BYKdb

Dataset for cluster tadcd of phylum verrucomicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

194 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2A2XVF1      MSKRVDFPRRAFCEFRGIFVRFVFLFLIGMSVAAEPSNEYKLAPNDLLDFRVFQEPELDA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1Q6UXG8      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A3R5SIG7      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2T6CWI7      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A1Q6UTU9      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      VVRVSGDGQAIFPLVGGVAIAGASISEAIELIKSRYRDGYLKNPQVTLTVRSYAKKLFTI
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1Q6UXG8      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A3R5SIG7      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2T6CWI7      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A2G4G428      --------------------------------------------------MSEENPNTGS
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A1Q6UTU9      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      LGQVQQPGSYDIQSQIRGMSPLSVSRMVVSASSSLTRNAWRAVMKKPRSSSRREMSSPSA
A0A2V5UHJ2      ------------------------------------------------------------
A0A2V5PST3      ---------------------------------------------------------MRP
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1Q6UXG8      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A3R5SIG7      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2T6CWI7      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      -------------------------------------------------MSMKMMSSPSP
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290QGD9      -------------------------------------------------------MNPPA
A0A1D8AS58      -------------------------------------------------------MENAP
I6AQC1          -------------------------------------------------------MDSQA
W0ITH7          -------------------------------------------------------MDSQA
A0A290Q2Z2      ------------------------------------------------------MLWWSR
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------MKDNHS
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A2V5URB2      -----------------------MSSISHLPVQSWSPTAFIGFSQPSCTSGPVSLLLDNK
A0A2V2DJ66      -----MENSDSKTPAQDGASQNAPSSQGAKSVRKKRNSGYGYG--YNYSAYGNYGGYGGY
R7L5A9          -----MESSNN--------NNSQPDSAPTKVIKKKIVASYGSGGYGGYGGYGDYGGYGAY
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      --------MPLNGTAGVSPGLALLWPWSPCACNGHSAAFSSGLIIPVNGNIGTVRLYRTD
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ---------------------MENTESKDNSGQKTVKRVIKKRIISDAAGAYGYGPGYGG
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------MDPSQSAQTQPN
A0A1H1MGC9      ------------------------------------------------MDTVPKAEKAQG
A0A2A2PYE8      -------------------------------------------------MSSESGEKQSQ
A0A2T6CN73      ------------------------------------------------MAAEQEKHAPGE
A0A2N8HDG3      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A2G4G428      TNSSSSSGSASGTNNTSRGSQRRGYGGGGYGGNYGGGYGGGYGGNYGGGYGGGYGGGYGG
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A0R2XQ77      ---------------------------------------------MKNDYVRGAPDPNSG
A0A2E9IN28      ---------------------------------------------MKNDYVRGGADPNTG
D5ENH7          ---------------------------------------------MKNDYVRGGADPNSG
A0A351WE84      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A3D4HF88      ----------------------------MRNTTESMVQDPQEEASKRKPNYHNYHSYHNH
A0A351MR11      -------------------------------------------MPSSYILRQRDDGNTSY
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------MKNEYVRGAPDPNAGGYA
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
B3DZK9          -----------------------------------------------------------M
A0A2A2XV69      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A1Q6UTU9      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      -----------------------------------------------------MGVFLFL
                                                                            

A0A2A2XVF1      SPYFKMLDPSRPPAEKRFGSVLPTIHSSLDEVGTALDLRRIYHLLLQRW-----------
A0A2V5UHJ2      MEQVNQPSPYFIRRTLRPENQTIDLHEFSVVEDQVLPLRDYWLIIKRHR-----------
A0A2V5PST3      PYNMRTYFPENDTQRPALPDSSESDYAYYGSEEERVQLLDYWKNLVKRR-----------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ----MAEPAGSSPTPPVPLGAAPSSSAADAPVEQRRSLRDYYVILRERF-----------
A0A1D8AZK8      ----MSVP--DSPPSSSAAQRAASLHGNDHQVVERRSLRDYYIILRERL-----------
A0A1Q6UXG8      ---------------MANNTAP--TPPVTENTEETTSLDTVLLVLRRYW-----------
A0A2N8I9W1      ---------------MANNTAP--TPPVTENTEETTSLDTVLLVLRRYW-----------
A0A3R5SIG7      ---------------MANNTAP--TPPVTENTEETTSLDTVLLVLRRYW-----------
A0A2N8IBZ6      ---------------MANNTAP--TPPVTENTEETTSLDTVLLVLRRYW-----------
A0A2N8IJW9      ---------------MANNTAP--TPPVTENTEETTSLDTVLLVLRRYW-----------
R6J100          ---------------MANNTAP--TPPVTENTEETTSLDTVLLVLRRYW-----------
A0A139TV24      ---------------MPQPTVPPVSSPAPETPDSSLSLDIVAIILRRRW-----------
A0A2N8HT11      ---------------MPDTPAPPAAPPA-EEPESSLSLDVITSILLRRW-----------
R7DS70          ---------------MPDTPAPPAAPPA-EEPESSLSLDVITSILLRRW-----------
A0A2N8HNL6      ---------------MPDTPAPPAAPPA-EEPESSLSLDVITSILLRRW-----------
A0A1V5QB01      -MENILRPPRPPTAGDAPAQPVSIGSPPPAKGFGIADLKHYFHIVVKRI-----------
A0A139SPN4      -----------------------------MPAGQSRSLRDYYVILRERF-----------
A0A1V6E7N1      -----------MADVSAKSTHHSP--GKDEEVVERRTLRDYLIILRERL-----------
A0A2T6CWI7      -----------MADANAKPPPPPPVDHDDETVSERRTLRDYYIMLRERL-----------
A0A2D9MYT1      -----------------MXQXPFNESREEGLFEESINLRHYWHIVLERR-----------
A0A258ANJ7      KASFNTMQPTSLSLPQSPMEMTQRLEADSESSSSFMNPAQLVDGMRRHS-----------
A0A139TLN4      -----------------MKSSSPKPDSLETEGGASVSLFPSPRALLARI--------IRN
A0A1G3ZFT0      --------------------MNTLTHGKANQENIEIDFVALFHQLLEHK-----------
A0A1Z8ZMT6      -------MAKLRSTPEPVDSYYDEAQAEIKKSPGLFDLAYLLPRLIARW-----------
A0A2E8MCT7      -------MAKLRSAPGPVDSYYQETKADIKKSPGVFDLAYLLPRLIARW-----------
A0A290QGD9      SPAPHGGPDQAPESPYGYGAYQQPP-----DGPQQRGFQDYVLILRERI-----------
A0A1D8AS58      KADKVQGPGEA-YPAYYGGGQGGYGVLGQGESQMHRSMQDYLLILRERV-----------
I6AQC1          KQPK---ASDG-RAEYGYGGYNEYPGYGN-EASGQRTLSDYLLILRERI-----------
W0ITH7          KQPN---PSDG-RAEYGYGGYNEYPGYGN-EASGQRTLSDYLLILRERI-----------
A0A290Q2Z2      RVWWWRPEKTSLLTGGEGNSLAARSMAHTHVSKEGASLADFFHLLRLRK-----------
A0A2A2RGK2      -------------MSTDKVIQPRPPESAPP--IESIDWREYFHAVIDRL-----------
