
A0A357FSP9      TVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSLQLEN---D---F-GMLDHI
A0A2A2R174      AVPSEGKSFCCVNYAVAYAQQGKRTLIIDFDLRKPTLAESFGIKE---D---HFGVSDVL
A0A1H1SWX2      TIPGEGKTMISCNLAGSFARHGKKVLLIDCDMRRPMLHRHFKLTN---E---A-GLIAWF
A0A290QE54      TIPGEGKTLVSSNLAASFARHGKRTLLIDCDLRRPMVHRHFNQPN---D---N-GLITWF
A0A1H2DTI1      ASPDEGKTTVATNFAITLAMLEGRVLLVDADLRRGGLNRLLDIDA---P---L-GFTDVL
A0A1V5L462      CAPAEGKSTVSSNLAVTLAYSGAKTLLIDCDLRRGHLHNKFGIDR---D---P-GLAELL
A0A2A2R3V9      AIPNEGKSTFASNLAITMAFAGSRVLLVDADLRRGRIHDAFSVSN---Q---R-GLSDVL
A0A3D3LGD3      GGAGEGKSTTLCNLAVVCAQGGYSVLLIDADLRRPSMHTHFDAGN---T---T-GLTNFL
A0A350ARX4      ATPSEGKSTISANLAIALSHLGKRVLLIDADMRRGGVHHLFSLSA---E---N-GLSDLL
B5JIS2          TTTSEGKSTIAANVASGFVQIKRKTIIIDGDLRRPCLHQFNRIKK---S---G-GLIRWA
A0A1H2GQN6      GGPGEGKSTTLFNLAHVCAEAGQSVIILDADLRRPSQHTILDIAS---G---P-GLADHL
A0A2A2RPW6      AVPSEGKSFTGANYAVAHAQQGKKTLIIDLDLRKPSLSETFGVSS---N---QIGATDVM
B4D1I7          AVPNEGKSTVAVNFAITLALAGSRVLLVDGDLRRGELHRSFGLTN---D---A-GFGDVL
A0A353F286      GGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFDINN---S---V-GLTNYL
A0A354FSA6      GGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFDINN---S---V-GLTNYL
A0A3B9GA54      GGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFDINN---S---V-GLTNYL
A0A2D7B7R6      SIPSEGKTFTSINYASSLAQQGHRTLLVDMDLRKPAVGPEFKLGE---E---YVGVSDLL
B1ZT68          SMPGDGKSLTASNLAAAFAAHGRRTLLVDCDLRRPVLHRYFGVDL---S---N-GWIRAL
W0J7C2          SVPAEGKSLLCCNLAAVFASHKRRTLLVDCDLRRPTLHRLFGVKP---D---T-GWVDWL
A0A2E5K4P7      TIPGEGKSFVSTNLAFTYAESGNRVLLLDCDLRLPNIAKSLQLEL---T---T-GLLDYV
A0A0R2XPB1      AIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLHHLMQLNR---E---N-GFSDIL
A0A348NQP1      AIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLHHLMQLNR---E---N-GFSDIL
A0A357FV58      AIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRLHHLMQLNR---E---N-GFSDIL
A0A2V6F9Q9      AIPNEGKSTVSANLAIALALSGARVLLIDGDLRRGTLREQFNSNS---R---L-GFSEVL
A0A2V6ME53      AVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNS---R---V-GFAEVL
A0A2V6NZZ3      AVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNS---R---V-GFAEVL
A0A2V6EBU2      AVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNS---R---I-GFAEVL
A0A2V6EY06      AVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNS---R---I-GFAEVL
A0A2V6NIJ1      AVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNS---R---V-GFAEIL
A0A2V6C292      AVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGVLREQFGSNS---R---V-GFSEVL
A0A2V6D2X0      AVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGVLREQFGSNS---R---V-GFSEVL
A0A2V5ZUK1      AVPSEGKSTVSSNLAITMALSGAKVLLIDCDLRRGAIREAFGIDS---K---I-GFSEVL
A0A2V5XFN9      AVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFGITS---K---I-GFSEVL
A0A2V6EZC8      AVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFGITS---K---I-GFSEVL
A0A2V6I7Z5      AVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFGITS---K---I-GFSEVL
A0A3B9LCP2      AVPNEGKSTIAANLAITMALSGAPTLLIDADLRRGALREAFGISS---E---I-GFSEVL
A0A3C0R669      AVPNEGKSTIAANLAITMALSGAPTLLIDADLRRGALREAFGISS---K---I-GFSEVL
A0A2V6EID2      AVPNEGKSTIAANLAITMALSGARTLLIDADLRRGALREAFGISS---K---L-GLSEVL
A0A2V6MHB0      AVPNEGKSTIAANLAITMALSGARTLLIDADLRRGALREAFGISS---K---L-GLSEVL
A0A2W5YWL9      AVPSEGKSTISANLAITMALSGARTLLIDGDLRRGALREQFGVSS---R---I-GFAEAL
A0A2V5NH62      SVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALREAFGISS---K---I-GFSEVL
A0A2W6A620      SVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALRESFGVSS---K---I-GFSEVL
A0A2V5PIJ4      AIPNEGKSTVSANLSITMALAGARTLLIDGDLRRGALRDAFGVSS---K---I-GFSEVL
A0A2V6K2G8      AVPSEGKSTVSANLAITMALSGARTLLIDCDLRRGALREAFGITS---K---I-GFSEVL
A0A2V5W206      AVPSEGKSTLSANLAITMALSGARTLLIDCDLRRGALRETFGISS---K---I-GFSEVL
A0A2V6MW77      AVPSEGKSTISANLAITMALSGARTLLIDCDLRRGGLREAFGISS---K---I-GFSEVL
A0A3C1VFY9      AVPNDGKSVTAANLAITLATGGSRVLLVDGDLRKGSLHSRFKIQA---D---T-GLSESL
A0A2G4GZN8      TRPSEGKTFVATNLALLFAQHSERVLVIDADLRLPNVGPSLGFTG---D---G-GLSKWF
A0A348NPT1      TVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSLQLEN---D---F-GMLDHI
A0A2E1KV60      TTPSEGKSFISSNLALSFSAHGEKVLLLDADLRLPNVAKSLQLEN---D---S-GVIDFI
A0A2D7F4D9      TVPSEGKSFISSNLALSFASNGEKVLLLDGDLRLPNVAKSLQLEN---E---S-GVLDYI
A0A3R7RBR8      TVPSEGKSFISSNLALSFASNGEKVLLLDGDLRLPNVAKSLQLEN---E---S-GVLDYI
A0A2E0NH28      TVPSEGKSFVSSNLALTFANNGDKTLLLDGDLRLPNIARSLQVSN---D---N-GLIDYI
A0A350AS32      TVPGEGKSFVSSNLALTFANHGEKTLLLDGDLRLPNVARSLQLEN---D---F-GLLDHV
A0A368BGT4      TVPGEGKSFVSSNLSLTFANHGEKTLLIDGDLRLPNVARSLQLKN---D---L-GLLDHV
A0A1G3ZL71      TIPGEGKTLVSCNLAGSFARHGRSTLIIDCDMRRPMLHRHFKMEN---D---A-GLLAWA
A0A2T6DX88      TIPGEGKTLVSCNLAASFARHGKSTLIVDCDLRRPMLHRRFGKEN---E---A-GLLTWF
A0A3E1E5C8      TIPGEGKTLIACNLAGSFARHGKRTLLIDCDLRRPMLHRNFKQEN---L---H-GLITWF
B1ZZ74          TIPGEGKTLISCNLAGSFARHGKNTLLIDCDLRRPMLHRHYKQQN---N---A-GLITWF
A0A2E0V4K6      ALPGEGKTTTSINYALATASQGRKTLLLDMDLRKPRVHRQLGRRRSEQG---K-GMAEIL
A0A2E6NAH3      TVPGEGKSFVSSNLSLTFANHGEKTLLLDCDLRLPNVARSLQIEN---D---L-GMLDYV
A0A2A5VZA5      TVPSEGKSFVSSNMALTFANHGERTLLLDADLRLPNIASSLQLPN---E---F-GLLDHI
A0A424R295      TVPSEGKSFVSSNMALTFANHGERTLLLDADLRLPNIASSLQLPN---E---F-GLLDHI
B4CZV9          AMPKEGKTVVSSNLAASFALTGAKTLLIDTDLRRGRLHRLFGYRK---E---P-GLSNVL
A0A3B9FM17      AIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLHKFCNLEN---S---K-GLLSLV
R7E4L8          TRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFYGGKN---A---R-GLVHLL
A0A0E3YV65      TLPGEGKSFVASNLAASFASHGIKTLLVDTDFRRPTLHRYYGQSN---D---A-GLLRWL
W0J900          TVPGEGKSFVASNLATAFAAHGMRTLIIDGDLRRPVQHRLAGAPN---T---H-GLLRWL
A0A2T6DSN5      SVPSEGKSLTASNLAAVFAAHGRRTLLVDCDFRRPTLRRYFGATA---G---V-GLLPWL
A0A2V2SMX4      SAPGEGKSLTAENLGAILANTGSRVLLVDGDLRKGVLHSRFGLDA---M---P-GLTEVL
A0A317ZIW7      AVPSEGKSTVSANLAVALSFSHSKVLLVDADLRRGRLHKLMNLDF---D---G-GLTDVL
A0A2D7WMI4      AIPSEGKSLISANLAYTCANHGKNTILIDFDLRRPGLHKFAGLDN---E---S-GIITLV
A0A2D6VHX5      AIPSEGKSLISANFAHTCANHGSKTILIDFDLRRPGLHNFCDESN---D---E-GVMTIL
A0A2D8I214      AIPSEGKSLISANLAYSCANHGRRTVLVDFDLRRPGLHKFCGIEN---K---T-GLVSLV
A0A1Z8VL41      AIPSEGKSLISANLAXSCANHGRKTILIDFDLRRPGLHKFCSITN---D---N-GLLTLI
A0A2E6TNA4      AIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLHKFCSISN---D---K-GLLTLI
A0A1Z8RG47      AIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLHNLCNITN---E---K-GIVTLV
A0A1Z8RJJ5      AIPSEGKSLISANLAFSCANHGRKTILIDFDLRRPGLHNLCNITN---E---K-GIVTLV
A0A2D7V631      AIPSEGKSLISANLAYSCANHGRKTILIDFDLRRPGLHNFCNITN---E---K-GIVSLV
A0A354RA24      AIPSEGKSLISANLAYSCANHGRKTILIDFDLRRPGLHNFCNITN---E---K-GIVSLV
A0A2E9RV62      AIPSEGKSLLAANLAYSCANHGRKTILVDFDLRRPGLHKFCGVNN---D---R-GLLTLI
A0A2E4AY96      AIPSEGKSLISTNLAFTCANHGKKTILIDFDLRRPGLHKFVGLEN---E---G-GLIPII
A0A3B9B9P4      AIPSEGKSLISTNLAFTCANHGKKTILIDFDLRRPGLHKFVGLEN---E---G-GLIPII
A0A2D5Y6N6      AIPSEGKSLISANLAYSCANHGKKTILIDFDLRRPGIHKFCNITN---E---K-GLLSLI
A0A2E7HSS8      AIPSEGKSLISANLAHSCANHGRKTILIDFDLRRPGLHKFCNMEN---E---R-GLLSLV
A0A2D8VCK3      AIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLHKFCNLEN---S---K-GLLSLV
A0A350QVY4      AIPSEGKSLISANLAYSCANHGRKTILVDFDLRRPGLHKFCNLEN---S---K-GLLSLV