A0A2A2XXF7      -------------MNKETDLKKPPSASPPPPSQEGIDWREYFHAVVDRL-----------
A0A2A2R5D6      --------------------------MAAPASEVSLHFLDYWRVIRNRA-----------
A0A1J4XH17      NKNEPEDQKSYGGYYNGYGSYSYGYGSGAYEENNQRNIKDYLLILRERV-----------
A0A3C1VJ32      ----------------------MDQVTTSAAPEARLHFLDYWRVIRIRK-----------
A0A2N9NTX7      ----------------------MDPIPVPPPQESKLHFLDYWRIIRIRK-----------
B9XK55          ----------------------MDPLKTSAPPEAKLHFLDYWRIIRIRK-----------
A0A2E6T482      ----------------------MDKIPTTDQSSDKLHILDYWRILRVRF-----------
A0A3C0DQZ7      ----------------------MDKIPTTDQSSDKLHILDYWRILRVRF-----------
A0A1Z9CBK5      ----------------------MERNTGSDQSSDKLHILDYWRIIRVRI-----------
A0A2D6ZI96      ----------------------MERNTGSDQSSDKLHILDYWRIIRVRI-----------
A0A358KGZ3      ----------------------MEPTSRKENSSDKLHILDYWRIIRVRI-----------
A0A2E9ZQX4      ----------------------MEPTSRKENSSDKLHILDYWRIIRVRI-----------
A0A3D5JZU0      ----------------------MEPTSGKENSSDKLHILDYWRIIRVRI-----------
A0A2E6HCR0      ----------------------MDNNSGSEQSSDKLHILDYWRIIRVRI-----------
A0A1Z8WN04      ----------------------MDNTSGSEQSSEKLHILDYWRIIRVRI-----------
A0A2D7L1N4      ----------------------MDNTSGSEQSSEKLHILDYWRIIRVRI-----------
A0A2E2R937      ----------------------MDNTSGSEQSSEKLHILDYWRIIRVRI-----------
A0A2D5MR66      ----------------------MDKTSGLEQSSDKLHILDYWRIIRVRI-----------
A0A2E0PDQ1      ----------------------MDKTSGSEQSSDKLHILDYWRIIRVRI-----------
A0A2E2ZZP9      ----------------------MDKTSGSEQSSDKLHILDYWRIIRVRI-----------
A0A2A2RGF2      -----------------MDAAPKPTDSAPATPENRLHFLDYWRIIRMRA-----------
A0A2G4I5Y6      -----------------MDAAPHQAEPAPATPENRLHFLDYWRIIRMRG-----------
A0A3M1I883      ----------------------MQSTSSSARPQTEFHFLDYWRIIRIRK-----------
A0A1V6JZ45      ----------------------MDATKPNPISDSQLHFLDYWRIIRIRK-----------
A0A356NPK0      -------------------MQTKPSQQPQQQSDSKLHFLDYWRIIRIRK-----------
A0A2D7B5P5      -------------------MQTKPSQQPQQQSXSKLHFLDYWRIIRIRK-----------
A0A3D3XGB5      -------------------MQTKPSQQPQQQSDSKLHFLDYWRIIRIRK-----------
A0A2V6F8A1      ---------------------MEAPKTNSNPVETKLHFLDYWRIIRIRK-----------
A0A2V5TNH4      ---------------------MEAAKTNSNPVETKLHFLDYWRIIRIRK-----------
A0A2V5X5Q6      ---------------------METAKTNSNPVETKLHFLDYWRIIRIRK-----------
A0A139TS01      -----------------------MNAPDQQNGDPIVRNIDYIQVLKNRW-----------
A0A2V5URB2      EGPMKEISPHRARATMLLEDADLVSEPRLIESDEAPSLRDYWQIVRKHK-----------
A0A2V2DJ66      YGGYGAYGGYGG-----YGYGTNPAASGEGAEAPNRTLRDYFMILRERL-----------
R7L5A9          GGGYGGYGGYGGSYGGYYGGYNSKNPAGEGG-VPNRTFRDYMMILRERF-----------
A0A2V6JLK8      ----------------MGGSPPKGPTGMAHNEEVKLHFLDYWRVIRIRW-----------
A0A2W5Z1A5      ---------------------------MAETDEGKLHFLDYWRVVRVRW-----------
A0A2V6EA09      ---------------------------MAHNDEVKLHFLDYWRVVRVRW-----------
A0A2V6GQI7      ---------------------------MAHNDEVKLHFLDYWRVVRVRW-----------
A0A2A2XXW5      ----------------MEEQFQSQQGNSMSGADPSINLRQYWHVILERR-----------
A0A3R5R2M8      ------------------MNAAPNTTSPMEEEESSFSLDTVLVILRRFW-----------
A0A411SUQ6      SPGVQYFHTTFHPLSSMTNNTAPTPPVTENTEETALSLDTVLTILRRYW-----------
A0A2N8HZF2      ----------------MTNNTAPTPPVTENTEETALSLDTVLTILRRYW-----------
A0A354E720      ----------------MTKNTAPTPPGTENTEETALSLDTVLMILRRYW-----------
B2UPB6          ----------------MTNNTAPTPPVTENTEETALSLDTVLTILRRYW-----------
A0A3C1HEJ2      -----------------MATPSNYLPGDEGPEASSAVDLPSARTLIEKA-----------
A0A1V6JU76      -------------MSYSYYTSQAAPPEASESSSSNLNLRHYWNIVLQRR-----------
A0A1Q6UHJ9      GYGGGYGGGYGGGGYGYGYGYGGGQGEGGSPERPNRTFRDYMMILRERW-----------
A0A2V2BXR0      -----------------------------------------MMILRERW-----------
A0A2D8V0G3      ------------------MEFQQSSQATETSVAENLNLRHYWHILLERR-----------
A0A348S017      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A3C1UUV7      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A350I3V2      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A3D3XF90      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A2D7B522      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
A0A356NIC2      ------------------MESNNQHSMENQSVAENLNLRHYWHIVLERR-----------
R7DZW0          -----------------MKDLSPKKETLDVGGAAPASLLPSPRAIMGRI--------VRK
A0A2N8HID1      -----------------MKDLSPKKESLDAGGAAPVSLLPSPRAIMGRI--------VRK
A0A2N8HS06      -----------------MKDLSPKKESLDAGGAAPASLLPSPRAIMGRI--------VRK
A0A3R8IT45      DGR------YGYGYQEY--PGYGNENAAG-----HRTLGDYLLILRERI-----------
A0A1H1MGC9      SGEAYPYTYYGTSYSGYGSPGHGDNQ-------MQRSMQDYVLILRERA-----------
A0A2A2PYE8      NSSGYGYN-YGGNYAGYSAVGYGYGEGGGGGSHSQRTFQDYLLILRERI-----------
A0A2T6CN73      SGGGYSYG-TGGNYAGYSAAGYGYGD-AGESSTIQRTFQDYLLIVRERI-----------
A0A2N8HDG3      ----------------MPDTSAPPAVPPAEESESSLSLDVITGILLRRW-----------
A0A2U8DZK4      -------------------------MAYSDPVKESAPLPAFLQTLNLRK-----------
A0A1D8AWD4      -------------------------MPTLPSTKDSATLGDFVGLLRLRK-----------
A0A2T6DFL8      -------------------------MANVHAAPVGASVAGFLQILRQRQ-----------
A0A178IH18      -------------------------MARPDSSSETAALPEFFQVLRQRK-----------
A0A2T6DT99      -------------------------MASTHASREGASLADFFQLLRLRK-----------
A0A1G3ZT33      -------------------------MASIITSRDGGSLTDFFNILRLRK-----------
A0A3E1E2T2      -------------------------MAQPSASKDSATLADFLRLLRLRK-----------
B1ZMW1          -------------------------MVPTSASKDSASLADFMQLLRQRK-----------
A0A3D1TI55      --------------------------MDEKQQDSSLHFLDYWRVIRARK-----------
A0A2G4G428      GNYGGGYGGGYGRQRGGYGGGYGGGYGEGSSKDTEVSISTYVNMVRERI-----------
A0A3E1ET42      --------------------------MREQLNESKMHALDYWQVIRNRW-----------
A0A2A2YDW8      ------------------------MQPQSSNSEAALHAVDYWQVIKNRY-----------
A0A352XLN9      ------------------------MQPQSSNSEAALHAVDYWQVIKNRY-----------
A0A3D0YP62      -----------------------MQPQNSQQNEASLHAIDYWQVLKNRY-----------
A0A3D3DV47      -----------------------MQPQNSQQNEASLHAIDYWQVLKNRY-----------
A0A2A2QX62      ------------------------MNPTTNTSEASLHAIDYWQVAKNRY-----------
A0A3N5WCF1      --------------------MNTSAPQQ---NEAALHAVDYWQVIKNRY-----------
A0A2E5XJ49      --------------------MQNDLDRQSAASEASLHAVDYWQVLKNRY-----------
A0A2E6SBY8      --------------------MQNDPDRQPAASEASLHAVDYWQVLKNRY-----------
A0A2E5QMS4      --------------------MQNDPDRQTAASEASLHAVDYWQVLKNRY-----------
A0A2E7YXQ3      --------------------MQNDPDRQTAASEASLHAVDYWQVLKNRY-----------
A0A2E3H787      --------------------MRNGPDRQTSASEAALHAVDYWQVLKNRY-----------