A0A2E4ZYR7      AIPSEGKSLLAANLAYSCANHGRRTILIDFDLRRPGLHKFCGVSN---D---R-GLLTLV
A0A2E6TCV1      AIPSEGKSLLAANLAYSCANHGRRTILIDFDLRRPGLHKFCGVSN---D---R-GLLTLV
A0A3D4HHL8      SVPGEGKSTMAANLAVTLAFAGKKTLLLDADLRRGVLHNAFNVPN---D---K-GLSDVI
A0A366HV03      ARPSEGKTVTAANLAWTLQSIGAKTLLVDLDFRKGRVHNLFGVDR---Y---P-GFCQAL
A0A2V2SDN0      SVPQEGKSTVALYLAATMAIGGSKVLLIDGDMRRAKLHRHFGVAS---S---P-GLAEIL
A0A1V6GL40      SVPNDGKSITAANLAITMANAGSRVLLVDADLRKGTLHRLFGVSP---E---P-GLSDVL
A0A2V5X6Z6      SVPEEGKSTVALYLAATLAKGNSRVLLIDADMRRTALHKFFGAAS---S---P-GLAEVL
A0A2V5VGZ7      SVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFGTAS---S---P-GLAEIL
A0A2V5U130      SVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFGTAP---R---P-GLAEIL
A0A2V6C237      SVPEEGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFGTAS---S---P-GLAEIL
A0A3R8L982      TIPGEGKTLISCNLAGAFARHGRRTLLIDCDLRRPTIHRHFGIEN---N---A-GLLAWF
A0A2E7HPU9      SIPGEGKTTTSSNFAIAAAQQGKKTILVDFDLRKPAVHKAFGLKRRDLP---T-GLTEVL
A0A388PR45      TRPGEGKTFVATNLALAFAQHAERVIVVDADLRLPNVGPSLGFAG---D---G-GVSRWF
A0A388QR61      TRPGEGKTFVATNLALTFAQHSERVIVVDADLRLPNVGPSLGFAG---D---G-GVSRWY
A0A2A2RS01      TRPGEGKTFVVTNLALSFAQHAERVLVIDADLRLPNVGPSLGFSG---D---G-GVSRWF
A0A2A2Y1A7      TRPGEGKTFVVTNLALSFAQHAERVLVIDADLRLPNVGPSLGFSG---D---G-GVSRWF
A0A388PDH9      TRPGEGKTFVATNLALSFAQHAERVLVIDADLRLPNVGPSLGFSG---D---G-GVSRWF
A0A2G4H1E7      TRPSEGKTFVATNLAMIFAQHSERVLIIDADLRLPNVGPTLGFTG---D---A-GLSKWF
A0A2G4GZA6      TRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTG---D---G-GLSKWF
A0A388P514      TRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTG---D---G-GLSKWF
A0A2A2YG59      TRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTG---D---G-GLSKWF
A0A2G4F7D5      TRPSEGKTFIATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTG---D---G-GLSKWF
D5EML0          SVPNEGKSMVACNLSAVIAKHNYRVLLVDCDLRNPSLHRAHGVED---D---A-GLCPWF
A0A3C1C1M3      SLPEEGKTTTSCNLATACALNGQKTLLIDFDLRRPRVGNIFPRPE---A---VCGLLEYL
A0A2E9EYJ1      GGAGEGKSTTLVXLAYVCAQGGYNTLMIDGDLRRPQLHTFFNINN---S---V-GLTNYL
A0A258AXR6      GGAGEGKSTTMVNLAYVCAQGGYNVLLIDADLRRPSLHTHFDVSH---A---T-GLTNFL
A0A1T4WVZ9      GGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMHTLFDVSN---A---V-GLTNYL
A0A3D3NZQ6      GGAGEGKSTTLCNLAVVCAQGGYSVLLIDADLRRPSMHTHFDAGN---T---T-GLTNFL
A0A1Z8SVB5      AIPSEGKSLISANYAHTCANHGSKTILIDFDLRRPGLHNFCNESN---D---A-GVMTIL
A0A2V5W3Y0      SVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALREAFGVSS---K---I-GFSEVL
A0A432FAS4      TIPAEGKSLVASNHAIVMAQTGAKTLLVDFDLRRPSVHKAFQLQS---P---R-GLSSYL
A0A3D4CZT6      GGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFDINN---S---V-GLSNYL
A0A1Z9KB52      AIPSEGKSLISANFAHTCANHGSKTILIDFDLRRPGLHNFCDESN---D---E-GVMTIL
A0A2D5W0Q9      TIPSEGKSLVASNLAIVTAQTGVKTLLIDADLRRPSMHKAFQMQS---P---I-GLSAYL
                  . :**:      .          :::* *:*                     *     

A0A2V5UAD5      RCPEDLEKI-I-------QTNSLPNFFFVS---SGGRLS------NPGDLFLNPALSQVL
A0A258AXL1      ADRVKWNDA-V-------RSSGVENLDFIS---RGNDSA------RGHDLLSSSRFKEFL
A0A2E6T1E0      LGKVDSIDAIV-------HQTEVPNLDVIC---CGAVPN------NPSELSGSQRMRDFV
A0A2V5U7A0      GGE-MPIEQLI-------QPTSIAGLSLVT---RGVCPP------NPSELLGTRKMKELV
A0A355VK99      LRQ-NPDTAGV-------IRPVGEDTRGMDVLYTGPTVP------NPVTLLSHPLLGQIL
A0A257LYL4      TTE-LMLEDVI-------LQTPVDNLYFMP---SGILPA------DAAGILNSRRMSELI
A0A2V6N5E0      KQE-VNWREVV-------VPTAYETLFVLP---RGKTLS------QPSEHLLRESTEALL
A0A2V6NH44      QQE-VPWQEVV-------MPTTYPSLFLLT---RGKALP------QPSEHLLRDSTDQFL
A0A432FDF6      LGQ-ATIEEVI-------QTTELPSLHFIP---SGKLPS------SSMGILSSAKMKEFV
A0A353DCA1      TTD-LALEDVI-------LQTPVDNLYFLP---SGILPA------DAAGILNSRRMSELL
A0A3C1AXQ2      TTN-VQLEEVV-------VRTPVENLYFLP---SGMLPA------DSAGVLNSQRMSELI
A0A3D0IZR7      AGQ-ASLDELI-------QSTAIPNLEILT---AGSLGP------EELGGFSRSRLATLM
A0A3R5R793      LED-YPLEEVI-------FQTPIENLYVMP---AGPTPF------DPSGALNSRKFNELL
A0A2N8IV96      LED-YPLEEVI-------FQTPIENLYVMP---AGPTPF------DPSGALNSRKFNELL
R7E1V8          LED-YPLEEVI-------FQTPIENLYVMP---AGPTPF------DPSGALNSRKFNELL
A0A356FSV4      DHD-VDINAVI-------VNEVYPHLDVLP---AGGKSK------NPTQILNSAKYSSLL
A0A3D3DET9      AKG-TAWETTV-------SATKIANLHILP---AGTFTA------RSSELFISEATQRFL
A0A355SVK9      DKG-VSLDELI-------IKEVYPNLDVLP---TGGKSK------NPTQVLNSAKFEAML
A0A2E5D7I3      SNQ-CDASEAV---------TKTPGIERLDAIFAGGKAP------NPGELLREEAISKLF
A0A2V5NYE2      SQG-LNWSEAV-------QATRTPNLFLLP---RGAITH------KSSEFFIGEVTERFL
A0A2V6FIP7      MEKVSRVDEFI-------HTTEVPHLDVVC---CGAVPS------SPSELAGSKRMRQFL
A0A353DI77      NGTAAANQAIT-------VYPGLDTLSVIY---SGPKSP------NPGELLEPGRLRDLV
A0A1V6GCZ3      LRQ-NTLEEVI-------QTTSLPTLDFLS---SGKLPS------SSLGILSSTQMKDLI
A0A3C1UJT2      QSE-----DKLGQFPDLAIYEATEKLFVLH---GGSHIS------NPSEHISGSAIEELI
A0A2S7U0Z3      AGQ-ASIQDVF-------SDTEIENLTVVC---SGAKAP------NPSELLNEGEFNSLL
A0A2E0R252      SLN-RPLKEVVM------KTRESENLFIMP---AGSRSA------NPSELLAGKGLKGAI
A0A3E1EF48      SRT-SSLAEVIH------QT-EIENLWFVP---GGGKSA------NPAELLGGRHLGTFL
A0A2A2PVG8      SLG-TPLKEVIL------RSEVSEDLFLIP---AGSWSA------NPAELLSGKSLRPLL
A0A2E0R421      SLR-TPLNKVVK------PTDKSGKLYVLL---AGSPSA------SPSELLASKALPALV
A0A2N8IR72      LQQTTDTTGIIRP-----LGENSRGMDILY---TGPMVP------NPVTLLSHPLLGHIL
A0A410ELH5      LQQSSDTTGIIRP-----LRENSRGMDILY---TGPMVP------NPVTLLSHPLLGQIL
A0A2E5EJ69      LAN-KTLDEVA-------LKTDFENLTLIP---AGSTVP------NPSELIASDHVKKLI
A0A1T4WWY4      TGR-ASLSECV-------QKVEAENLWAIT---RGMVVP------GTTELLNSGVFAAIL
A0A3D3LEQ6      TGQ-ATLEECL-------VKSPAENLWLLP---RGQVIA------GTTELLNTEVFSQLL
A0A3D3NW23      TGQ-ATLEECL-------VKSPAENLWLLP---RGQVIA------GTTELLNTEVFSQLL
A0A2G4I5Z5      LGK-VPLDQCV-------QKTRFDNLFLLT---AGTMVP------NPAELLSGQWTAKLI
A0A2E7ALI1      SNQCTPEEALT-------KTPGIETLDAIF---AGGKAP------NPGELLREGMIEKLF
A0A178IDB9      RAHPDDGADTPLDLATLGIATVENNLHLLP---AGHAIK------NPTEIIDQIAHSELF
A0A290QD69      RENGSNAA-AQVETQKMGIVTIAPGLDLLP---AGDAIK------NPTEVIDQLAHCDLF
A0A2E7VDS1      NEI---HGEHGTEPERNALTEIYPNLYVLP---SGGKTR------AATEMLARPDFDILL
A0A178IFJ2      DKG-GKSGGPLANDPDLDLLRPAPNLFVLR---AGGTSR------RISELLDNEKLKGLF
A0A357FSP9      EKE-VALDEVI-------MKAVYPNLDVLP---SGGKSK------NPTQVLNSAKFEAML
A0A2A2R174      LNK-AQLEQAV-------QTTRFDNLFLLT---AGTTVP------NPAELLSGQWTSKLI
A0A1H1SWX2      EAG-AKIPADPFTDASLGFTKVDENLFLLR---SGGRSK------SPTELLETAVFGQFI
A0A290QE54      EHG-ASLDGDLTENQHLGITRLSENFSLLC---SGGRSK------TPTEILENPAFGQLL
A0A1H2DTI1      LHG-ADWRKAV-------VPSKHKNLSVMV---CGKYTS------QGAELFLSPITDGIL
A0A1V5L462      EHPEMDVQDVI-----LVGDQELGNLSVIS---AGRPQE------NPGDLFLNERMDAIL
A0A2A2R3V9      SNQ-MNWRDAI-------QESAAYHFHIIP---RGPTPP------NPGELFLSSLVPSIF
A0A3D3LGD3      TTN-VRMEDVV-------VRTAVENLYFLP---SGLLPA------DSAGILNSQRMSDLI
A0A350ARX4      SCE-SDFDGYV-------QQTQHAKLDLIA---NGRSLL------NSGELLLSERMDNLL
B5JIS2          EEG-YPMDDIYGEDSPLGIQKLKGGAYLLP---AGGVFP------LPSKLLVSTKIDALL
A0A1H2GQN6      IRG-VPIADLI-------RETAIPNLHIIP---AGEDAH------DAISRFDNQVLREII
A0A2A2RPW6      LGR-EPFEKGV-------QTTRFENLFLMT---AGKMVP------NPAELLAGPWAKQLI
B4D1I7          SGR-KSLDDAI-------QLTLVPGLMLLS---RGRGVP------NPGELYLGRSADEFL
A0A353F286      TTD-LALEDVI-------LQTPVDNLYFMP---SGILPA------DAAGILNSRRMSELL
A0A354FSA6      TTD-LALEDVI-------LQTPVDNLYFMP---SGILPA------DAAGILNSRRMSELL
A0A3B9GA54      TTD-VALEDVI-------LQTPVDNLYFMP---SGILPA------DAAGILNSRRMSELL
A0A2D7B7R6      QSE-----DKLGQFPDLAIYEATEKLFVLH---GGSHIS------NPSEHISGSAIEELI
B1ZT68          ATSAAGGQPPP---LPTTIA-FSENLDLLP---SGGVAK------NPTETLERFVTSGML
W0J7C2          ETDPA--QRPT---LPVGIVPVADHLDLLP---AGRSLG------RPTELLDQLSRRETL
A0A2E5K4P7      QGT-ATLEEVI-------VPGVFTNLDILP---AGGRSR------TPMTIFNNEYFPFLM
A0A0R2XPB1      EGS-LTLDSAV-------QSSSYEHLDFVS---IGGYPD------HPAELLMSKYMDQFI
A0A348NQP1      DGN-LTLDNAV-------QSTSYKHLDFVS---IGGYPD------HPAELLMSEYMDQFI
A0A357FV58      DGN-LTLDNAV-------QSTSYKHLDFVS---IGGYPD------HPAELLMSEYMDQFI
A0A2V6F9Q9      RQE-VPWSEVV-------MPTAYHSLSLLT---RGKPLT------QPSEHLLRDSTDQFL
A0A2V6ME53      QQE-VPWQEVV-------MPTTYPSLFLVT---RGKTLP------QPSEHLLRDSTDQFL
A0A2V6NZZ3      QQE-VPWQEVV-------MPTAYPSLLLVT---RGKTLA------QPSEHLLRDSTDQFL
A0A2V6EBU2      QQE-VPWQEVV-------MPTAYPSLLLVT---RGKTLA------QPSEHLLRDSTDQFL
A0A2V6EY06      QQE-VPWQEVV-------MPTAYPSLLLVT---RGKTLA------QPSEHLLRDSTDQFL
A0A2V6NIJ1      QQE-VPWQEVV-------MPTVYPSLFLLT---RGKALT------QPSEHLLRDSTDQFL
A0A2V6C292      QQE-VPWQEVV-------MPTAYPSLFLLM---RGKALA------QPSEHLLRESTDQFL
A0A2V6D2X0      QQE-VPWQEVV-------MPTAYPSLFLLM---RGKALA------QPSEHLLRESTDQFL
A0A2V5ZUK1      KGE-VNWREVV-------VPTAYETLFVLP---RGKTLG------QPSERLLHETTDVLL
A0A2V5XFN9      KQE-VNWREVV-------VPTAVPTLFVLP---RGKPLS------QPSEHLLRESTEALL
A0A2V6EZC8      KQE-VNWREVV-------VPTAVPTLFVLP---RGKPLS------QPSEHLLRASTEALL
A0A2V6I7Z5      KQE-VNWREVV-------VPTAVPTLFVLP---RGKPLS------QPSEHLLRESTEALL
A0A3B9LCP2      KQE-VNWQEVV-------VPTFYPSLFVLP---RGKISA------QPSEHLLRDSTDAIL
A0A3C0R669      KQE-VNWQEVV-------VPTFYPSLFVLP---RGKISA------QPSEHLLRDSTDAIL
A0A2V6EID2      KQE-VNWQEVV-------VPTSYPSLFILP---RGKSLS------QPSEHLLRDSTDVLL
A0A2V6MHB0      KQE-VNWQEVV-------VPTSYPSLFILP---RGKSLS------QPSEHLLRDSTDVLL
A0A2W5YWL9      KQE-VNWREVV-------VPTSCSNLSLLP---RGKTVA------QPSEHLLRDSTDQML
A0A2V5NH62      KQE-VNWQEVV-------VPTTYENLFVLP---RGKTLG------QPSEHLLRDSTDALL
A0A2W6A620      KQE-VNWQEVV-------VPTSYPNLYLMP---RGKTLG------QPSEHLLRESTDQLL
A0A2V5PIJ4      QQE-VNWRQVV-------VPTSYPNLFLMP---RGKTIG------QPSEFLLRESTDALL
A0A2V6K2G8      KQE-VNWREVV-------VPTAVSTLFVLP---RGKTLG------QPSEHLLRESTEALL
A0A2V5W206      KQE-VNWREVV-------VPTAYETLFVLP---RGKTLS------QPSEHLLRESTEALL
A0A2V6MW77      KQE-VNWREVV-------VPTAYETLFVLP---RGKTLS------QPSEQLLRDSTEALL
A0A3C1VFY9      AQG-MDWHKAV-------KETTVGNLFLLP---RGASTQ------HSSELFLGPVMGKFL
A0A2G4GZN8      NAE-MTLDDAI-------VRDVAPGLDVLP---VGLSCK------NPTQVINNPKFLAMI
A0A348NPT1      EKE-VALDEVI-------MKAVYPNLDVLP---SGGKSK------NPTQVLNSAKFEAML
A0A2E1KV60      NGD-DSISNFI-------VKDVYPNFDVLP---SGGKSK------NPTAVLSDEKYQSMM
A0A2D7F4D9      QGE-GTFDSYI-------AKEVYPNLDILA---SGGKAK------NPTAILNDSKFESML
A0A3R7RBR8      QGE-GTFDSYI-------AKEVYPNLDILA---SGGKAK------NPTAILNDSKFESML
A0A2E0NH28      DHD-VDINAVI-------VNEVYPHLDVLP---AGGKSK------NPTQILNSAKYSSLL
A0A350AS32      DKD-VAIDEVI-------IKEVYPNLDVLP---SGGKSK------NPTQVLNSAKFEAMF
A0A368BGT4      EKG-VSLEDII-------IKDVCPNLDVLP---TGGKSK------NPTQVLNSAQFEEML
A0A1G3ZL71      EAG-ASLDGDLTTDPKLGLARIADNLMLLR---SGGRSK------VPTELLEKPEFGELI
A0A2T6DX88      EKG-GKVEGDLANDPTLGIVKLEDNLSLLR---SGGRSK------IPTELLEDPRFGQLI
A0A3E1E5C8      EGG-AKLDGDLSTDPSLGIIKLADNLSLLC---SGGRAK------SPTELLENPAFGQLL
B1ZZ74          EAG-SPLDGELASTPALGIIKISENLSLLC---SGGRSK------SPTEFLENPVFGQLL
A0A2E0V4K6      ARQCPPEEAVC-------QDVGHGNLDAVF---AGGKVR------NPGELLKPGAIRELL
A0A2E6NAH3      ENG-VSLDEVI-------VKEVYPNLDVLS---TGGKSK------NPTQVLNSAQFEAMF
A0A2A5VZA5      EQG-SRLDDMI-------VSEVYPNLDVLP---SGGKSK------NPTQVLVSAQFEAML
A0A424R295      EQG-SRLDDMI-------VSEVYPNLDVLP---SGGKSK------NPTQVLVSAQFEAML
B4CZV9          LGE-CTLEDAF-------RPSGQENLTVLS---AGRHLD------HGTELLGSAQFSELL
A0A3B9FM17      NDV-GKPGQDVQNCISESLTEVHPNLFLLP---SGGKTR------AATEMLEQNDFSTVI
R7E4L8          MNPQVSPDSVLQ------SGKRFPGFDLVT---AGPVPP------NPVALLTQGRLEELL
A0A0E3YV65      DTK-SKTEPALLRDPALGITAFGPSLHLLR---SGGTTR------RSTEILDSAAFRDLL
W0J900          DKG-GRSDGPLAGDPDLGLLRPAPNLFVLR---AGGISR------RISELLESKKLKALI
A0A2T6DSN5      REN-AHRPDVQIDAHKMGIMNIGPAFDLLP---AGDAIK------NPTEVIDQIASCDLF
A0A2V2SMX4      ADG-KPVRDVI-------RETTIPNLWLLP---RGSTTH------HSSELFISQAAADFL
A0A317ZIW7      EGR-KEMEEVI-------QRSTYDNLDFVS---IGGHPD------HPAELLMSDSMEQFI
A0A2D7WMI4      NE-MSQNPNFIDSGLKKHLKNIHPNLNMLT---SGGKTR------SVTELIERKEFGILL
A0A2D6VHX5      NT-PNATEEEVTDKLKKVLCSIHPNLFLLP---SGGKTR------AATEIIEKKEFELLL
A0A2D8I214      N--VASSKENLKNSINDSVQEIHPNLYILP---SGGKTR------AATEMLEQKEFDIVH
A0A1Z8VL41      NE-AKNGVENLRELTDKTLHPIHDNLYILP---SGGKTR------AATEILESAEFEMVT
A0A2E6TNA4      NE-AKNGVENLHELADKTLHPIHDNLYILP---SGGKTR------AATEILESTEFEMVT
A0A1Z8RG47      NE-VVKGSKDIDTHIQESLHETHPNLHVLP---SGGKTR------AATEMLERAEFDLVM
A0A1Z8RJJ5      NE-VVKGSKDIDTHIQESLHETHPNLHVLP---SGGKTR------AATEMLERTEFDLVM
A0A2D7V631      NE-VVKGSSDIDEQIKSCLHEIHPNLHVLP---SGGKTR------AATEMLERSEFDYVM
A0A354RA24      NE-VVKGSSDIDEQIKSCLHEIHPNLHVLP---SGGKTR------AATEMLERSEFDYVM
A0A2E9RV62      NETVANPTPNYNFWDSGTLVEIYPNLLILP---SGGKTR------AATEMLEKPEFDKML
A0A2E4AY96      NK-SAEQPNYIKENLDSELHDIHPNLKMLT---SGGKTR------SVTELIEKNQFHELL
A0A3B9B9P4      NK-SAEQPNYIKENLDSELHDIHPNLKMLT---SGGKTR------SVTELIEKNQFHELL
A0A2D5Y6N6      NS-EKTDLKELQELAQSTVTQIHPNLLVLP---SGGKTR------AATELLESNSFDRIH
A0A2E7HSS8      NE-VSQKGGDIDQSVTETLTEIHPNLFVLP---SGGKTR------AATEMLEHNDFSVVI
A0A2D8VCK3      ND-VGKPGQDVQNCISESLTEVHPNLFLLP---SGGKTR------AATEMLEQNDFSTVI
A0A350QVY4      ND-VGKPGQDVQNCISESLTEVHPNLFLLP---SGGKTR------AATEMLEQNDFSTVI
A0A2E4ZYR7      NE-I--NGEHDTEAERNALTEIYPNLYVLP---SGGKTR------AATEMLERPDFDILL
A0A2E6TCV1      NE-I--NGEHGTEAERNALTEIYPNLYVLP---SGGKTR------AATEMLERPDFDHLL
A0A3D4HHL8      RER-ISFDDAI-------QRPGIENLDFVA---HGTTTK------RPGELLSGVYFATML
A0A366HV03      TGE-LVLEDVV-------RHTHLANFHYCT---RGNTSA------GSAELLCRLSLEENV
A0A2V2SDN0      NQE-TYPNYGI-------VTTALENLSFLP---AGAPTL------EPGELVLRSQFSSLL
A0A1V6GL40      AKG-TAWETTV-------SATKIANLHILP---AGTFTA------RSSELFISEATQRFL
A0A2V5X6Z6      NEE-ISFAEAI-------VPTGLENLALLP---AGEARQ------NPGELALSPVWLSFL
A0A2V5VGZ7      NEE-ISFKEAI-------VPTGLENLALLP---AGEANR------NPGELVLSQVWPGFL
A0A2V5U130      NEE-ISFAEAI-------VPTGLENLALLP---AGEANR------NPGELVLSQVWPGFL
A0A2V6C237      NEE-ISFKEAI-------VPTGLENLALLP---AGEANR------NPGELVLSPVWPGFL
A0A3R8L982      EAG-APFDDLLPENPHLGVIKIGENFDLLR---SGGRSR------TPTEFLESAAFTQLL
A0A2E7HPU9      TGKATLAEAIQ-------EQAGQENFSIIF---AGQKAP------NPGELLTTEGVVAVL
A0A388PR45      NGE-MTLDEAI-------VKDVAPGLDVLP---VGLSCR------NPTQVINHPRFGEMI
A0A388QR61      NGE-MTLDEAI-------VKDVAPGLDVLP---VGMSCR------NPTQVINNPKFAEMI
A0A2A2RS01      NGE-MTLDEAI-------VRDVAPGLDVLP---VGMSCR------NPTQVINNPKFLAML
A0A2A2Y1A7      NGE-MTLDEAI-------VRDVAPGLDVLP---VGMSCR------NPTQVINNPKFLAML
A0A388PDH9      NGE-MTLDEAI-------VRDVAPGLDVLP---VGMSCR------NPTQVINNPKFLAML
A0A2G4H1E7      NGE-IPLDDAI-------IREVAPGLDVLP---VGLSCK------NPTQVINHPKFLAMI