A0A2E7AGN1      --------------------MRNGPESQTNASEAALHAVDYWQVLKNRY-----------
A0A2E7AKY7      --------------------MRNGPESQTNASEAALHAVDYWQVLKNRY-----------
A0A3D4CU34      --------------------MRNGPESQTNASEAALHAVDYWQVLKNRY-----------
A0A2E8M146      --------------------MPNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A355S8S2      --------------------MPNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A2D6DVN8      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A3C1W2R2      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A2E3NAY6      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A2E3II01      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A368B8C5      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
A0A3R7RBB5      --------------------MRNGPERQTNASEAALHAVDYWQVLKNRY-----------
B4DB23          ---------------------------MNDSNEVKLHFLDYWRIIRLRM-----------
A0A139TUL1      ----------------------MSIPVIQPEDNDIFSFRFIFSTARRYW-----------
A0A2N8HCB0      ----------------------MPVSVIQPEDNDIFSFRFIFSTARRYW-----------
A0A2N8HP04      ----------------------MPVSVIQPEDNDIFSFRFIFSTARRYW-----------
A0A2N8HRJ0      ----------------------MPVSVIQPEDNDIFSFRFIFSTARRYW-----------
A0A366HAG0      -------------------------MATPNNLELQRHALDYWQIIRNRL-----------
A0A3M1I8A3      ---------MAYQAYPQTAPADPVSLPPAGGAMGSMTLRHYWHVLLERR-----------
A0A0R2XQ77      GYSGYG-GYG-SNSYSDGGYGAG---GYGAGGAPQRSFKDYFLMFRERV-----------
A0A2E9IN28      GYGGYGYGYGYGGGYGYGGYGAGGGYGEGGGGAPQRSFKDYFLMFRERI-----------
D5ENH7          GYGGYGYGYG-GGSYGYGGYGSGGG-GAGYEQGPQRSAKDYLLMFRERI-----------
A0A351WE84      ------METSEATRASLVILGCGVKFMADSQQDTALHFLDYWRVIKSRK-----------
A0A146GCJ0      --------MPKDDGENLTSKPAVNLSFRDDTHGDLFDSERWFNLLRSKA-----------
A0A2T6D6H8      --------MVNKGAENKDRKSAAQVTLLRELSGEVIDFERLLNLLRARA-----------
A0A1V5QDZ6      -------------------------MEQQPSDSSGLHFLDYWRVIRSRK-----------
A0A3D4HF88      GYHGYHGYGGHGGAGYGGYGYGYGDDYSTQHRQPPRTFRDYIFILRERI-----------
A0A351MR11      SGGYGGYGGYGAYGESRYGGYGSVPAPGYGQAAGVNPLANYMLMLRERM-----------
A0A1V6J089      --------------------------MAEESQTTALHFLDYWRVIRDRK-----------
A0A3C1BZR1      --------------------------MAEESQTTALHFLDYWRVIRDRK-----------
A0A1H6KPB7      ----------------------MSSPAINQKSEASLHAGDYLQILRNRW-----------
A0A2E9ISN4      -----------MQIPNSTISESKPPTPADNDRETTTAFSNPWALVQLIF---------RH
B9XAX1          ---------------MKLRLSNEREIAEMTEVDRPLDVQEFLQTLIEKW-----------
I0JYY7          ---------MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSFSTGEWLKERFNEIYRY
A0A3E1EJT7      -------MNPPSPYARSSYAPVNPDFTDGEEPEDNDYLRRWWVMVLERK-----------
A0A317ZP96      GGYGYGSYGYGGGYGYGGAGYGYGGGYGGGGGGPQRSFKDYFLMFRERI-----------
A0A2D5WGA5      ----------------------MDKLPKTDQSSDKLHILDYWRIIRVRF-----------
A0A2E7SSH2      ----------------------MERKPGTEHSSDKLHILDYWRIIRVRI-----------
A0A349GXM8      -------------------MATPRPGGGVSTEENKIDFRIYLSVMLFRW-----------
B3DZK9          SEELQKKPKDNLTVGNKDVFQTEVLLSPYESSDLEWLKEKLWDIYRFRK-----------
A0A2A2XV69      ------------------------MMNSSDSNEIQLHFLDYWRVIRIRL-----------
A0A3C1VB86      --------------MPNPDPLDLPPSLETSAPGSISDLHGVIRLLLDKS-----------
A0A146G2Q9      -----------------------MSLESPDSGEIKLHFLDYWRVIRVRL-----------
A0A2T6D3Y2      -----------------------MSFESPDSGEIKLHFLDYWRVIRVRL-----------
A0A2V2SDV4      ----------------------MDPIKAAAPQDSKLHFLDYWRIIRIRK-----------
A0A2V5PK75      ----------------------MDPLKVPASQETKLHFLDYWRIIRIRK-----------
A0A1V6DME1      ----------------------MDPLKTTPPPETKLHFLDYWRIIRIRK-----------
A0A3D3DIJ3      ----------------------MDPLKVAPPQEAKLHFLDYWRIIRIRK-----------
A0A2D5VY59      ----------------------MQSKPVPQQSDSKLHFLDYWRIIRIRK-----------
A0A2D8UZZ4      ----------------------MQSKPVPQQSDSKLHFLDYWRIIRIRK-----------
A0A353DV86      ----------------------MQSKPVPQQSDSKLHFLDYWRIIRIRK-----------
A0A2E5EPT8      ---------------------MEYQSNGPTSSDNRLHFLDYWRILRLRK-----------
A0A350EWA4      -----------------------MDSFKQDQPTASLHFLDYWRIIRIRK-----------
A0A2N8HD92      -----------------------MNSQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8HIT2      -----------------------MNAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A354EBD3      -----------------------------------VRNIDYLQVLKNRW-----------
A0A355VEB2      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8IMT3      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
R6K1U5          -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8IWC2      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8I441      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A1Q6UTU9      -----------------------MNAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A2N8I3A6      -----------------------MNAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A410SCC4      -----------------------MNAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A3R5VEW0      -----------------------MSVQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A411SSG2      -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
B2UKW3          -----------------------MSAQDQQNSDRIVRNIDYLQVLKNRW-----------
A0A1M6RLZ4      ----------------------MQQNNSLNPSEASLHAVDYWQIVKNRY-----------
A0A354T7G8      --------------------------MNETGSEFQKHAMDTWQVVKNRI-----------
A0A2S7U4L6      ----------------------MQPNNSLNTSDATLHAVDYLQILKNRY-----------
A0A2E8MEZ0      ------------------------MQGTNFRNADDAPSVDYWQVVKNRY-----------
A0A2E3EC33      ---------------------------MAKQSETKLHALDYWQVIRNRY-----------
A0A2E4GN01      ---------------------------MAKQSETKLHALDYWQVVRNRY-----------
A0A1Z8XU55      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2E1RQR9      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2E3ISQ4      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2D6W6F4      ---------------------------MAKQSETKLHALDYWQVARNRY-----------
A0A2D8Z5A8      VEKTSECSYFADSKFILNSPQIKYIXTMAKQSETKLHALDYWQVARNRY-----------
                                                                            

A0A2A2XVF1      -WVITLLVGVSMMAATGYV-MRQPKIYESRAVLQVQQSEQQVVNIDGVSQENPS------
A0A2V5UHJ2      -WLILSCALALFIGATLYT-FTRTPLYTADATLLIERKAPQILKLQDARADSVDYNDY--
A0A2V5PST3      -RIIIQIFIIFLLVGAYFT-FTATPVYKATATLKIEPINPMVTGVTGVGESGARTAEGGG
A0A2V5PXM3      --------MVAAIGTTTYL-LRAPKIYASKLVLQVEQEEQKILNIQRVQQEDPQ------
A0A139SU05      -WIALPLALLVSLVIGYYQ-ARQTPMYASTAIIQFERPETVVTTQTVMDATIR-------
A0A1D8AZK8      -WIALPVALLVSLSVGYYK-AQETPMYSSVATMQFERPERVVQNEQVVDTSVR-------