A0A2G4GZA6      NAE-MSLDEAI-------VHDVSPGLDVLP---VGLSCK------NPTQVINNPKFLAMI
A0A388P514      NGE-MSIEEAI-------VHDVSPGLDVLP---VGLSCK------NPTQVINNPKFLAMI
A0A2A2YG59      NGE-MSIDEAI-------VHDVSPGLDVLP---VGLSCK------NPTQVINNPKFLAMI
A0A2G4F7D5      NGE-MSIDEAI-------VHDVASGLDVLP---VGLSCK------NPTQVINNPKFLAMI
D5EML0          DSGSTDMEDLL-------GNESLGILKLSP---SLSLLRAGGGCEHPTELLGDLRVSALF
A0A3C1C1M3      DSDQMKPEEIV-------YASECRNLSVIS---SRVVGRS-----RPAELVGGAKVAALL
A0A2E9EYJ1      TTD-LXLEDVI-------LQTAYENLYFMP---SGIL-PA-----DAAGILNSRRMSELI
A0A258AXR6      TTD-IRLEDVV-------LRTQVENLFFLP---SGLL-PA-----DSAGLLNSQRMVDLI
A0A1T4WVZ9      TTN-VTLEEVV-------VRTPVENLYFLP---SGML-PA-----DSAGVLNSQRMTELI
A0A3D3NZQ6      TTN-VRMEDVV-------VRTAVENLYFLP---SGLL-PA-----DSAGILNSQRMSDLI
A0A1Z8SVB5      NTP-NATEEQISEKIEKCLCNIHPNLFLLP---SGGKTR------AATEIIEKKEFELLL
A0A2V5W3Y0      KQE-VNWQEVV-------VPTSYPNLFLLP---RGKTLG------QPSEHLLRDSTDALL
A0A432FAS4      LGK-IDSIEEIVHHAE------VPNLDVIC---CGAVPN------NPSELAGSQRMKDFI
A0A3D4CZT6      TTD-LMLEDVILQTP-------VDNLYFLP---SGILPA------DAAGLLNSRRMSELI
A0A1Z9KB52      NTP-NATEEEVTDKLKKVLCSIHPNLFLLP---SGGKTR------AATEIIEKKEFELLL
A0A2D5W0Q9      TGQ-ITDPSEITQTTE------VPNLDLIC---CGAVPN------NPSELVGSKRMGELL
                                                                            

A0A2V5UAD5      AWARQHFDYVLIDSSPVFAADDTATLAPMVDGTLFVVRNRFSRPRPAREALELLFQRQAK
A0A258AXL1      DALKHHFDRIIVDTPPLLGLADSLLISKAVDGLIFVIRADQTTQRDVATASEILHQSGAQ
A0A2E6T1E0      EEVRTKYQKIVFDCPPVSAVSDPLIIAAATDGIIFVNKFNKIRREHARKTVQRIQDAGIN
A0A2V5U7A0      MDLRESYDFILLDTPPAIAVSDPAILSSVADGIILVFHARKTTVHSARQVKERFDAVRGP
A0A355VK99      SILKKQYDAVIIDAPPYGILADTAILASLSDITLYTVRSGKIDKRYLTQIQQLADQGKLP
A0A257LYL4      QDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLMRVKQAVENVGGH
A0A2V6N5E0      KEMYQHYDYIIIDSSPVLAADDTTSLAPKIDATIFVVRLSYTSARLTKKALELLYGRQVN
A0A2V6NH44      KEIYHQYDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSHTSARLTKKALESLYSRQVN
A0A432FDF6      AEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQYRKYPQLMTQRAKDMVTKVGGE
A0A353DCA1      QDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLLRVKQAVENVGGQ
A0A3C1AXQ2      ADAKSRFDLVLIDSPPILGVSDASVLANEADLTLIVVQHRKLPRHMLMRVKQTVENVGGT
A0A3D0IZR7      EACRPNYDVILVDSPPVLGISDASVISQEVDVSLLLIQHRRYPRNVSQRAKRVIEDVGGK
A0A3R5R793      QEVKQRFDIVLVDSPPILGVSDSAVIVSEVDMTLMVVQPRKLPLKALLRQKQVIESVGGN
A0A2N8IV96      QEVKQRFDIVLVDSPPILGVSDSAVIVSEVDMTLMVVQPRKLPLKALLRQKQVIESVGGN
R7E1V8          QEVKQRFDIVLVDSPPILGVSDSAVIVSEVDMTLMVVQPRKLPLKALLRQKQVIESVGGN
A0A356FSV4      GSLREKYDRIVIDSPPLAAVSDALNILPHVDGVIYVIKFNTVKRKTAVMNVRRLWESNTP
A0A3D3DET9      RDAASRYDYVIFDTVPVMAADDVTCLAPQIDGVIFVLRAAFTSARVARASLESLYQRQVR
A0A355SVK9      ADLRERYDRIVIDSPPLGAVSDALNLLPLVDGVIYVVKFNTVKRKTAMVNARRMAESNTP
A0A2E5D7I3      AWAREHYDHIVIDSAPILPVPDTRIIFPLVDNPCLVIRANVVPKPAVFRALDVMEEDGSR
A0A2V5NYE2      RDAAAKYDYVMIDTAPVMAADDVTSLAPHLDGVLFVIRAERTSARVGRAALELLYHRQVS
A0A2V6FIP7      EEVRNRYDRVILDCPPVSAVSDPLIIASLSDGVAFVTKFNKIRRDHASRTIQRIQDAGIH
A0A353DI77      EMFSSNFDHIVIDSAPLLPVPDTRILAPLVDNLALVIRAEHTPVKSIQRAFDMLEDDGVF
A0A1V6GCZ3      GELKQRYDFVFFDSPPIMGVSDASILASEVDMTIQVIQYRRYPQPMNIRAKQLIEKVGGN
A0A3C1UJT2      LKARQNFDRIVIDSAPLGPIGDTLSVARLADMLCLVVRSGKTTSKVVLRIIDYLHRHGHT
A0A2S7U0Z3      EDLIPEFDRIILDSAPVLPVADSRLLAKHAHAVILVVRTRKTPIGAMIRACDLLKASGAK
A0A2E0R252      GALEEYFDRIIIDSAPLVPVSDSLPLAKLAESVVLVCRVGKTPRGAIKRAIRVLEANHSA
A0A3E1EF48      ADLCRDFDRVVIDTAPLVPVSDTLPIAKRAQSVIMVYRMGKTPRKALFRGLKTLRSNHAE
A0A2A2PVG8      EKLSEYFDRIVIDSAPLVPVSDSIPIAKLVQSVVLVVRMGSTPKGAIKRAIRVLSDNGSH
A0A2E0R421      DKLGKYFDRIIIDSAPIVSVSDTYPLAKIAQSVVLVCRMSMTSRSSIMRALRILKVNQSD
A0A2N8IR72      GILKKQYDAVIIDAPPYGILADTAILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLP
A0A410ELH5      GILKKQYDAVIIDAPPYGILADTAILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLP
A0A2E5EJ69      DDVVGKYDQVVIDNAPVTAVSDTLLILEYVQTICMVTRAAKTSYRLIGRALELVRRSGKN
A0A1T4WWY4      EELKKKYDRIILDTPPVLGLSETAFLQHHADGVAIVVRCGKTLRKDVEDAVQSLQKLGAH
A0A3D3LEQ6      DTLRKQFSRIILDTPPVLGLSETAFLQNHADGVVLVVRSASTPRSDVTAAFQQLEKLGGH
A0A3D3NW23      DSLRKQFSRIILDTPPVLGLSETAFLQNHADGVVLVVRSASTPRSDVTAAFQQLEKLGGH
A0A2G4I5Z5      QEASAKFDHVVLDNAPINAVSDALLIVKEAQTVCLVANAGKTSYRVVLRALEMLRRAGAK
A0A2E7ALI1      DWAREHYDHVVIDTAPVLAVPDTRIIXPLVSNPXLVVRANVVPKPAVFRALEMLEEDGSR
A0A178IDB9      NKLSKSYEVIIIDTPPAAVFPDALLLSRFCAELVYVCRFRTVRRKLIKKTLSKFTESGIS
A0A290QD69      NKLSKIYDLVIIDTPPAAVFPDALLLSRFCTEMIYVCRFKTVRKAVIRKALEKFQESGIT
A0A2E7VDS1      SNLKKLCDILIIDSPPVGLFPDSMAMARKVDEVLCVIRYGKVSRKVVKNLLAKVDETGAN
A0A178IFJ2      EQARREFDILVIDTPPAGIFPDAFDLVPFASELVYVVRFNHVSRPQVHRVTERFRSTGLE
A0A357FSP9      ADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTP
A0A2A2R174      KEASAKFDHVVLDNAPINAVSDALMIVKEAQTVCLVANARKTSYRAVLRALEMLRRAGAK
A0A1H1SWX2      EAMKQHFDLIVVDSPPMGAVTDSLLIAERTDEVIYVCRFNRAYRKHIRLYIKQLKESKNE
A0A290QE54      ARLKKHFDLIIVDSPPMGAVTDSLLIAERTDEVVYVCRFNKAYRKHIKLYIRALHNGKND
A0A1H2DTI1      REMYNEFDYIIFDTSPVMAADDATSLAPKIDGTIFVLRASMTSARAARNALDQLYHRQVN
A0A1V5L462      EACRKQYDFVILDTAPILAVDDTIGLLRRADDVIFVVKSGQTNFRQVKISLERLSVTKTK
A0A2A2R3V9      QEMRDEYDYVVVDSAPILATDDTASLAPKLDGTIFLMRTSYTSARLSRNAMDLLYQRQVN
A0A3D3LGD3      EDAKSRFDIVLIDSPPILGVSDASVLANEADLTMIVVQHRRLPRQTLMRVKQTVENVGGT
A0A350ARX4      EWARERYTYVIVDAPPILAVNDTIGLSNKTDSMMFVVRASQTSTRQVQSSLERLSSRTSK
B5JIS2          RKLEETFEVIIVDTPPVGLYPDALIFAKSVGETLLVARESKAPISQIRQVIGDIDSTGAP
A0A1H2GQN6      VELKEKYQVIFIDSPPALGVSDASVIAHEVDKVVMVIQHRRYPREISIRTKKAIEEVQGN
A0A2A2RPW6      EEASKRYDKVVLDNAPVNAVSDTLLICKEAQTICLVMHSRRTPVRVVSRALEMLRRAGGK
B4D1I7          KTVHAEFDYVVLDSSPVMAADDTTSLAPKADAAVFVFRFTSSSTRASRKALELLRERQTN
A0A353F286      QDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQ
A0A354FSA6      QDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQ
A0A3B9GA54      QDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQ
A0A2D7B7R6      LKARQNFDRIVIDSAPLGPIGDTLSVARLADMLCLVVRSGKTTSKVVLRIIDYLHRHGHT
B1ZT68          KRLLERYDLVILDTPPVAVFPDALLLSRYCKELIFVCKYGSVRLNSVRKTLARVHETGIK
W0J7C2          QPLLDNYDLILFDTPPAAVFPDALMLARCCHEMIYVCRYRTVRPAIIRKVIDRFHGTGIS
A0A2E5K4P7      NEIRQYYDKIIIDSPPLAAVSDALNIVPFVDGILFVVKYNTVKRNTASLTVRKLAEAGKP
A0A0R2XPB1      RDARAQYDFVIFDTAPILATDDTCGFAAKMDAVLFTIRCAHTQVRQIKPAMARLRERKID
A0A348NQP1      SEARERYDFVIFDTAPILATDDTSGFAAKVDAVLFTIRCAHTQVRQIKPAMARLRERNIE
A0A357FV58      SEARERYDFVIFDTAPILATDDTSGFAAKVDAVLFTIRCAHTQVRQIKPAMARLRERNIE
A0A2V6F9Q9      KEIYHQYDYIIIDSSPVLAADDTTSLAPKVDATLLVVRLSHTSARLTKKALELLYSRQVN
A0A2V6ME53      KEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVN
A0A2V6NZZ3      KEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVG
A0A2V6EBU2      KEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVG
A0A2V6EY06      KEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYNRQVG
A0A2V6NIJ1      KEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKALELLYSRQVN
A0A2V6C292      KEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKAFELLYSRQVN
A0A2V6D2X0      KEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVRLSYTSARLTKKAFELLYSRQVN
A0A2V5ZUK1      REIYQHYDYVIIDSSPVLAADDTTSLAPKIDATLFVVRLAYTSARLTKKALELLYSRQVN
A0A2V5XFN9      KEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYGRQVN
A0A2V6EZC8      KEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYGRQVN
A0A2V6I7Z5      KEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYGRQVN
A0A3B9LCP2      KEMYNYYDYIIIDSPPVLAADDTTSFAPKIDATLFVVRLSHTSARLARKGLELLYDRQVN
A0A3C0R669      KEMYNYYDYIIIDSPPVLAADDTTSFAPKIDATLFVVRLSHTSARLARKGLELLYDRQVN
A0A2V6EID2      KEMYKHYEYILIDSSPVLAADDTASLAPKIDATLFVVRLSYTSARLIRKGLELLYGRQVN
A0A2V6MHB0      KEMYKHYEYILIDSSPVLAADDTASLAPKIDATLFVVRLSYTSARLIRKGLELLYGRQVN
A0A2W5YWL9      KDMYQQYDYILIDSSPVLAADDTTSLAPKIDATLFVVRLGYTSARLTRKALELLYSRQVN
A0A2V5NH62      RDMYNHYDYIIIDSSPVLAADDSTSLAPKIDATLFVVRLSYTSARLTRKSLELLYNRQVN
A0A2W6A620      KEMYNHYDYILIDSSPVLAADDSTSLAPKIDATLFVVRLSYTSARLTRKSLELLYNRQVN
A0A2V5PIJ4      REINTFFDYIIIDSAPVLAADDATSLAPKIDATLFVVRLSHTSARLTRKSLELLYNRQVN
A0A2V6K2G8      KEIYQDYDYVIIDSSPVLAADDTTSLAPKIDATLFVVRLSYTSARLTKKALELLYNRQVN
A0A2V5W206      KEMYQHYDYIIIDSSPVLAADDTTSLAPKIDATIFVVRLSYTSARLTKKALELLYGRQVN
A0A2V6MW77      KELYQHYDYVIIDSSPVLAADDTTSIAPKIDATIFVVRLSYTSARLTKKALELLYGRQVN
A0A3C1VFY9      QETIKEYDYVLIDTAPVMAADDVTSLAPRVDGVIFVVRAEFTSARVVRASLDMLYQRKAR
A0A2G4GZN8      EELRGRYDRIFIDSPPIGAVSDALHILPKTDGVIYVVRYNVVNARNAVSCISRLRDAHAP
A0A348NPT1      ADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTP
A0A2E1KV60      LELRDRYDKIIVDSPPLAAVSDALNVVPYIDAVLFVIKYDSVKKSLVNSCVRRLWESKKP
A0A2D7F4D9      LQLRDRYDKIIIDSPPLAAVSDSLNIVPLVDAVIYVIKYDSVKKSLANSCIRRLWESKTP
A0A3R7RBR8      LQLRDRYDKIIIDSPPLAAVSDSLNIVPLVDAVIYVIKYDSVKKSLANSCIRRLWESKTP
A0A2E0NH28      GSLREKYDRIVIDSPPLAAVSDALNILPHVDGVIYVIKFNTVKRKTAVMNVRRLWESNTP
A0A350AS32      ADLRDRYDRIVVDSPPLAAVSDALNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTP
A0A368BGT4      AVLRDRYDRIVIDSPPLAAVSDALNLLPLVDGVIYIIKFNTVKRKTAVLNVRRLWESNTP
A0A1G3ZL71      LQLKKRFDLIVIDSPPLGAVTDSLLIAEQTDEVIYVCRFNRALRKHIKVFVRTLREGKNA
A0A2T6DX88      AKLKNQYDLVVVDSPPMGAVTDAMLVAERTDEVVYVCRFNHAARKHIRLYIRALQSGKNE
A0A3E1E5C8      EKLKKDYDLVVVDSPPLGAVTDSLLIAERTDEVIYVCRFNCAAKKHVRLYMKTLRNGKNE
B1ZZ74          ERLKREYDLVIIDSPPLGAVTDSMLIAERTDEIIYVCRFNRAYRKHIRLYMKALRDAKNE
A0A2E0V4K6      QWAREHYDHVVIDTAPVLAVPDTRIILPQADNRCLVIRANVVPKPAVFRAIDLLEEDGVK
A0A2E6NAH3      SDLRNRYDRIVVDSPPLAAVSDALNLLPMVDGILYVIKFNTVKRKTAVINVRRLWESNTP
A0A2A5VZA5      ADLRDRYDRIVVDSPPLAAVSDALNLLPFVDGIVYVIKFNTVKRKTAVANVRRLWESNTP
A0A424R295      ADLRDRYDRIVVDSPPLAAVSDALNLLPFVDGIVYVIKFNTVKRKTAVANVRRLWESNTP
B4CZV9          NSLRGRFDRIVIDTPPVLGLSETSIMQSLVDGVLFVIWTGQTPVRCVKSAIETLRANRAN
A0A3B9FM17      DLLRRNAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGAN
R7E4L8          RYWRARYDRIILDGCPYEAVADASLMARHADLVLYVIRCGMIEKQYVPVIQGLADKGEFR
A0A0E3YV65      DFLHKQYDAVIIDTPPAGVFSDAMVLAEQAGELVFVVRYNYTSRPGVRRLIETFKRSQID
W0J900          EQAQREFDILLIDTPPAGIFPDALSLAPFANELIYVVRFNYVSRPQVHRVTERLRSTGLE
A0A2T6DSN5      NKLSKHYDIIVIDTPPSAVFPDALLLSRFCSEMVYVCRFKTVRKALIKKTLHKFAESGIH
A0A2V2SMX4      KNAAMQYDYVIMDTAPVMAADDVASLAPNMDSTIFLVRAEHTSARVARAALDILYQRRVK
A0A317ZIW7      KHAREHYDFIVFDTAPILATDDTTSFAPFVDAVLFTVRCSYTHLRQIKPAIARLKERSTN
A0A2D7WMI4      DKLKAESDVIVVDSPPIGLFPDALAFSKIADDIIFVTRYGKVARRVAKNLLYSIEESGTN
A0A2D6VHX5      TCLKKLADVVIFDSPPAGLFPDSIALARKTDEVLFVTRYGKVSRQVVKRLIGDLKATGAN
A0A2D8I214      NELKEMFDVIIVDSPPIGLFPDSLAIARKVDDVLFVTRYGKVSRKIAKNLVENLEETGVN
A0A1Z8VL41      NHLKSLAEVIIIDSPPIGLFPDSLAIARKAEEVLFVTRYGKVSRKVAKNLIENIEETGAN
A0A2E6TNA4      NHLKSLAEVIIIDSPPIGLFPDSLAIARKAEEVLFVTRYGKVSRKVAKNLIENIEETGAN
A0A1Z8RG47      NKLRQIADVIIVDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVAKSLLENIEETGAN
A0A1Z8RJJ5      NKLRQIADVIIVDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVAKSLLENIEETGAN
A0A2D7V631      NKLRQIAEVIIVDSPPIGLFPDSLAIARKVEEVLFVTRYGKVSRKVAKSLLENIEETGAN
A0A354RA24      NKLRQIAEVIIVDSPPIGLFPDSLAIARKVEEVLFVTRYGKVSRKVAKSLLENIEETGAN
A0A2E9RV62      FSLRQNAEIIIIDSPPIGLFPDSLAMARKVDEVIFVTRYGKVARKVAKNLIESLEETGAN
A0A2E4AY96      GKLKSSADIIVVDSPPVGLFPDAMALSKIVDDVIFVTRYGKVARRAAKGLLSNLEESGSN
A0A3B9B9P4      GKLKSSADIIVVDSPPVGLFPDAMALSKIVDDVIFVTRYGKVARRAAKGLLSNLEESGSN
A0A2D5Y6N6      KILRTIADVIIIDSPPIGLFPDSLAMARKVEEVLFVTRYGKVSRKIAKSLLENLDETGAK
A0A2E7HSS8      DSLKRHAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVVKSLIASIKETGAN
A0A2D8VCK3      DLLRRNAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGAN
A0A350QVY4      DLLRTNAEVVIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGAN
A0A2E4ZYR7      NNLKKLCDILIIDSPPVGLFPDSMAMARKVDEVLFVTRYGKVARKVVKNLLMRMDETGAN
A0A2E6TCV1      NNLKKLCDILIIDSPPLALFPDSMAMARKVDEVLFVTRYGKVARKVVKNLLTRVDETGAN
A0A3D4HHL8      EGLRKRYDFIVFDLPPVLATDDTPGFVQKVDGVLFVVRSNTTRVKQAKSAFHILMFRRAK
A0A366HV03      AIWRQQYDWIILDTPPVLGLSETTNLQRVADAVVLVVKAEKTHGRDVTEAVEQLMRAGAP
A0A2V2SDN0      SDVYSRFDYIIIDSPPVLAADDAATLAPKVDGVLFVVRGSHTSARMVREGLDTLRQRRAR
A0A1V6GL40      RDAASRYDYVIFDTVPVMAADDVTCLAPQIDGVIFVLRAAFTSARVARASLESLYQRQVR
A0A2V5X6Z6      AEAKSQFDYVLVDTPPVLAADDAATLAPKVDGVLFVVRGSFTSARMARGALDALRQRRVH
A0A2V5VGZ7      AEAKPQFDYILVDTPPVLATDDAGSLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVR
A0A2V5U130      AEAKPQFDYILVDTPPVLATDDAASLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVH
A0A2V6C237      AEAKPQFDYILVDTPPVLATDDAASLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVR
A0A3R8L982      TKLKKHYDLVIVDSPPLGAVSDSLLIAERTDEVLYVCRFNRALRKHIKLYIKALRAGKNE
A0A2E7HPU9      KELKQEFDVIVIDSAPLLAVPDTRLLVPEVDNFCLVVRAEHTPKGAVAKCLDMLRDDDNE
A0A388PR45      DELRRRYDRVFIDSPPIGAVSDALHLIPKVDGVVYVVRFNVVSARNAAACLARLRDAGAP
A0A388QR61      DELRRRYDRVFIDSPPIGAVSDALHLIPKADGVVYVVRFNVVSARNAAACIGRLREAGVP
A0A2A2RS01      DEMKTRYDRIFIDSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGSCLGRLAETGVP
A0A2A2Y1A7      DEMKTRYDRIFIDSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGSCLGRLAETGVP
A0A388PDH9      DEMKTRYDRVFIDSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGACLARLAETGVP
A0A2G4H1E7      DGFRERYDRIFIDSPPLGAVSDSLHLLPKVDGVIYIVRYNAVNLRHATSCLARLREAQAP
A0A2G4GZA6      DELRGRYDRIFIDSPPIGAVSDALHLLPKVDGVLYVVRYNTVNLRNATSCLARLREAQAP
A0A388P514      DELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAP
A0A2A2YG59      DELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAP
A0A2G4F7D5      DELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAP
D5EML0          SKLKDLYDIVVFDTPPIGLFSDATIVADSADSCVMVARQFAVKRTKFQHSVNQMERSTAP
A0A3C1C1M3      AWARAHFDRIVLDVPPLGIVSDALSLAHLSDCVLVMARPATSRKRAVRHTIQRFQAAGMA
A0A2E9EYJ1      AXVKSRFDLVFIDSPPILGVSDASVISSXVDLTIIVIQHRKLPRGMLXRVKQAIQNVGGT
A0A258AXR6      AEVKSRFDLVLIDSPPILGVSDASVLANLADMTMIVVQHRKLPRHMLMRVKQGVENVGGK
A0A1T4WVZ9      EDAKSRFDIVLIDAPPILGVSDASVLANEADLTIIVVQHRKLPRHMLLRVKQTIENVGGT
A0A3D3NZQ6      EDAKSRFDIVLIDSPPILGVSDASVLANEADLTMIVVQHRRLPRQTLMRVKQTVENVGGT
A0A1Z8SVB5      AAXKKMADVVIFDSPPAGLFPDSIALARKTDEVLFVTRYGKVSRHVVKRLIGDLKITGAN
A0A2V5W3Y0      ADLYNHYDYIIIDSSPVLAADDSTSLAPKIDATLFVVWLSYTSARLVRKSLELLYNRQVN
A0A432FAS4      EEIRSKYDKIMFDCPPVSAVSDPLMIAAATDGIIFVSKFNKVRREHARKTVQRIQDAGIY
A0A3D4CZT6      QDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLVRVKQAVENVGGH
A0A1Z9KB52      TCLKKLADVVIFDSPPAGLFPDSIALARKTDEVLFVTRYGKVSRQVVKRLIGDLKATGAN
A0A2D5W0Q9      DSLRDRYDRIFVDCPPVSAVSDPLMVGARTDGMVFVSKFNKIRREHARKTVQRIQDAGIY
                         :..*  *     :   .           .                      

A0A2V5UAD5      VLGLVFNRADASA--------RSHYY----------------------------------
A0A258AXL1      VYGFVLNCVNLRR--------LENNYYYGHY------------------YSRYYEPTYYN
A0A2E6T1E0      IVGVCINDLDFEG--------KDSYYYSYYY------------------YQNRYYASHYK
A0A2V5U7A0      ILGVILNGINVED--------PDYAYYRHYY---------GSD------YGTVAAAENGN
A0A355VK99      NMAYIINGVNFKS--------ASYSYYGYGY---------GYQ------YGYGAKDPQQT
A0A257LYL4      VIGVVLNNVDVRS--------DSQYQYYTSY---------YTY------YAPAESQSAAQ
A0A2V6N5E0      IPGVILNFVDTSL--------PEY--YYYQY---------SEY------YSTPTSVPDGE
A0A2V6NH44      VPGIILNYVDTSL--------PEY--YYYQY---------SEY------YNRPVAPPESA
A0A432FDF6      LVGVVLNNINISQ--------DSYYYYYSGY---------YYD------YYYKSREKEES
A0A353DCA1      VIGVVLNNVDVRS--------DSQYQYYTSY---------YTY------YAPSSLEETGT
A0A3C1AXQ2      VLGVVLNNVDLRS--------DSQYQYYTSY---------YTY------YSPDNM-----
A0A3D0IZR7      LFGVILNNVNIKT--------DDNYYYYAGY---------STQ----YGYKKRAPRAAQR
A0A3R5R793      LAGVVMNNVDITS--------DHQYQYYTTY---------YSY------YSADGSSSGEN
A0A2N8IV96      LAGVVMNNVDITS--------DHQYQYYTTY---------YSY------YSADGASSGEN
R7E1V8          LAGVVMNNVDITS--------DHQYQYYTTY---------YSY------YSADGGSSGEN
A0A356FSV4      VFGSVLNNV-STA--------LSSY-YYSHY---------SDKSYQDY-YINNEDDFEDQ
A0A3D3DET9      LLGLVFNAVRPSS--------ED-Y-YYYRY---------KDY------YRPYPSGGTKA
A0A355SVK9      VFGAILNNI-SST--------LSSY-YYYSY---------SDKSYSDY-YVHHDVESEQD
A0A2E5D7I3      IVGVVLNGYRETR--------RLXG-YNYSY---------GSYRYGKYGYSQYGYGGYGS
A0A2V5NYE2      VLGLVFNGVRPSS--------VDYY-YYYKY---------KDY------YKAYPTSPSQS
A0A2V6FIP7      ILGVVLNDIDFEG--------KDSY-YYNYY------YYQNRY------YSSHYNPRPDK
A0A353DI77      SSGVILNDFTENR--------LQGGKYGYGY-----------G------YGHYGDDT---
A0A1V6GCZ3      LVGIVLNNINMSQ--------DESYYYYSGY-----------Y------HDYYYRSEEQE
A0A3C1UJT2      PSGIVLNFLRNNN--------NKGS-YYYYYSSDKDKTYSKSG------YQKKQVTNSPM
A0A2S7U0Z3      LGGVVVNGMKRTG--------GSNYLGYKGH-----GEYGGEE------YGYYGGDK---
A0A2E0R252      PVGVVANGLPRTR-------TKGAYGYYYSY-------YGGGN------YANY--SDAK-
A0A3E1EF48      PVGIVANLLPRVA-------GRGAYGYYYGY-------HGGGA------IDGYVSNDSK-
A0A2A2PVG8      PVGIVANGLPQTR-------TAGAHGYYYSY-------SSGGS------YSGYSSNEK--
A0A2E0R421      PVGIVANGLPVAK-------TKTGHDYYYSY-------PGSGS------YGSGNNSDTEK
A0A2N8IR72      NMAYIINGV-NFK--------SASY-SYYGY---------GYG------YQYGYGTKEPQ
A0A410ELH5      NMAYIINGV-NFK--------SSSY-SYYGY---------GYG------YQYGYGSGEPR
A0A2E5EJ69      VSGLVLNFVPEKR--------RAGYNYYYYT---------DKK------YYGYGEDKR--
A0A1T4WWY4      FYGFILNGVDFSK--------RVNH-YYYYY-------YSASY------YDANW------
A0A3D3LEQ6      FFGFVLNRVDFSK--------RSNH-YDYYY-------YSSNY------YDSNW-EEEKE
A0A3D3NW23      FFGFVLNRVDFSK--------RSNH-YDYYY-------YSSNY------YDSNWEEEEKE
A0A2G4I5Z5      PSGVVLNFLPQSA--------GSGYYYYYSG---------NKY------YGQKGVYGAST
A0A2E7ALI1      VVGIILNGYRESRRLXGXXYSYGSY-RYGKYGYSQYGYGGYGS------YGSYGSDDDED
A0A178IDB9      ILGVVLNRMPHAS--------IMNY-GYDGY-----GAYGSDY------YKAYQEEEAAA
A0A290QD69      ILGVVLNCMPHAS--------VMNY-GYDGY-----GAYKADY------YKSYQGEKAES
A0A2E7VDS1      VLGVVLNDLPEKK--------TPGY-YYAGY--YGYGYFRYKY------YNKYYGENEPQ
A0A178IFJ2      MPGIVLNMMPSGR--------GSAA-YYSGY-----GYYGSKH------YSSYYKEGQLA
A0A357FSP9      IFGAILNNI-SST--------LASY-YYSSY--------SDKA------YQDYYISQDVE
A0A2A2R174      PSGVVLNFLPQSA--------GSGYYYYYSG---------NKY------YGQKGVYGATS
A0A1H1SWX2      LLGIVLNGLSPRR--------IEYY-SNYRY---------YRS------YKKYYGSQS--
A0A290QE54      ILGIVLNGLSTRR--------IEYY-SNYRY---------YRS------YKKYYGTQT--
A0A1H2DTI1      VLGLVLNSV-NAL--------LPDYYYYYRY---------YEY------YRPKDEVIEGA
A0A1V5L462      VWGFVMNYVKAGG--------NDYY-YYGRY----------KS------YRYQHKESGDS
A0A2A2R3V9      ILGLVMNFV-DTN--------LPEY-YYYQY---------KEY------YNRGAKAS---
A0A3D3LGD3      VLGVVLNNVDLRA--------DSQYQYYTNY---------YTY------YSPDNRPAAEG
A0A350ARX4      IMGLVFNCAPATG--------VD---YYYNY----------RH------YDSYHQQPDAK
B5JIS2          VLGLVLNDYSFGS--------LNPRLAYGGK-------GKYKY------HNNIKKHAKGA
A0A1H2GQN6      LVGVALNSVATNS--------DEGYYYYGAY---------ADY------YNNPKNRKKKK
A0A2A2RPW6      PSGVVLNFLPGSA--------GAGYYYYYSG---------NKY------YGSKGVYGASS
B4D1I7          VIGIVCNDV-SEA--------MQDY-YYYRY---------PDY------YATAKSDQAGV
A0A353F286      VIGVVLNNVDVRS--------DSQYQYYTSY---------YTY------YSPSNMEENQK
A0A354FSA6      VIGVVLNNVDVRS--------DSQYQYYTSY---------YTY------YSPSNMEENQK
A0A3B9GA54      VIGVVLNNVDVRS--------DSQYQYYTSY---------YTY------YSPSNMEENQK
A0A2D7B7R6      PSGIVLNFLRNNN--------NKGS-YYYYYSSDKDKTYSKSG------YQKKQVTNSPM
B1ZT68          VLGLVINQMPESR--------FRAS-GYEGY-----GAYGQDY------YQAYAKTSAAQ
W0J7C2          LLGVVLNRLPQSK--------ARSY-GYHGY-----GTQSAAY------YKAYEEQTPA-
A0A2E5K4P7      IFGVILNNMASKS--------AEYY-YSEYY---------TGQ------YKKYYTSQGAP
A0A0R2XPB1      ISGLILNYV-DTT--------QPGY-YYYKY---------SEY------YTDPKNGVQST
A0A348NQP1      ISGLILNFV-DTT--------QPGY-YYYKY---------SEY------YTDPKNSEQSL
A0A357FV58      ISGLILNFV-DTT--------QPGY-YYYKY---------SEY------YTDPKNSEQSL
A0A2V6F9Q9      VPGIILNFV-DTS--------LPEY-YYYQY---------SEY------YNRSVAVLESE
A0A2V6ME53      VPGVILNFV-DTS--------LPEY-YYYQY---------SEY------YNRPIAPPESE
A0A2V6NZZ3      VPGVILNCV-DTS--------LPEY-YYYQY---------SEY------YNRPVAPSESE
A0A2V6EBU2      VPGVILNCV-DTS--------LPEY-YYYQY---------SEY------YNRPVAPSESE
A0A2V6EY06      VPGVILNCV-DTS--------LPEY-YYYQY---------SEY------YNRPVAPSESE
A0A2V6NIJ1      VPGIILNYV-DTS--------LPEY-YYYQY---------SEY------YNRPVASSESE
A0A2V6C292      VPGVILNFV-DTS--------LPEY-YYYQY---------SEY------YNRPVTSSASD
A0A2V6D2X0      VPGVILNFV-DTS--------LPEY-YYYQY---------S-------------------
A0A2V5ZUK1      VPGVILNFV-DTS--------LPEY-YYYQY---------SEY------YSTPS-VPETD
A0A2V5XFN9      VPGVILNFV-DTS--------LPEY-YYYQY---------SEY------YSTPA-APDGE
A0A2V6EZC8      VPGVILNFV-DTS--------LPEY-YYYQY---------SEY------YSTPA-APDGE
A0A2V6I7Z5      VPGVILNFV-DTS--------LPEY-YYYQY---------SEY------YSTPA-APDGE
A0A3B9LCP2      VPGIILNFV-DTS--------LPEY-YYYQY---------SEY------YNAPASAPEGE
A0A3C0R669      VPGIILNFV-DTS--------LPEY-YYYQY---------SEY------YNAPASAPEGE
A0A2V6EID2      VPGIILNFV-DTS--------LPEY-YYYQY---------AEY------YNPPASVTDDE
A0A2V6MHB0      VPGIILNFV-DTS--------LPEY-YYYQY---------AEY------YNPPASVTDDE
A0A2W5YWL9      VAGVILNYV-DTS--------LPEY-YYYQY---------SEY------YNTPAEPAE--
A0A2V5NH62      VPGVILNYV-DTS--------LPEY-YYYQY---------SEY------YNTPVPVEEHD
A0A2W6A620      VPGVILNYV-DTS--------LPEY-YYYQY---------SEY------YNTPVPVEEHD
A0A2V5PIJ4      VPGVILNQV-DTS--------LSEY-YYYQY---------AEY------YNTPEPVDERA
A0A2V6K2G8      VPGVILNFV-DTS--------LPEY-YYYQY---------SEY------YSTPT-VPDAE
A0A2V5W206      IPGVILNFV-DTS--------LPEY-YYYQY---------SEY------YSTPTSVPDGE
A0A2V6MW77      IPGVILNFV-DTS--------LPEY-YYYQY---------SEY------YSTPTSVPDGE
A0A3C1VFY9      VLGLVFNAVRMSV--------GGYY-NYYRY---------QDY------YSTHPGK----
A0A2G4GZN8      ILGVVLNSM-SIR--------MASA-YTDTY-------DS--S------YRKYYVDEPR-
A0A348NPT1      IFGAILNNI-SST--------LASY-YYSSY-------SD-KA------YQDYYISQDV-
A0A2E1KV60      VLGAILNNV-SSG--------LSSY-YYSQY-------SS-EK------YSQYYLQDSYL
A0A2D7F4D9      LLGAVLNNV-SLG--------LSHY-YYSQY-------SANKK------YSAYYMQESYL
A0A3R7RBR8      LLGAVLNNV-SLG--------LSHY-YYSQY-------SANKK------YSAYYMQESYL
A0A2E0NH28      VFGSVLNNV-STA--------LSSY-YYSHY-------SD-KS------YQDYYIN----
A0A350AS32      VFGAILNNI-TST--------LSSY-YYSHY-------SD-KA------YQDYYIH----
A0A368BGT4      VFGAILNNI-TSS--------LSSY-YYSNY-------SD-KA------YKNYYTNRGEE
A0A1G3ZL71      FLGIVLNGLTARR--------IAYY-TNYRY---------YRS------YKKYYGTQG--
A0A2T6DX88      ILGIVMNGMSTRR--------IEYY-SNYRY---------YRS------YKKYYGTQA--
A0A3E1E5C8      VLGVVLNGLSPRR--------IEYY-SNYRY---------YRS------YKKYYGTQS--
B1ZZ74          VLGVVLNGLSPRR--------IEYY-SNYRY---------YRS------YKKYYGSQS--
A0A2E0V4K6      LAGVVMNGYRESR--------RLLG-YNYSYGAYRTGRYGYRQ------YGYGGYGSYGA
A0A2E6NAH3      VYGAILNNI-TSV--------LSSY-YYSNY--------SDKA------YQDYYINQEEE
A0A2A5VZA5      VFGAILNNI-TTS--------LSSY-YYSQY--------TDKA------YQDYYIGQEDE
A0A424R295      VFGAILNNI-TTS--------LSSY-YYSQY--------TDKA------YQDYYIGQEDE
B4CZV9          FYGFVLNRL-DLN--------ATQN-YYQYY------YYSHDY------YYQHAIEST--
A0A3B9FM17      LLGVVLNDLPQKK--------TPGY-YYSGY--YGYGYFRYKY------YNKYYGKSDAE
R7E4L8          SGAVILNAENFKN--------SRFH-YYDEY------------------------SETDG
A0A0E3YV65      LAGIVLNRMPAGT--------HSDA-YYSSY-----GHYGSKY------AADYIREEKA-
W0J900          LPGIVLNMMPSGR--------GSSG-YYSGY-----GYYGSRY------YASYYKEEQLA
A0A2T6DSN5      VLGVVLNCVPSSS--------VRNY-GYDGY-----GSYESDY------YKSYQSEKVSS
A0A2V2SMX4      VMGLVFNAV-RPT--------TADY-YYSKY---------SEY------YRTYPGKG---
A0A317ZIW7      VDGIILNYV-DTA--------QPGY-YYYRY---------SEY------YTSTQKPEDSV
A0A2D7WMI4      ILGVVLNDLPQKR--------STGY-YYSGY--YGYGYYRYKY------YNKYYGKNQDS
A0A2D6VHX5      ILGVILNDLPSKK--------ATGY-YYSGY--YGYGYYRYKY------YSKYYSPTEDT
A0A2D8I214      VLGVVLNDLPQKK--------APGY-YYSGY--YGYGYFRYKY------YNKYYGKEKKS
A0A1Z8VL41      ILGVVLNDLPQKK--------TPGY-YYSGY--YGYGYFRYKY------YNKYYGSEKDT
A0A2E6TNA4      ILGVVLNDLPQKK--------TPGY-YYSGY--YGYGYFRYKY------YYKYYGSEKDT
A0A1Z8RG47      VLGVVLNDLPQKK--------TPGY-YYSGY--YGYGYFRYKY------YNKYYGKEKDE
A0A1Z8RJJ5      VLGVVLNDLPQKK--------TPGY-YYSGY--YGYGYFRYKY------YNKYYGKEKDE
A0A2D7V631      VLGVVLNDLPQKK--------TPGY-YYSGY--YGYGYFRYKY------YNKYYGKDKDE
A0A354RA24      VLGVVLNDLPQKK--------TPGY-YYSGY--YGYGYFRYKY------YNKYYGKDKDE
A0A2E9RV62      MLGVVLNDLPEKK--------TPGY-YYSGY--YGYGYFRYKY------YNKYYGKQGAE
A0A2E4AY96      ILGVVLNDLPSKK--------STGY-YYSGYYGYGYGYYRYKY------YNKYYGGSKSN
A0A3B9B9P4      ILGVVLNDLPSKK--------STGY-YYSGYYGYGYGYYRYKY------YNKYYGGSKSN
A0A2D5Y6N6      ILGVVLNDLPQKK--------APGY-YYSGY--YGYGYFRYKY------YNKYYGRERDD
A0A2E7HSS8      LLGVVLNDLPQKK--------TPGY-YYSGY--YGYGYFRYKY------YNKYYGKSDAE
A0A2D8VCK3      LLGVVLNDLPQKK--------TPGY-YYSGY--YGYGYFRYKY------YNKYYGKSDAE
A0A350QVY4      LLGVVLNDLPQKK--------TPGY-YYSGY--YGYGYFRYKY------YNKYYGKPDAE
A0A2E4ZYR7      TLGVVLNDLPEKK--------TPGY-YYAGY--YGYGYFRYKY------YNKYYGGRGED
A0A2E6TCV1      ILGVVLNDLPEKK--------TPGY-YYAGY--YGYGYFRYKY------YNKYYGGKEGA
A0A3D4HHL8      ILGIVLNAF-DVR--------GPGY-YYHRY---------GEY------YTRREEPSPKV
A0A366HV03      MAGFVLNNIDMSK--------VSNY-YYYYY---------SSS------YYYQAFEEDDV
A0A2V2SDN0      VLGVIFNRAVSSS--------FEYH-HYQRY---------KDD------YRWQPNVTTAA
A0A1V6GL40      LLGLVFN-AVRPS--------SEDY-YYYRY---------KDY------YRPYPSGGTKT
A0A2V5X6Z6      VLGLIFNRAASSP--------CERQ-YYQRY---------RRA------YRWEPQKSGRV
A0A2V5VGZ7      VLGLIFNRTVSSP--------YEHD-YYQRY---------RRA------YHWEPKETRCA
A0A2V5U130      VLGLIFNRAASSP--------YGHD-YYQRY---------RRA------YRWEPKETRRA
A0A2V6C237      VLGLIFNRTVSSP--------YEHD-YYQRY---------RRA------YHWEPKETRCA
A0A3R8L982      ILGVVLNGLTARR--------IEYY-SNYRY---------YRS------YKKYYGPRAA-
A0A2E7HPU9      PAGIVVN---DYQ--------ERGG-FARKY---------LYK------YGGY--GGYGG
A0A388PR45      MLCAVLNQM-SVR--------LASV-YTDTY---------DPS------AGKYYVGESGA
A0A388QR61      MLCAVLNQM-SVR--------MASV-YTDTY---------DPT------AGKYYASDAGG
A0A2A2RS01      ILGAVLNRM-SIR--------MASV-YTDSY---------DPA------NKKYYIDSEGS
A0A2A2Y1A7      ILGAVLNRM-SIR--------MASV-YTDSY---------DPA------NKKYYIDSEGS
A0A388PDH9      ILGAVLNRM-SIR--------MASV-YTDSY---------DPA------NKKYYIDAQDS
A0A2G4H1E7      LLGVILNAM-SLR--------MASA-YTDSY---------DSS------YRKYYVDERGA
A0A2G4GZA6      LLGVVLNAM-SLR--------MASA-YTDTY---------DSS------YRKYYVDETRS
A0A388P514      LLGVVLNAM-SLR--------MASA-YTDTY---------DSS------YRKYYVDEPRG
A0A2A2YG59      LLGVVLNAM-SLR--------MASA-YTDTY---------DSS------YRKYYVDEPRG
A0A2G4F7D5      LLGVVLNAM-SLR--------MASA-YTDTY---------DSS------YRKYYVDEPRG
D5EML0          VVGVVFNGIKDVN--------AAVG-FGRNG---------VSH------YGY--------
A0A3C1C1M3      NLAVVMNDV-E-H--------SKFT-Y-HSY---------GPY------YHY--------