A0A1Q6UXG8      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASSERIMAELGIDS---
A0A2N8I9W1      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASSERIMAELGIDS---
A0A3R5SIG7      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASSERIMAELGIDS---
A0A2N8IBZ6      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASSERIMAELGIDS---
A0A2N8IJW9      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASSERIMAELGIDS---
R6J100          -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASSERIMAELGIDS---
A0A139TV24      -YWILFCALLGGTAAYYMA-ATQNYVFEKTASVMMREASKD--SSTDRIMVELGVDS---
A0A2N8HT11      -YWILLFALLGGAGAYYVT-GKQNYIFEKTASVIMRESNKDS-SSSDRIKVELGMDS---
R7DS70          -YWILLFALLGGAGAYYVT-GKQNYIFEKTASVIMRESNKDS-SSSDRIKVELGMDS---
A0A2N8HNL6      -YWILLFALLGGAGAYYVT-GKQNYIFEKTASVIMRESNKDS-SSSDRIKVELGMDS---
A0A1V5QB01      -WLVALCFVLSLTVMVAIL-VRQVPVYRCRVTLLMSKGVPMPYSLRQVESQP--------
A0A139SPN4      -WIALPLALLVALGIGYYQ-ARQTPMYASTAIIQFERPETIVTTQGVVDASIR-------
A0A1V6E7N1      -WIALPIALLVAVGIGYYQ-SRATPLYQSRATLRFEKPDRIVATEGVTRPEVQ-------
A0A2T6CWI7      -WIALPLALLVAVGYAYKN-LQETPRYAATARMQFEKPDRIVMAEGVVDTAVR-------
A0A2D9MYT1      -WLVAATFLVVIILTAFYL-FSATPIFSATTRLQIDRETENALRMESFVMEGAR------
A0A258ANJ7      -WIPITLSLFGLILGYAYF-KRQKPVYEAVSVAQFGSEQSSLLGLNSMSTPGLG------
A0A139TLN4      WYWCLLSLCICLPLAYLYA-ARLPFVYGKATTVLIKNDYPKESVATTVLATSNGIVNT--
A0A1G3ZFT0      -WLIAVIIAISLMGGKYYA-SKQIPVYNPDVLIQVESNRGVSGLTIGLPGMGGGSGPS--
A0A1Z8ZMT6      -HWILIGSLLGVVLGVITI-RMSVPEYRSTATVRVKSQNSGSMG----NSSDSDDIDLQS
A0A2E8MCT7      -HWILIGILLGVVLGVINI-RMSVPEYRSTATVRVKSQNSGSMG----NSSESEDIDLQG
A0A290QGD9      -WYILAVFLVIFSCVLVYT-LTQTKIYQSRSLIQILRRDPAVLKVQSVTDNDVR------
A0A1D8AS58      -WYIVLVFALVFSAAVIFT-FTRVPRYTSVASVQVFRNDPVVMQVQSVVNNEIR------
I6AQC1          -WYIVVVFLVIFSSALVYT-FSQTKIFSSSATVQIMRRPAMTLPTPELLPTNVI------
W0ITH7          -WYIVVVFLVIFSSALVYT-FSQTKIFSASATVQIMRRTAVTLPTQNPIDNNVL------
A0A290Q2Z2      -ALIFLILSLVVITTVVVT-AFLPKWYLSTLNVRVEKPEGEVKLFQAQSSGYY-------
A0A2A2RGK2      -WIVILCVILGGIYAGFTL-SKIETTYRARAVLFIEQDQARILDPRFSQVRDEQIR----
A0A2A2XXF7      -WIVILCVVVGGIYAGVTL-SKVETTYRARAVLFIEQDKSRILDAKMEQVRDEQIR----
A0A2A2R5D6      -AIIVTVLLLTLMTGYVVTVYVMQKMYDAKAQLRVYKEKSDVEFMG--NSRTDAPF----
A0A1J4XH17      -WLLVFVFAIIFLGSIIYL-IKATPIYEAEAMLQILRDDTTVLGVRSVESNEVR------
A0A3C1VJ32      -AIIITVFLITAIIATAVT-LILPESYASTARIKVENEGGIVSGMGNSPAATSFGY----
A0A2N9NTX7      -TVILAVFLLVVITATVVT-FILPPKYKSMARIKIERDQTDIPSLTQQQGSFSP-Y----
B9XK55          -TVILAVFLLVVITATIVT-FILPEQFSSTARIKVEGDTTDVPGITQTPNYSGH-Y----
A0A2E6T482      -VTILLVFLLTAVTTTVVT-FLLPRTYMSLSRISVEKDSSDIAPLLGMQAGPTA-F----
A0A3C0DQZ7      -VTILLVFLLTAVTTTVVT-FLLPRTYMSLSRISVEKDSSDIAPLLGMQAGPTA-F----
A0A1Z9CBK5      -ATILLVFLLTAITTTVVT-VMLPSTYMSLSRIAVEKDTSDIAPLMGVQATQSS-F----
A0A2D6ZI96      -ATILLVFLLTAITTTVVT-VMLPSTYMSLSRIAVEKDTSDIAPLMGVQATQSS-F----
A0A358KGZ3      -VTILLVFLLTAITTTVVT-FLIPKTYMSLSRIAVEKDTSDIAPLLGMQATQSS-F----
A0A2E9ZQX4      -VTILLVFLLTAITTTVVT-FLIPKTYMSLSRIAVEKDTSDIAPLLGMQATQSS-F----
A0A3D5JZU0      -VTILLVFLLTAITTTVVT-FLIPKTYMSLSRIAVEKDTSDIAPLLGMQATQSS-F----
A0A2E6HCR0      -ATILLVFLLTAITTTVVT-FLIPPTYMSISRIAVEKDTSDIAPLMGVQTAQSS-F----
A0A1Z8WN04      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGAQSSQSS-F----
A0A2D7L1N4      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGAQSSQSS-F----
A0A2E2R937      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGAQSSQSS-F----
A0A2D5MR66      -ATILLVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGVQASQSS-F----
A0A2E0PDQ1      -AIILVVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGVQAAQSS-F----
A0A2E2ZZP9      -AIILVVFLLTAITTTVVT-FLIPPTYMSLSRIAVEKDTSDIAPLMGVQAAQSS-F----
A0A2A2RGF2      -LLIFVVFALVVGTTALLT-HNMEPTFMSTVRMDVQKDVGDISSLMPQQQ-QGG-F----
A0A2G4I5Y6      -LLIFVVFALVVGTTAVLT-HSMEPTYMSTVRMDVQKDVGDITSLMPQQQ-QGG-F----
A0A3M1I883      -MVILAVWLLVVLTTLAVT-FVLKPTYASTVRIEIEKDATDIPTIGGQQR-DPS-F----
A0A1V6JZ45      -TVILAVFLLVVLTTTAVT-FVLKPTFMSTARIEVEKQPTDFDPFLRPQV-QNQ-F----
A0A356NPK0      -TVILAVFLLVVLTTAIIT-FLIQPTYASSVRIAIEKDNSDITPLMGLQA-AQQ-H----
A0A2D7B5P5      -TVILAVFLLVVLTTAIIT-FLIQPTYASSVRIAIEKDNSDITPLMGLQA-AQQ-H----
A0A3D3XGB5      -TVILAVFLLVVLTTAIIT-FLIQPTYASSVRIAIEKDNSDITPLMGLQA-AQQ-H----
A0A2V6F8A1      -TVILAVFLLVVLTTTAVT-FILPESWSSMVRIAVEKDISDISPLGITQN-STQ-Y----
A0A2V5TNH4      -TVILAVFLLVVLTTTAVT-FILPESWSSTVRIAVEKDVSDINPIGFAQN-NSA-Y----
A0A2V5X5Q6      -TVILAVFLLVVLTTTAVT-FILPESWSSTVRIAVEKDVSDINPIGFTQN-NSA-Y----
A0A139TS01      -KEVFLVFMLVLVISLVVT-LLMPPSFRATSKFQIKRPRPVMGIGTGEDVVASSNI----
A0A2V5URB2      -WKILACFLAAVVITAIIV-FSMTPIYTATATLLIERKAPQVVKIQQVLSESIEAD----
A0A2V2DJ66      -WYIIVTFIVIFSGIALYT-LRITPLYTSASSVLIFREA---------AAPIDGPGSSDR
R7L5A9          -WYIIVTFFIIFAGVLLYT-FRITPIYTSAASVQILRDS---------DSPIDGPGSTER
A0A2V6JLK8      -VLVLLAFLLVLITAAIFT-YFQPREYKADVFVEVKSTAENPRIFG--QGDPNQPIH---
A0A2W5Z1A5      -VLILLAFSLVLITAAVVT-YFQPREYQSSAFIEVRSTAQNPHIFS--QIDPSQPVH---
A0A2V6EA09      -GLISLAFFLVLITAAIVT-YFQPREYKASAFIEVKSTAENPRIFG--N-DLHQPVH---
A0A2V6GQI7      -GLISLAFFLVLITAAIVT-YFQPREYKASAFIEVKSTAENPRIFG--N-DLHQPVH---
A0A2A2XXW5      -WLIVATWSVCIIAGVLYA-FQATPMFRAIARLQIDPENQGVLNLNSMALGNS-------
A0A3R5R2M8      -FLIILAAIAGGSLAFYLA-GRQNYVYQKTASVMMRDAKSGTDASSERIMSELGIDS---
A0A411SUQ6      -FIIILAALAGGTAAYYLA-GKQNYIYQKTASVLMRDAKTGSDASSERIMAELNIDP---
A0A2N8HZF2      -FIIILAALAGGTAAYYLA-GRQNYIYQKTASVLMRDAKTSSDASSERIMAELGIDS---
A0A354E720      -FIIILAALAGGTAAYYLA-GKQNYIYQKKASVLMRDSKTGSDASSERIMAELNIDP---
B2UPB6          -FIIILAALAGGTAAYYLA-GKQNYIYQKTASVLMRDAKTGSDASSERIMAELNIDP---
A0A3C1HEJ2      -WVVVLCLLAAGFITYGYL-KRAPVIYASTVTLKVEEQSQKILSGL--QEGVRDDGE---
A0A1V6JU76      -WLVIATFVSVFVLCLVYL-FKAPRIYSATARLQIDRESAASLNLNEVVMSMT-------
A0A1Q6UHJ9      -AYILITALIILAGVILYT-LRVTPIYMSVSRVQILRDS---------DVAIEGPGSTDR
A0A2V2BXR0      -AYILITALIILAGVILYT-LRVTPIYMSVSRVQILRDS---------DVAIEGPGSTDR
A0A2D8V0G3      -WLVITTFISVVILSVLYL-YRAVPIYQAKTVLQINKESTSIMDVG--SQVVFNSN----
A0A348S017      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA--TPIVFNSN----
A0A3C1UUV7      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA--TPIVFNSN----
A0A350I3V2      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA--TPIVFNSN----
A0A3D3XF90      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA--TPIVFNSN----
A0A2D7B522      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA--TPIVFNSN----
A0A356NIC2      -WLVIVAFISVFILSILYL-FKATPIYEAKTVLQINKESTSMMDGA--TPIVFNSN----
R7DZW0          WYWCVLSLCICLPLAYLYA-ARQPQVYGKATTILIKDDYPRESVAATVLASTNGIVNT--
A0A2N8HID1      WYWCVLSLCICLPLAYLYA-ARQPQVYGKATTILIKDDYPRESVAATVLASTNGIVNT--
A0A2N8HS06      WYWCVLSLCICLPLAYLYA-ARQPQVYGKATTILIKDDYPRESVAATVLASTNGIVNT--
A0A3R8IT45      -WYIVVVFLVIFSSALVYT-FSQTKIYRAMATAQILRKTATMFSQS--REMLDSTMF---
A0A1H1MGC9      -WYIVLVFALVFSAATIFT-FTRVPQYQSVASVQVFRRDPVVM-QV--QGVVDNEIR---
A0A2A2PYE8      -WYIVVVFLVVFSSSLVYT-LSDTKIYQSSATVQIFRRDPTVM-QV--QQVVDTDIR---
A0A2T6CN73      -WYIVVVFLVVFSSALVYT-LSKPKIYESTATVQIFRRDPTIM-PG--QQVVDTDIR---
A0A2N8HDG3      -YWILLFALIGGGAAYYLT-GRQNYIFEKTASVIMRESSKESTSDRIKVDLGMDS-----
A0A2U8DZK4      -ALILLILALVVITTIAVT-AFLPKWYRSKASIRVLKIGTTSAVFQAQSNDYY-------
A0A1D8AWD4      -GLIFLVLGLVLLTTLGVT-ALLPKWYLSTAKISVQKPESEVKLFQAQSNTYY-------
A0A2T6DFL8      -WLIALILALVVVTTIGVT-AFLPKGYRATTKVRVERPDGQVKLFQAQTSPSY-------
A0A178IH18      -FLILLVMALVVGTAAVVT-ALLPKWYLSTINIRVEKPEGKV-VFENQANNYY-------
A0A2T6DT99      -ALIFLILSLVVVTTAVVT-ALMPKWYVSTLNVRVEKPEGEVKLFQNQQSAYY-------
A0A1G3ZT33      -ALIFLILALVLLTTLGVT-ALLPRWYLSTVAMRVEKPESEVKLFQAQSSSYY-------
A0A3E1E2T2      -SLILLILSLVVITTVAVT-AFLPRWYLATAKIRVEKPESEVKLFQAQSSSSY-------
B1ZMW1          -ALIALILGLVLITTIVVT-AFLPRWYLATTKIRVEKPEGEVKLFQAQSSSYY-------
A0A3D1TI55      -EIIITVSVLIILTVFIIT-LIMPEKYRASVRITIDQYRPDIELVD--RGRQSQY-----
A0A2G4G428      -WWLVLSVLIFFTLSLVYT-YNMMPEYKASGRLRVFRLAPNISGSNTAAESNFSIT----
A0A3E1ET42      -GVILLTFFLIALASLVII-ALLDKKYQSTTRFRVL------------LSSAIDPFQTNE
A0A2A2YDW8      -GVILITLLLVFMTAAVIT-YVMPRKFESRAVVQVNP-----------SNRFGTAF-GDD
A0A352XLN9      -GVILITLLLVFMTAAVIT-YVMPRKFESRAVVQVNP-----------SNRFGTAF-GDD
A0A3D0YP62      -GVILLTFLLVFLTAAVIT-YVMPKKYESAALVEVK-PISDIDPVGMRGGGIGTPM----
A0A3D3DV47      -GVILLTFLLVFLTAAVIT-YVMPKKYESAALVEVK-PISDIDPVGMRGGGIGTPM----
A0A2A2QX62      -GVILLTFLLVFMTALVIT-YVMPKKYESTAVVQVRP-----------KGAGAVMMPGTE
A0A3N5WCF1      -GIILLTLLLVFMTAAVIT-YVMPKKYESQAVIEVKPRMPGMSPL---GAAMTETSGGGR
A0A2E5XJ49      -GVILLTFLLIFMTAAVIT-YVIPKQYESTALVQVNHSFVELDPL---NGVAGAPMTGAS
A0A2E6SBY8      -GVILLTFLLIFMTAAVIT-YVIPKQYESTALVQVNHSYIELDPL---NGAAGPPMTGAS
A0A2E5QMS4      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---NGAAGHPMTGAS
A0A2E7YXQ3      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---NGAAGHPMTGAS
A0A2E3H787      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---NGAAGRPMTGAS
A0A2E7AGN1      -GVIILTFLLIFMTAAVIT-YVLPKKYESTALLQVNYSYIELDPL---NGSVGQPMTGAS
A0A2E7AKY7      -GVIILTFLLIFMTAAVIT-YVLPKKYESTALLQVNYSYIELDPL---NGSVGQPMTGAS
A0A3D4CU34      -GVIILTFLLIFMTAAVIT-YVLPKKYESTALLQVNYSYIELDPL---NGSVGQPMTGAS
A0A2E8M146      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A355S8S2      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A2D6DVN8      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A3C1W2R2      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A2E3NAY6      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFVELDPL---NGSVGQPMTGAS
A0A2E3II01      -GVILLTFVLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A368B8C5      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
A0A3R7RBB5      -GVILLTFLLIFMTAAVIT-YVLPKKYESTALLQVNHSFIELDPL---NGSVGQPMTGAS
B4DB23          -GLILLTFFLVMVTAGVTT-YFLPKKYYSKVTMEVKQDKSDLVQTF--GPGQFRQTY---
A0A139TUL1      -LWILAAALLGGAGAYFIF-ARQGYLYEKTARIMLRDDKQKNSQVS--EIILSDLGVRA-
A0A2N8HCB0      -PWILACALLGGGLAYFIS-ARQGYLYQKTARIMLRDDKQKNAQVS--EIILSDLGFKP-
A0A2N8HP04      -PWILACALLGGGLAYFIC-ARQGYLYQKTARIMLRDDKQKNAQVS--EIILSDLGFKP-
A0A2N8HRJ0      -PWILACALLGGGLAYFIC-ARQGYLYQKTARIMLRDDKQKNAQVS--EIILSDLGFKP-
A0A366HAG0      -GLILASFIFIFAVAAVLT-YIMPRKFRGRVEMVIERKLDDARVVG--NANLQDDNLAS-
A0A3M1I8A3      -WLVIMVLILSVAASVGYV-VKAPRIFRATVRLQIDPESETGVNLR--DGFGGVSRM---
A0A0R2XQ77      -WYLIVAFFIIFSGSILYT-FNKTKVYTAVATVQLLRDDPSAMA-S--AEMEMNQIR---
A0A2E9IN28      -WYLIVAFFIIFSGSILYT-FNKTKIYTAAAQVQLFRDDASALGKG--AEMEQNQIR---
D5ENH7          -WWMIVAFFIIFSGAILYT-FNKTKVYTAVAQVRLLREDPAAMGDQ--VDLAQDSIR---
A0A351WE84      -EIVMAVTLLIVITGVAVT-FMQPKKYSSTVRILVREDSMDVDVFE--RQMIQGY-----
A0A146GCJ0      -WLIAAVAVVVVIGAAAYA-FRLPKIYESRALLQVEQLAQKVVDIA--DVSQENPQ----
A0A2T6D6H8      -WLVIVVAVIFFAAAFAYA-LRSPKIYESRALIQVEQASQNVVDID--DIARENPQ----
A0A1V5QDZ6      -EVILAVLLLVVVTGTSFT-LTLPKKYMADARILVRDDSLDVDVFE--RQIPQAY-----
A0A3D4HF88      -WFFLVIFLIVFLGSVLYT-FNTTPLFTAGATVQVLRDPVNPLGAG--AEDITKEEIR--
A0A351MR11      -WYLVLTVLVFVTAALIYT-VNATPEYRASGRLKVYKYAPNITGRG--AGEELYAIM---
A0A1V6J089      -EVILAVALLTIVSGTAYT-LMMPKKYTALTQIQVREDAMDVDPFY--QRDINRMGY---
A0A3C1BZR1      -EVILAVALLTIVTGTAYT-LMMPKKFTATTQLEVREDAMDVDPFY--ERQASRMGY---
A0A1H6KPB7      -KEAVLVFVLVFVAAAVAT-YLMPPSYTSVINFEIKKPGAIVSLSR--GAERVLQNNA--
A0A2E9ISN4      WSWLVCSVVLCTLLGGLYA-YLATPIYRATARIEILNDSRVETRAT--TQYDR-------
B9XAX1          -WLIVLVTCAVTLPAFWWV-RNVPVGYQARAVLQVEQEEQRLVGIE--EVSRQDLR----
I0JYY7          KAVVVISFLLILLFTILFT-FTQKPVYRGVATIKINFNKSEVLPYK--TVGEDQAGLFD-
A0A3E1EJT7      -WYALAAFVVIVAGVSAYT-FLSTPIYAGQVTVQVLKHGSQVMRVA--DVVDSNIT----
A0A317ZP96      -WYLIVAFFIIFSGSILYT-FNKTKVYTSAATVQLLRDDPS------------ALGDTVE
A0A2D5WGA5      -INIMLVFLLTALTTTLVT-FLLDKTYMSQSRISIEKDTSDIAPLL--GMQTGPTAF---
A0A2E7SSH2      -ATILLVFLLTAITTTAVT-FLIPATYMSLSRIAVEKDTSDIAPLM--GMQATQSSF---
A0A349GXM8      -QLIALCFLYTMLGAVAYL-YLAPKTYESNTKIMIYRDPLLTVSNE--GA----------
B3DZK9          -QALLF-FLVCLFVVFLFT-FSQKPIYRGESVVKINSTKSEVVPYK--QVSNDEPGLFD-
A0A2A2XV69      -PLIVLVFLLVVITTGVVT-YFLPKQYESSVTMQVNQNDTYLQVFD--DRGGGRGF----
A0A3C1VB86      -WLIVSCLVLALLAAAVYV-ERAPRVYAATTTVQVEQADAKVVKVE--QVVSEDMR----
A0A146G2Q9      -PLIILVLLLVVITAGVVT-YFMPKQYASTVTMQIRQNDKVLQVFG--QGGVQGL-----
A0A2T6D3Y2      -PLIILVLLLVVITAGVVT-YFMPKQYASTVTMQIRQNDKVLQVFG--QGGVQGL-----
A0A2V2SDV4      -AIILAVFLLVVITTVVVT-FIYPESFSGTARIRVERDQSDISGVL--QGQAFPSSY---
A0A2V5PK75      -TVILAVFLLVVITATLVT-FILPESYSSKARI----DSPDISGIA--KRMPTA-GY---
A0A1V6DME1      -TVILAVFLLVVLTATLVT-WILPVSYSSEARIKVDRDVSDIPGMT--QTPLLP-GY---
A0A3D3DIJ3      -TVILAVFLLVVITATLVT-FILPESYSSKARIKIDRDQTDISGLA--DRSTLA-GY---
A0A2D5VY59      -TVILAVFLLVVLTTALVT-YILKPTYSSSVRIAIEKDSADITPLI--GMQMSQQH----
A0A2D8UZZ4      -TVILAVFLLVVLTTALVT-YILKPTYSSSVRIAIEKDSADITPLI--GMQMSQQH----
A0A353DV86      -TVILAVFLLVVLTTALVT-YILKPTYSSSVRIAIEKDSADITPLI--GMQMSQQH----
A0A2E5EPT8      -GVIFVNFIFVVLVATFVT-YLLPKTYKSTVRMDVKKDTAS-DIEL--LGGTPQGPDF--
A0A350EWA4      -TVILAVFLLVVLTTTLVT-FLLPESYSSTVTIEVKKDSSTLDRIG--GPTAVQGF----
A0A2N8HD92      -KEVFLVFLLVLVISVVVT-FLMPPAYQTRCQFQIKLPKPVMEIGQ--GGDVVATSNV--
A0A2N8HIT2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMEIGQ--GGDVVASSNV--
A0A354EBD3      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVVATSNV--
A0A355VEB2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVVATSNV--