A0A2E9EYJ1      AXGVVLNNV-DVR--------SDNX-Y-QYY---------TSY------YTYYAPRNL--
A0A258AXR6      VVGVVLNNV-DLR--------SDAQ-Y-QYY---------TSY------YTYYSPTNSPN
A0A1T4WVZ9      VLGVVLNNV-DLR--------SDSQ-Y-QYY---------TSY------YTYYSPNNTAA
A0A3D3NZQ6      VLGVVLNNV-DLR--------ADSQ-Y-QYY---------TNY------YTYYSPDNRPA
A0A1Z8SVB5      ILGVILNDLPSKK--------ATGY-YYSGY--YGYGYYRYKY------YSKYYSPDXA-
A0A2V5W3Y0      VPGIILNYVDTSL--------PEYY-YYQ--------------------YSEYYNTPLAV
A0A432FAS4      IAGICINDLDFEG--------KDSY-YYS------YYYYQNRY------YASHYKSDKPG
A0A3D4CZT6      VIGVVLNNVDVRS--------DSQY-QY-------YTSY-YTY------YAPSADSDPVP
A0A1Z9KB52      ILGVILNDLPSKK--------ATGY-YYSGY--YGYGYYRYKY------YSKYYSPTEDT
A0A2D5W0Q9      ILGTVINDIDFEG--------KDSY-YYS------YYYYQNRY------YASYYSNEKKL
                      *                                                     

A0A2V5UAD5      ------------------------------------------------------------
A0A258AXL1      NPKEGGEAA---------------------------------------------------
A0A2E6T1E0      SDKSDSEHGKEEEFDSKKTKKKAV------------------------------------
A0A2V5U7A0      GGEHADVEVLMAHDSFEKDPWPKIAASEIVPQNFFDHIVSKLRDAVGPMAGLIVEDHISL
A0A355VK99      ARKRD-------------------------------------------------------
A0A257LYL4      LGPVAPQGS---------------------------------------------------
A0A2V6N5E0      AVAPVRRQR---------------------------------------------------
A0A2V6NH44      AAV---QHR---------------------------------------------------
A0A432FDF6      ADEAQDGKK---------------------------------------------------
A0A353DCA1      PQQMTAAPA---------------------------------------------------
A0A3C1AXQ2      -----AAPA---------------------------------------------------
A0A3D0IZR7      SKATATVAA---------------------------------------------------
A0A3R5R793      ADASSMKKV---------------------------------------------------
A0A2N8IV96      ADASSMKKV---------------------------------------------------
R7E1V8          ADASSMKKA---------------------------------------------------
A0A356FSV4      LVESTASGD---------------------------------------------------
A0A3D3DET9      AESVRTEQT---------------------------------------------------
A0A355SVK9      LGKGALKPE---------------------------------------------------
A0A2E5D7I3      YGSYGSDDX---------------------------------------------------
A0A2V5NYE2      AATASPKRE---------------------------------------------------
A0A2V6FIP7      PLKDKSEEVKKAG-----------------------------------------------
A0A353DI77      ------------------------------------------------------------
A0A1V6GCZ3      PVVKEGAESGGKDKLDIKQKY---------------------------------------
A0A3C1UJT2      EVGASAEDEPVKS-----------------------------------------------
A0A2S7U0Z3      ------------------------------------------------------------
A0A2E0R252      ------------------------------------------------------------
A0A3E1EF48      ------------------------------------------------------------
A0A2A2PVG8      ------------------------------------------------------------
A0A2E0R421      IKTTRVRVPLFQNILNLGSKMKDHDFFSKKQKRPRRRNRRRPSRR---------------
A0A2N8IR72      QTSRKQNK----------------------------------------------------
A0A410ELH5      QTTRKQD-----------------------------------------------------
A0A2E5EJ69      ------------------------------------------------------------
A0A1T4WWY4      ----DVKPAKKET-----------------------------------------------
A0A3D3LEQ6      EREADERPGRKKRRGSSQSA----------------------------------------
A0A3D3NW23      DREADERPGRKKRRGSSQAA----------------------------------------
A0A2G4I5Z5      PRS---------------------------------------------------------
A0A2E7ALI1      ------------------------------------------------------------
A0A178IDB9      VK----------------------------------------------------------
A0A290QD69      K-----------------------------------------------------------
A0A2E7VDS1      EHGKAKAG----------------------------------------------------
A0A178IFJ2      ARSG--------------------------------------------------------
A0A357FSP9      LEDELAGSVEPEMEPRA-------------------------------------------
A0A2A2R174      SKG---------------------------------------------------------
A0A1H1SWX2      ------------------------------------------------------------
A0A290QE54      ------------------------------------------------------------
A0A1H2DTI1      PGTPRRGKDGSKL-----------------------------------------------
A0A1V5L462      GNEEIRKKTGRLSPKEK-------------------------------------------
A0A2A2R3V9      ------------------------------------------------------------
A0A3D3LGD3      GKPKKRRKAAGETAPARTPGGDLF------------------------------------
A0A350ARX4      QKRERS------------------------------------------------------
B5JIS2          GRVKSKSMVGKLMAEDVEDDDNLEAVEANGKVAETAKSKLKSTPLKLNNKNSGSKSLIGK
A0A1H2GQN6      KGSSLQPRPAPPLPPGTTPPPTPPSQPDEF------------------------------
A0A2A2RPW6      SKG---------------------------------------------------------
B4D1I7          ------------------------------------------------------------
A0A353F286      PQAMTARKSSKSEPKGSSSSDTSNDDLY--------------------------------
A0A354FSA6      PQAMTARKSSKSEPKGSSSSDTSNDDLY--------------------------------
A0A3B9GA54      PQAMTARKSSKSEPKSSSVSDTSNDDLY--------------------------------
A0A2D7B7R6      EVGASAEDEPVKS-----------------------------------------------
B1ZT68          ------------------------------------------------------------
W0J7C2          ------------------------------------------------------------
A0A2E5K4P7      EVSLGETSNSHPKPARKMNLEQGSEAQA--------------------------------
A0A0R2XPB1      SQQTTASS----------------------------------------------------
A0A348NQP1      SQQTTA------------------------------------------------------
A0A357FV58      SQQTTA------------------------------------------------------
A0A2V6F9Q9      ATAQRQPTR---------------------------------------------------
A0A2V6ME53      A------TA-QHSSG---------------------------------------------
A0A2V6NZZ3      A------IA-QRSSG---------------------------------------------
A0A2V6EBU2      A------IA-QRSSG---------------------------------------------
A0A2V6EY06      A------IA-QRSSG---------------------------------------------
A0A2V6NIJ1      A------TT-QHHPTSQAQSS---------------------------------------
A0A2V6C292      A------IA-Q-HSSDQAQSF---------------------------------------
A0A2V6D2X0      ------------------------------------------------------------
A0A2V5ZUK1      AQPVAPPVR-RQRPRPIETQI---------------------------------------
A0A2V5XFN9      A---VTSVG-REHPKPIETA----------------------------------------
A0A2V6EZC8      A---VTPVG-REHPKPIETA----------------------------------------
A0A2V6I7Z5      A---VTPVG-REHPKPIETA----------------------------------------
A0A3B9LCP2      T---VAAPH-REQAKPVETS----------------------------------------
A0A3C0R669      T---VAAPH-REQAKHVQTS----------------------------------------
A0A2V6EID2      A---LTAPP-PREPAKQPS-----------------------------------------
A0A2V6MHB0      A---LTAPP-PREPAKQPS-----------------------------------------
A0A2W5YWL9      ----------RPATHQVQPS----------------------------------------
A0A2V5NH62      D---VAAAHRHHQPRQIQSS----------------------------------------
A0A2W6A620      E---VAATTLHPQPKQIQSS----------------------------------------
A0A2V5PIJ4      A---PAALH-HREPKQIQSS----------------------------------------
A0A2V6K2G8      T---VTPVR-RERPKPIETA----------------------------------------
A0A2V5W206      A---VAPVR-RQRPKPIETT----------------------------------------
A0A2V6MW77      A---VAPVR-RQRSKPMETT----------------------------------------
A0A3C1VFY9      ------------------------------------------------------------
A0A2G4GZN8      --------------------------------GATDSDSAKS------------------
A0A348NPT1      ------------------ELEDELAGSVEPEMEPRA------------------------
A0A2E1KV60      -DLNESNATKSLDSSTANDQSAGVDTAVAESDTNTDTDKLDS------------------
A0A2D7F4D9      GNMDESEAEES-------NQAIVADTFTETKTDSDSEDKLDS------------------
A0A3R7RBR8      GNMDESEAEES-------NQAIVADTFTETKTDSDSEDKLDS------------------
A0A2E0NH28      --------NED-------DFEDQLVESTASGDEDTSEIARET------------------
A0A350AS32      --------NDE-------EFEEELAGSVEPTVDSKS------------------------
A0A368BGT4      LDQGEELVQGE-------ELEDELVGDIETELESKS------------------------
A0A1G3ZL71      ------------------------------------------------------------
A0A2T6DX88      ------------------------------------------------------------
A0A3E1E5C8      ------------------------------------------------------------
B1ZZ74          ------------------------------------------------------------
A0A2E0V4K6      YGSDDEED----------------------------------------------------
A0A2E6NAH3      LEEELVGDIETELESKS-------------------------------------------
A0A2A5VZA5      MEDELAASTEPEEKVES-------------------------------------------
A0A424R295      MEDELAASTEPEEKVES-------------------------------------------
B4CZV9          ------------------------------------------------------------
A0A3B9FM17      EKRKKKQAVS--------------------------------------------------
R7E4L8          ------------------------------------------------------------
A0A0E3YV65      ------------------------------------------------------------
W0J900          GQSG--------------------------------------------------------
A0A2T6DSN5      ------------------------------------------------------------
A0A2V2SMX4      ------------------------------------------------------------
A0A317ZIW7      KSVGGV------------------------------------------------------
A0A2D7WMI4      ------------------------------------------------------------
A0A2D6VHX5      ------------------------------------------------------------
A0A2D8I214      EA----------------------------------------------------------
A0A1Z8VL41      STKIEV------------------------------------------------------
A0A2E6TNA4      SSKIEA------------------------------------------------------
A0A1Z8RG47      KAPVEKLTS---------------------------------------------------
A0A1Z8RJJ5      KAPVEKLTS---------------------------------------------------
A0A2D7V631      KPPVEKLTT---------------------------------------------------
A0A354RA24      KPPVEKLTT---------------------------------------------------
A0A2E9RV62      KAQ----GKNAKLS----------------------------------------------
A0A2E4AY96      TG----------------------------------------------------------
A0A3B9B9P4      TG----------------------------------------------------------
A0A2D5Y6N6      EPSSPTVQGKESVS----------------------------------------------
A0A2E7HSS8      EKR----KSVSS------------------------------------------------
A0A2D8VCK3      EKR----KKKQAVS----------------------------------------------
A0A350QVY4      EKR----KNKQAVS----------------------------------------------
A0A2E4ZYR7      EKA----EKKAQAS----------------------------------------------
A0A2E6TCV1      ESE----LPREKAS----------------------------------------------
A0A3D4HHL8      SKKMQAVSKT--------------------------------------------------
A0A366HV03      AGRSAPVSA---------------------------------------------------
A0A2V2SDN0      ------------------------------------------------------------
A0A1V6GL40      AESARTGQA---------------------------------------------------
A0A2V5X6Z6      -ALAGNLSPNTTDR----------------------------------------------
A0A2V5VGZ7      TALAGHSAPDATDG----------------------------------------------
A0A2V5U130      TALAGHSAPDATGG----------------------------------------------
A0A2V6C237      TALAGHSAPDATDG----------------------------------------------
A0A3R8L982      ------------------------------------------------------------
A0A2E7HPU9      YGGYGGYGGYGQYGGGYGSGSYGSYGSYGADEEEDD------------------------
A0A388PR45      GPKA--------------------------------------------------------