A0A2N8IMT3      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVIATSNV--
R6K1U5          -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVIATSNV--
A0A2N8IWC2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVVATSNV--
A0A2N8I441      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVVATSNV--
A0A1Q6UTU9      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVVATSNV--
A0A2N8I3A6      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVVATSNV--
A0A410SCC4      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVVATSNV--
A0A3R5VEW0      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVVATSNV--
A0A411SSG2      -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVVATSNV--
B2UKW3          -KEVFLVFLLVLVISVVVT-FLMPPSYRATSQFQIKLPKPVMDIGR--GGDVVATSNV--
A0A1M6RLZ4      -GIILLTFILVVVTAAVIT-YVMPKKYESVAQIEIKPLGIKTDTV-------LGQDTSGR
A0A354T7G8      -GLITLCFILIFAAAAILT-YIMPRKYRGHVEMTIERITQDINVFD--R-----NRGDSL
A0A2S7U4L6      -GIILLTFILVVLTAAVIT-YVMPKKYEAIAVVKINPLGTNNQVL---------GSGSSA
A0A2E8MEZ0      -GVILLTFLLVFMTAAVIT-SVMPRKYESSSVVQVHPSVLLMTPF----------LGGSQ
A0A2E3EC33      -TVILLTFFLVIMTAAVIA-YLRPPEYLGRVQIQVQREARDLEVFR--ETGSVGNLGTES
A0A2E4GN01      -SVXLLTFFLVXMTAMVIA-YLRPPEYLGRVQIQVQREARDLEVFR--ETGTVGNLGSES
A0A1Z8XU55      -SVILXTFALVFMTALVIA-YLRPSEYLGRVXIQVQRVARDIEVFR--ETGSVGNLGSEQ
A0A2E1RQR9      -SVILXTFALVFMTALVIA-YLRPSEYLGRVXIQVQRVARDIEVFR--ETGSVGNLGSEQ
A0A2E3ISQ4      -AVILLTFALVFMTALVIA-YLRPSEYLGRVQIQVQREARDIEVFR--ETGSVGNLGSEQ
A0A2D6W6F4      -AVILLTFALVFMTALVIA-YLRPSEYLGRVQIQVQREARDIEVFR--ETGSVGNLGSDQ
A0A2D8Z5A8      -AVILLTFALVFMTALVIA-YLRPSEYLGRVQIQVQREARDIEVFR--ETGSVGNLGSDQ
                                          :                                 

A0A2A2XVF1      -------SPDFINTVVQSITSRNLMLRVIDA------------NKLRTNPAFVAP-----
A0A2V5UHJ2      -------NNEFYKTQYEILKSRALAERVVRD------------EGLESHPLFGGG-----
A0A2V5PST3      -------PYDYYQTQYKLLASSALAARVIAD------------LRLDSNKIFTGA-----
A0A2V5PXM3      -------SLEFLKTVEQTFESRSLFERVLDT------------NNLATDPRFLKI-----
A0A139SU05      -------NELDLNTYIHQLTSNRVRTRVLES------------LTPEEVAIIQRP-----
A0A1D8AZK8      -------SDVDLNTYIQILTSGRLRTMVSQS------------LTPEEIKILQRP-----
A0A1Q6UXG8      -------GAANLANESFILKSTALMKKVVED------------LNLNTS--YWQK-----
A0A2N8I9W1      -------GAANLANESFILKSTALMKKVVED------------LNLNTS--YWQK-----
A0A3R5SIG7      -------GAANLANESFILKSTALMKKVVED------------LNLNTS--YWQK-----
A0A2N8IBZ6      -------GAANLANESFILKSTALMKKVVED------------LNLNTS--YWQK-----
A0A2N8IJW9      -------GAANLANESFILKSTALMKKVVED------------LNLNTS--YWQK-----
R6J100          -------GAANLANESFILKSTALMKKVVED------------LNLNTS--YWQK-----
A0A139TV24      -------GAANLANESFILRSSTVMRHTVED------------LKLNVS--YWKK-----
A0A2N8HT11      -------GAANLANESFILRSSTVMRNTVED------------LTLNVS--YWKQ-----
R7DS70          -------GAANLANESFILRSSTVMRNTVED------------LTLNVS--YWKQ-----
A0A2N8HNL6      -------GAANLANESFILRSSTVMRNTVED------------LTLNVS--YWKQ-----
A0A1V5QB01      -------MGDYLATQQLIIQSGQLISRARAR---------------------LNK-----
A0A139SPN4      -------NEIDLNTYIHQLTSNRVRTRVLES------------LTPEEIAIIQRP-----
A0A1V6E7N1      -------SEFDINTYLEILKSDKLRQRVVNS------------LSPQEVKILQRP-----
A0A2T6CWI7      -------SEVDMNTHTEVLKSSSLREEVVAS------------FSADEIKVLQRA-----
A0A2D9MYT1      -------EQDYLQTQYKNLQSRSLMEMALEETLQNAMILDGLKAGRRNPKQLIGETGLSE
A0A258ANJ7      -------DEKSVNTLIQAAKSREVIGRVISE------------LNLTQLPSFSGG-----
A0A139TLN4      -------ASTNLDNEIFLLSSYSLMEEVVRK------------LKLDVT--YWKK-----
A0A1G3ZFT0      -------LGSPAAIQIALIKSRYILTPVIQS------------LHLNTN---LSPSHPQS
A0A1Z8ZMT6      LEAAEDIRSDFDRTELFLAVASDPTVRNLAN------------LIPPEAPSIMEV-----
A0A2E8MCT7      LEAVEDIRSDFDRTELFLAVASDPTVRNLAN------------LIPPDPPSIMGI-----
A0A290QGD9      -------SLEDLNTIVQILESGTIIQKVSDR------------LTGEKLAQFMAP-----
A0A1D8AS58      -------SAEDLNTQVKVLESLAIVQRVADR------------LTGADLELFMAP-----
I6AQC1          -------STEDMNTMVKIFESPTIIQKVSER------------ITGDELRRFMQP-----
W0ITH7          -------STEDMNTMVKIFESPTIIQKVSER------------ITGDELRRFMQP-----
A0A290Q2Z2      -------DPYFLQDQFKIMQSAKVLYPVIEN------------LGLNDK---IGR-----
A0A2A2RGK2      -------SIDMINTVVDLIRSYPFSQRVSAR------------LKLDQDPRFLSA-----
A0A2A2XXF7      -------SIDMINTVVDLLRSYSFAQRVSAR------------LKLDQDPRFLAA-----
A0A2A2R5D6      -------DLVFFTSEISTIQSKKILNPVIEK------------LGLQKE---WGT-----
A0A1J4XH17      -------TSEDLNTQIKVLESSTLAKAVADR------------LQKENLTDVFLA-----
A0A3C1VJ32      -------DPYFIQTTFEIMQSQLVLSNVIAT------------MNLNVE---WGK-----
A0A2N9NTX7      -------DPYFMQTEFELMKSEVVLDKVIKN------------LNLNEE---WG------
B9XK55          -------DPYFIQTEFEVIQSEVILDRVIEG------------LNLNEA---WK------
A0A2E6T482      -------DPYFIQTEFEKIQSQKVLDKVVEK------------CDLTNK---WDP-----
A0A3C0DQZ7      -------DPYFIQTEFEKIQSQKVLDKVVEK------------CDLTNK---WDP-----
A0A1Z9CBK5      -------DPXFISTEFEKIQSQVVLDAVVES------------CELQEK---WKE-----
A0A2D6ZI96      -------DPXFISTEFEKIQSQVVLDAVVES------------CELQEK---WKE-----
A0A358KGZ3      -------DPYFISTEFEKIQSQKVLDEVVKS------------CELREK---WKK-----
A0A2E9ZQX4      -------DPYFISTEFEKIQSQKVLDEVVRS------------CELREK---WKK-----
A0A3D5JZU0      -------DPYFISTEFEKIQSQKVLDEVVKS------------CELREK---WKK-----
A0A2E6HCR0      -------DPYFISTEFEKIQSQIVLDAVVRS------------CELRDE---WKD-----
A0A1Z8WN04      -------DPYFISTEFEKIQSQIVLDAVVET------------CELREE---WKD-----
A0A2D7L1N4      -------DPYFISTEFEKIQSQIVLDAVVET------------CELREE---WKD-----
A0A2E2R937      -------DPYFISTEFEKIQSQIVLDAVVET------------CELREE---WKD-----
A0A2D5MR66      -------DPYFISTEFEKIQSQIVLDAVVAT------------CELREE---WKD-----
A0A2E0PDQ1      -------DPYFISTEFEKIQSQIVLDAVVSS------------CELREE---WKD-----
A0A2E2ZZP9      -------DPYFISTEFEKIQSQIVLDAVVSS------------CELREE---WKD-----
A0A2A2RGF2      -------DPYFVMTQFEILQSKEVLYKVIDD------------LKLVPR---WDQ-----
A0A2G4I5Y6      -------DPYFVMTQFEILQSKEVLYKVIDE------------LKLVQR---WDQ-----
A0A3M1I883      -------DPYFMATEFEKIQSMSVLMPVIHSPTNAAGEKLPPDRQFIPA---WSK-----
A0A1V6JZ45      -------DPYFIQTEFEKIQSKPILYKVIES------------LDLRKT---WGQ-----
A0A356NPK0      -------DPYWVLTEYEKIQSKKVIHPVINA------------LGLNHK---WME-----
A0A2D7B5P5      -------DPYWVLTEYEKIQSKKVIHPVINX------------LGLNHK---WME-----
A0A3D3XGB5      -------DPYWVLTEYEKIQSKKVIHPVINA------------LGLNHK---WME-----
A0A2V6F8A1      -------DPFFLQTEFEKIRSQKVLYKVIDN------------LKLNER---WGE-----
A0A2V5TNH4      -------DPFFIQTEFEKIRSRKVLYKVIEN------------LKLNER---WGG-----
A0A2V5X5Q6      -------DPFFIRTEFEKIRSRKVLYKVIEN------------LRLNER---WGE-----
A0A139TS01      -------TDNYIPMQYSVLTSSEVLKVVSKK------------LNLAAE---WGM-----
A0A2V5URB2      -------ERSYYESQYEMLKSRSLAAEVIKGQGLDRNPQ----FTGQARHKNFAAELWSR
A0A2V2DJ66      TRNDKVLSVEDFNTQVKILESNEVIRAVRSR------------LKEDDLRKLMAP-----
R7L5A9          SRNNVIMSMEDFNTQVKLFESAEIVKAVKSR------------MKEDELKRFIAP-----
A0A2V6JLK8      -------DPQLAPTVYQVIQRTGILYPVIEQ------------LKLQDK---WAR-----
A0A2W5Z1A5      -------DPTLAPTVFQVIQRTGILYPVIDE------------LKLQEK---WAN-----
A0A2V6EA09      -------DPELAPTVFQVIQRTGILYPVIDD------------LKLQDK---WGK-----
A0A2V6GQI7      -------DPELAPTVFQVIQRTGILYPVIDD------------LKLQDK---WGK-----
A0A2A2XXW5      -------DQNYLTTQYRNLESRSLILAVMNK------------LKLETDDERYTK-----
A0A3R5R2M8      -------GAANLANESFVLKSTAIMQKVVED------------LKLNTS--YWQA-----
A0A411SUQ6      -------NAANLANESLVLKSTALMNKVVED------------LNLNTS--YWQK-----
A0A2N8HZF2      -------GAANLANESFILKSTALMKKVVED------------LNLNTS--YWQK-----
A0A354E720      -------NAANLANESLVLKSTALMNKVVED------------LNLNTS--YWQK-----
B2UPB6          -------NAANLANESLVLKSTALMNKVVED------------LSLNTS--YWQK-----
A0A3C1HEJ2      -------RPEDLKTIIETLKSRAVIERVIET------------NHLATDPRVVEP-----
A0A1V6JU76      -------DQDYLQTQYRNLLSRSLLEIVIKR------------EKINEDSRYRDS-----
A0A1Q6UHJ9      SRNNTVLTIEDFNTQVKILESNEIIKAVKSR------------MKEDEIVRFMAP-----
A0A2V2BXR0      SRNNTVLTIEDFNTQVKILESNEIIKAVKSR------------MKEDEIVRFMAP-----
A0A2D8V0G3      -------DQEYLQTQYKNLLSRSLIESVITD------------LELKQDEVFKGA-----
A0A348S017      -------DQEYLQTQYKNLLSRSLIESVVRD------------LGLDEEGRYAQS-----
A0A3C1UUV7      -------DQEYLQTQYKNLLSRSLIESVVRD------------LGLDEEGRYAQS-----
A0A350I3V2      -------DQEYLQTQYKNLLSRSLIESVVRD------------LGLDEEGRYAQS-----
A0A3D3XF90      -------DQEYLQTQYKNLLSRSLIESVVRD------------LGLDEEGRYAQS-----
A0A2D7B522      -------DQEYLQTQYKNLLSRSLIESVVRD------------LGLDEEGRYAQS-----
A0A356NIC2      -------DQEYLQTQYKNLLSRSLIESVVRD------------LGLDEEGRYAQS-----
R7DZW0          -------GATNLDNEIFLLSSHSLLKTVVRN------------LKLDVT--YWKK-----
A0A2N8HID1      -------GATNLDNEIFLLSSHSLLKTVVRN------------LKLDVT--YWKK-----
A0A2N8HS06      -------GATNLDNEIFLLSSHSLLKTVVRN------------LKLDVT--YWKK-----
A0A3R8IT45      -------STEDINTMVKVFESSIIIQKVSER------------ITGEELKKFMEP-----
A0A1H1MGC9      -------SAEDLNTQVKVLESFAIVQRVADR------------LTGEDLKAFLAP-----
A0A2A2PYE8      -------SAEDLNTQIKVIESVTMIQRVAER------------ITGDDLRAFLAP-----
A0A2T6CN73      -------STEDLNTQVKVIESEAIIESVASR------------ITGQELREFLAP-----
A0A2N8HDG3      -------GAANLANESFILRSSTVMRSTVED------------LALNIS--YWKQ-----
A0A2U8DZK4      -------DPYFVQDQLRTIKSPKIINPVIER------------LKLNEK---LAA-----
A0A1D8AWD4      -------DPYFIQDQFRIIQAEKILYPVIES------------LGLNEI---LGK-----
A0A2T6DFL8      -------DPVFLQDQFKIMQSEKILYPVIER------------LDLNRK---IAA-----
A0A178IH18      -------DPYFLQDQFKVIQSPKILNPVIEN------------LGLNRR---IAA-----
A0A2T6DT99      -------DPYFLQDQFKIMQSAKILYPVIER------------LQLNEK---LAA-----
A0A1G3ZT33      -------DPYFLQDQFKTIQSDIILKPVIEI------------LNLNAV---LGK-----
A0A3E1E2T2      -------DPYFLQDQFKILQSEKILYPVIKN------------LKLSTV---LAP-----
B1ZMW1          -------DPYFLQDQFKIMQSEKILYPVIEN------------LGLNTR---LAP-----
A0A3D1TI55      -------DPYFYLTQFELIRSRPVLTGVIRD------------MNLQEV---WGR-----
A0A2G4G428      -------SADDFYTAVESMRSSTIIEAVSRQ------------LTTAEKKEVLAP-----
A0A3E1ET42      ISNRSAYSGNWLETEFKTVTAHETLSLVIKK------------LNLDQT---W-G-----
A0A2A2YDW8      NNSQIQMTPQFFATQFEIIRSQMTLRRVVDK------------LRLTNR---WNV-----
A0A352XLN9      NNSQIQMTPQFFATQFEIIRSQMTLRRVVDK------------LRLTNR---WNV-----
A0A3D0YP62      -------TRQFMNTQFEIIVAPETLGRAIDK------------IQLETS---W-G-----
A0A3D3DV47      -------TRQFMNTQFEIIVAPETLGRAIDK------------IQLETS---W-G-----
A0A2A2QX62      PRGQYEMTSTFFPTEFEVIKAQKTLDSAIEN------------LDLVNR---WNS-----
A0A3N5WCF1      M------SPQFFGTEFEKIKSRNSLAKVVDN------------LQLVNR---WN------
A0A2E5XJ49      P------SHAYIYNQFKIIESEKTLARVVER------------LDLTTR---WSG-----
A0A2E6SBY8      P------SHSYIQNQFKIIESEKTLARVVER------------LDLXTR---WSG-----
A0A2E5QMS4      P------SHAYIQNQFKIIESEKTMLRVVER------------LDLTTR---WRG-----
A0A2E7YXQ3      P------SHAYIQNQFKIIESEKTMLRVVER------------LDLTTR---WRG-----
A0A2E3H787      P------SQAYIQNQFKVIESEKTLLRVVER------------LDLTTR---WRG-----
A0A2E7AGN1      P------SHAYIQNQFKIIESEKTLSRVVET------------LDLTTR---WSG-----
A0A2E7AKY7      P------SHAYIQNQFKIIESEKTLSRVVET------------LDLTTR---WSG-----
A0A3D4CU34      P------SHAYIQNQFKIIESEKTLSRVVET------------LDLTTR---WSG-----
A0A2E8M146      P------SHAYIQNQFKIIESETVLNRVVES------------LDLTTR---WNG-----
A0A355S8S2      P------SHAYIQNQFKIIESETVLNRVVES------------LDLTTR---WNG-----
A0A2D6DVN8      P------SHAYIQNQFKIIESEKTLLRVVEQ------------LDLPTR---WNG-----
A0A3C1W2R2      P------SHAYIQNQFKIIESEKTLLRVVEQ------------LDLPTR---WNG-----
A0A2E3NAY6      P------SHAYIQNQFKIIESERTMSRVVER------------LDLTTX---WNN-----
A0A2E3II01      P------SHAYIQNQFKIIESERTMSRVVER------------LDLPTR---WNG-----
A0A368B8C5      P------SHAYIQNQFKIIESERTMGRVVER------------LDLTTR---WNN-----
A0A3R7RBB5      P------SHAYIQNQFKIXESERTMGRVVER------------LDLTTR---WNN-----
B4DB23          -------DPQFVATQFQILQKTEILYPVIER------------LDLIKE-----------
A0A139TUL1      -------GEANLANESYVVQSSEVMGRVVKG------------LELGVS--YWEK-----
A0A2N8HCB0      -------GEANLANESYVVKSSEVMGRVVKG------------LGLDVS--YWEK-----
A0A2N8HP04      -------GEANLANESYVVKSSEVMGRVVKG------------LGLDVS--YWEK-----
A0A2N8HRJ0      -------GEANLANESYVVKSSEVMSRVVKG------------LGLDVS--YWEK-----
A0A366HAG0      -------TDSFLKTQFEIITKRRTLDRVVDK------------LDLLEK---WNL-----
A0A3M1I8A3      -------DPEYLQTQYKNLLSRSLLERVVKA------------ERLEQDPRYSKE-----
A0A0R2XQ77      -------SSEDLNTQISVLNSGAIVQGVERR------------LQDDERERFMAP-----
A0A2E9IN28      -------GAEDLNTQISVMESATIIKGVEQR------------LQDEMRERFMAP-----
D5ENH7          -------TAEDLNTQISLLNSSKIIQQVERR------------MSEEQRKKFMQP-----
A0A351WE84      -------NPFFLRTQERILKSTPLLYAVIDN------------LNLQAV---WGQ-----
A0A146GCJ0      -------STDFLKTVVEALKSRKLLARVVKA------------EGLDKD-----------
A0A2T6D6H8      -------TTDFVNTVVQALTSRKLMLRVVKA------------TGLDHN-----------
A0A1V5QDZ6      -------NPFFLRTQYEVIQSRKVLYQVVEN------------LDLQKV---WGE-----
A0A3D4HF88      -------TSEDLNTQIKILESLAIVNSVADR------------IKGAERKMLMEP-----
A0A351MR11      -------SADDFNTAIEVMKSSGIIEAVERR------------LTTSERKAVLEP-----
A0A1V6J089      -------NPFFLMTQEKILKSKPVLTTVIRN------------LNLQKV---WGA-----
A0A3C1BZR1      -------NPFFLMTQEKIMKSRPVLTAVIRN------------LNLQKV---WGM-----