A0A388QR61      PPSP--------------------------------------------------------
A0A2A2RS01      DSSG--------------------------------------------------------
A0A2A2Y1A7      DSSG--------------------------------------------------------
A0A388PDH9      DSSS--------------------------------------------------------
A0A2G4H1E7      SSSPGPPKS---------------------------------------------------
A0A2G4GZA6      QAGADSTKS---------------------------------------------------
A0A388P514      QSDAGSAKS---------------------------------------------------
A0A2A2YG59      QSGAGSEKS---------------------------------------------------
A0A2G4F7D5      QSGAGSEKS---------------------------------------------------
D5EML0          GYEKDPEKYKAYYRRSRSA-----------------------------------------
A0A3C1C1M3      ------QKHYGAYAQAVPPSLTPTGK----------------------------------
A0A2E9EYJ1      ----DPDMESGSIGSPKPGSKLASXDQNNLSAEDKF------------------------
A0A258AXR6      GGTGGKSRRRKIKAETTATALGSSQSVSRLDGDDVF------------------------
A0A1T4WVZ9      PAGTRPEKRKKQIPPSRPGQATVASSSA--PRGDLF------------------------
A0A3D3NZQ6      AEGGKPKKRRKAAGETAPAR-------T--PGGDLF------------------------
A0A1Z8SVB5      ------------------------------------------------------------
A0A2V5W3Y0      EEPDDVAAAHRHHQPRQIQSS---------------------------------------
A0A432FAS4      GKDEETNSKKPEKESSAA------------------------------------------
A0A3D4CZT6      TVGATASATSGSALESKVVANDSEEDEGLTY-----------------------------
A0A1Z9KB52      ------------------------------------------------------------
A0A2D5W0Q9      GSKKGEGAKDGELVQGGKAGKDDEPSKA--------------------------------
                                                                            

A0A2V5UAD5      --------------------------------------------
A0A258AXL1      --------------------------------------------
A0A2E6T1E0      --------------------------------------------
A0A2V5U7A0      LGEARNRFPKNRLHELFDRICEEILDDKLKNDFQQSMQEELRVL
A0A355VK99      --------------------------------------------
A0A257LYL4      --AV-----------------------APAPRSQPAAKGDSELY
A0A2V6N5E0      --PKPIETT-----------------------------------
A0A2V6NH44      --TGQAQSS-----------------------------------
A0A432FDF6      --DA----------KLLAKAD-------------IGGEDEKPKY
A0A353DCA1      --SS----------KTEEKK--------------SERSSSEDLY
A0A3C1AXQ2      --DK----------KPERRKKPTPAGQPSPGAAASSNAPRGDLF
A0A3D0IZR7      --VEIPAATPAASVDEVVEHPLDTPEASAPKVTFIRPPRGQDRF
A0A3R5R793      --ER---------------------SGKAKELAATQSHDSEDLY
A0A2N8IV96      --ER---------------------SGKAKELAATQSHDSEDLY
R7E1V8          --ER---------------------SGKAKELAATQSHDSEDLY
A0A356FSV4      --ED---------------------TSEIARET-----------
A0A3D3DET9      --------------------------------------------
A0A355SVK9      --LQ---------------------GKS----------------
A0A2E5D7I3      --ED----------------------------------------
A0A2V5NYE2      --QA---------------------HRA----------------
A0A2V6FIP7      --------------------------------------------
A0A353DI77      --------------------------------------------
A0A1V6GCZ3      --------------------------------------------
A0A3C1UJT2      --------------------------------------------
A0A2S7U0Z3      --------------------------------------------
A0A2E0R252      --------------------------------------------
A0A3E1EF48      --------------------------------------------
A0A2A2PVG8      --------------------------------------------
A0A2E0R421      --------------------------------------------
A0A2N8IR72      --------------------------------------------
A0A410ELH5      --------------------------------------------
A0A2E5EJ69      --------------------------------------------
A0A1T4WWY4      --------------------------------------------
A0A3D3LEQ6      --------------------------------------------
A0A3D3NW23      --------------------------------------------
A0A2G4I5Z5      --------------------------------------------
A0A2E7ALI1      --------------------------------------------
A0A178IDB9      --------------------------------------------
A0A290QD69      --------------------------------------------
A0A2E7VDS1      --------------------------------------------
A0A178IFJ2      --------------------------------------------
A0A357FSP9      --------------------------------------------
A0A2A2R174      --------------------------------------------
A0A1H1SWX2      --------------------------------------------
A0A290QE54      --------------------------------------------
A0A1H2DTI1      --------------------------------------------
A0A1V5L462      --------------------------------------------
A0A2A2R3V9      --------------------------------------------
A0A3D3LGD3      --------------------------------------------
A0A350ARX4      --------------------------------------------
B5JIS2          LMSEQEKKE-----------------------------------
A0A1H2GQN6      --------------------------------------------
A0A2A2RPW6      --------------------------------------------
B4D1I7          --------------------------------------------
A0A353F286      --------------------------------------------
A0A354FSA6      --------------------------------------------
A0A3B9GA54      --------------------------------------------
A0A2D7B7R6      --------------------------------------------
B1ZT68          --------------------------------------------
W0J7C2          --------------------------------------------
A0A2E5K4P7      --------------------------------------------
A0A0R2XPB1      --------------------------------------------
A0A348NQP1      --------------------------------------------
A0A357FV58      --------------------------------------------
A0A2V6F9Q9      --------------------------------------------
A0A2V6ME53      --------------------------------------------
A0A2V6NZZ3      --------------------------------------------
A0A2V6EBU2      --------------------------------------------
A0A2V6EY06      --------------------------------------------
A0A2V6NIJ1      --------------------------------------------
A0A2V6C292      --------------------------------------------
A0A2V6D2X0      --------------------------------------------
A0A2V5ZUK1      --------------------------------------------
A0A2V5XFN9      --------------------------------------------
A0A2V6EZC8      --------------------------------------------
A0A2V6I7Z5      --------------------------------------------
A0A3B9LCP2      --------------------------------------------
A0A3C0R669      --------------------------------------------
A0A2V6EID2      --------------------------------------------
A0A2V6MHB0      --------------------------------------------
A0A2W5YWL9      --------------------------------------------
A0A2V5NH62      --------------------------------------------
A0A2W6A620      --------------------------------------------
A0A2V5PIJ4      --------------------------------------------
A0A2V6K2G8      --------------------------------------------
A0A2V5W206      --------------------------------------------
A0A2V6MW77      --------------------------------------------
A0A3C1VFY9      --------------------------------------------
A0A2G4GZN8      --------------------------------------------
A0A348NPT1      --------------------------------------------
A0A2E1KV60      --------------------------------------------
A0A2D7F4D9      --------------------------------------------
A0A3R7RBR8      --------------------------------------------
A0A2E0NH28      --------------------------------------------
A0A350AS32      --------------------------------------------
A0A368BGT4      --------------------------------------------
A0A1G3ZL71      --------------------------------------------
A0A2T6DX88      --------------------------------------------
A0A3E1E5C8      --------------------------------------------
B1ZZ74          --------------------------------------------
A0A2E0V4K6      --------------------------------------------
A0A2E6NAH3      --------------------------------------------
A0A2A5VZA5      --------------------------------------------
A0A424R295      --------------------------------------------
B4CZV9          --------------------------------------------
A0A3B9FM17      --------------------------------------------
R7E4L8          --------------------------------------------
A0A0E3YV65      --------------------------------------------
W0J900          --------------------------------------------
A0A2T6DSN5      --------------------------------------------
A0A2V2SMX4      --------------------------------------------
A0A317ZIW7      --------------------------------------------
A0A2D7WMI4      --------------------------------------------
A0A2D6VHX5      --------------------------------------------
A0A2D8I214      --------------------------------------------
A0A1Z8VL41      --------------------------------------------
A0A2E6TNA4      --------------------------------------------
A0A1Z8RG47      --------------------------------------------
A0A1Z8RJJ5      --------------------------------------------
A0A2D7V631      --------------------------------------------
A0A354RA24      --------------------------------------------
A0A2E9RV62      --------------------------------------------
A0A2E4AY96      --------------------------------------------
A0A3B9B9P4      --------------------------------------------
A0A2D5Y6N6      --------------------------------------------
A0A2E7HSS8      --------------------------------------------
A0A2D8VCK3      --------------------------------------------
A0A350QVY4      --------------------------------------------
A0A2E4ZYR7      --------------------------------------------
A0A2E6TCV1      --------------------------------------------
A0A3D4HHL8      --------------------------------------------
A0A366HV03      --------------------------------------------
A0A2V2SDN0      --------------------------------------------
A0A1V6GL40      --------------------------------------------
A0A2V5X6Z6      --------------------------------------------
A0A2V5VGZ7      --------------------------------------------
A0A2V5U130      --------------------------------------------
A0A2V6C237      --------------------------------------------
A0A3R8L982      --------------------------------------------
A0A2E7HPU9      --------------------------------------------
A0A388PR45      --------------------------------------------
A0A388QR61      --------------------------------------------
A0A2A2RS01      --------------------------------------------
A0A2A2Y1A7      --------------------------------------------
A0A388PDH9      --------------------------------------------
A0A2G4H1E7      --------------------------------------------
A0A2G4GZA6      --------------------------------------------
A0A388P514      --------------------------------------------
A0A2A2YG59      --------------------------------------------
A0A2G4F7D5      --------------------------------------------
D5EML0          --------------------------------------------
A0A3C1C1M3      --------------------------------------------
A0A2E9EYJ1      --------------------------------------------
A0A258AXR6      --------------------------------------------
A0A1T4WVZ9      --------------------------------------------
A0A3D3NZQ6      --------------------------------------------
A0A1Z8SVB5      --------------------------------------------
A0A2V5W3Y0      --------------------------------------------
A0A432FAS4      --------------------------------------------
A0A3D4CZT6      --------------------------------------------
A0A1Z9KB52      --------------------------------------------
A0A2D5W0Q9      --------------------------------------------
                                                            

© 1998-2019