A0A1H6KPB7      -------SENYIPTQFEILVSDMNLMAVSKK------------LNLAQQ---WQT-----
A0A2E9ISN4      -------QERSLSRQMLLLNSNRLHQQVR--------------ANLAEE---WKK-----
B9XAX1          -------TGEMLNTIVQNVKNTKVLGRVVRN------------IGLATNSFFLPG-----
I0JYY7          -------FENFFKTQVEILKSRSLAQRVVER------------LDLDEHPDWLGLKKESF
A0A3E1EJT7      -------SEPDFNTQIKVLESLTILQNVANR------------LTPDEL---RLL-----
A0A317ZP96      MEQNQIRSAEDLNTQISLLESGTIIQGVEQR------LQ----DDMRKR---FMA-----
A0A2D5WGA5      -------DPYFIQTEFEKIQSQKVLDKVVEK------------CELEDK---WKP-----
A0A2E7SSH2      -------DPYFISTEFEKIQSQVVLDEVVKK------------CDLKKR---WKE-----
A0A349GXM8      -------QWTSLHTHTYMLNNEKLHERVMNK--------------LAEA---WAD-----
B3DZK9          -------WETFFKTQCEIIKSRSLAQRVVER------------LELDEHLDWLGL-----
A0A2A2XV69      -------DPRFITTQFEIIQRKEILYPVIEA------------LGLEQT---WKK-----
A0A3C1VB86      -------SQETLNTVAQKLSNLALLTQVLEE------------NHLLPP---EGT-----
A0A146G2Q9      -------DPRFLATQFEIIQRKEILYPVIDA------------LGLDRK---WGM-----
A0A2T6D3Y2      -------DPRFLATQFEIIQRKEILYPVIDA------------LGLDRK---WGM-----
A0A2V2SDV4      -------DPYYINTEFELIQSEVILQPVITK------------LDLNKV---WGA-----
A0A2V5PK75      -------DPYFIQTEFETIQSERVLGKVIDK------------LELNDD---WGK-----
A0A1V6DME1      -------DPYFIQTEFEVIQSERILSNVVHQ------------LNLSVE---WGK-----
A0A3D3DIJ3      -------DPFFIQTEFELIQSELILGKVVAD------------LDLNTE---WGR-----
A0A2D5VY59      -------DPYWVLTEFEKIQSKVVLHPVIDA------------LELRNR---WMK-----
A0A2D8UZZ4      -------DPYWVLTEFEKIQSKVVLHPVIDA------------LELRNR---WMK-----
A0A353DV86      -------DPYWVLTEFEKIQSKVVLHPVIDA------------LELRNR---WMK-----
A0A2E5EPT8      -------DPFFILTQFERLQSAEVLYPVIEK------------MNLGRV---WGA-----
A0A350EWA4      -------DPYFLQTEFEKIQSKTVLYQVITN------------LNLADF---YRD-----
A0A2N8HD92      -------TANYIPMQYSVLTSTEVLKIVSKK------------LNLAAE---WGM-----
A0A2N8HIT2      -------TANYIPMQYSVLTSTEVLKVVSRK------------LNLAAE---WGM-----
A0A354EBD3      -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
A0A355VEB2      -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
A0A2N8IMT3      -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
R6K1U5          -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
A0A2N8IWC2      -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
A0A2N8I441      -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
A0A1Q6UTU9      -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
A0A2N8I3A6      -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
A0A410SCC4      -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
A0A3R5VEW0      -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
A0A411SSG2      -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
B2UKW3          -------TANYIPMQYSVLTSAEVLKVVSRK------------LNLAAE---WGM-----
A0A1M6RLZ4      LM-----TRQFFATQFQLIESEENLKRAAIR------------CQLPER---WNL-----
A0A354T7G8      AF-----TQEYIKTQFETITKPSTLYPVIQS------------LDLAKR---WEL-----
A0A2S7U4L6      LM-----TRQFFGTEFKKIESDENLKR--------AAEL----VQLPQK---MQI-----
A0A2E8MEZ0      MTPGSTMTARYMENEFETITAPETLAEAAEN------------IDLPRR---WGL-----
A0A2E3EC33      LP-----YMTFMQTQFEIIQSRETLKEVINNGKDSLGQP----LDLXAK---WGL-----
A0A2E4GN01      LP-----YMTXMQTQFEIIQSRETFKEVINNGKDSLGRP----LXLMEE---WGV-----
A0A1Z8XU55      LP-----YMTFMQTQFEIIQSRETLKQVISKGKDSAGNP----LDLKKA---WGV-----
A0A2E1RQR9      LP-----YMTFMQTQFEIIQSRETLKQVISKGKDSAGNP----LDLKKA---WGV-----
A0A2E3ISQ4      LP-----YMTFMQTQFEIIQSRETLKEVIKNGENSAGNL----LDLKKS---WGV-----
A0A2D6W6F4      LP-----YMTFMQTQFEIIQSRETLKEVIKNGVDSAGNL----LDLKKS---WGV-----
A0A2D8Z5A8      LP-----YMTFMQTQFEIIQSRETLKEVIKNGVDSAGNL----LDLKKS---WGV-----
                                                                            

A0A2A2XVF1      -----------------------------------------------------GAKPTEI
A0A2V5UHJ2      ------------------KTNDAAKEGLVAGFWKELKNWAKGFMPATPTPSTPDPIPLST
A0A2V5PST3      --------------------------------------------------SITSDNPIKR
A0A2V5PXM3      --------------------------------------------------DDGAPRPTRE
A0A139SU05      -------------------------------------------------YLKSQAPGEPL
A0A1D8AZK8      -------------------------------------------------YLKDLAPGANP
A0A1Q6UXG8      ------------------------------------------------KDFREIDLYKTS
A0A2N8I9W1      ------------------------------------------------KDFREIDLYKTS
A0A3R5SIG7      ------------------------------------------------KDFREIDLYKTS
A0A2N8IBZ6      ------------------------------------------------KDFREIDLYKTS
A0A2N8IJW9      ------------------------------------------------KDFREIDLYKTS
R6J100          ------------------------------------------------KDFREIDLYKTS
A0A139TV24      ------------------------------------------------RDLRQIDLYRES
A0A2N8HT11      ------------------------------------------------QDLRQIDLYKDS
R7DS70          ------------------------------------------------QDLRQIDLYKDS
A0A2N8HNL6      ------------------------------------------------QDLRQIDLYKDS
A0A1V5QB01      ----------------------------------------------------------PA
A0A139SPN4      --------------------------------------------------YLKSQPPGEP
A0A1V6E7N1      --------------------------------------------------FLTKLSPGAT
A0A2T6CWI7      --------------------------------------------------ALKRLPPGSP
A0A2D9MYT1      TNVIERLHQISKAGFFGLTGYAGGDAPALSREENRPLATGLFAFPPKPKDGEEPEDLTYE
A0A258ANJ7      --------------------------------------------------HPADSKEARD
A0A139TLN4      ------SGFRKEEIY-----------------------------------D-------RS
A0A1G3ZFT0      RWSRILSRSQPEAEM-----------------------------------TLFTFPPEDN
A0A1Z8ZMT6      ------FTAKKAEEK-----------------------------------KVFAEAPAPE
A0A2E8MCT7      ------FTAKEPVKK-----------------------------------KVFADAPEPE
A0A290QGD9      --------------------------------------------------YLKGGSGDPL
A0A1D8AS58      --------------------------------------------------FKSPGAEVPI
I6AQC1          --------------------------------------------------YEKGRFGDPL
W0ITH7          --------------------------------------------------YEKGRFGDPL
A0A290Q2Z2      --------------S-----------------------------------IGAYAPLATD
A0A2A2RGK2      --------------V-----------------------------------GISAKDATND
A0A2A2XXF7      --------------A-----------------------------------GISARDASPD
A0A2A2R5D6      --------------R-----------------------------------LFGGSNLPMD
A0A1J4XH17      --------------------------------------------------PYSVSNKSKE
A0A3C1VJ32      ------------K-------------------------------------YNNGETLKTT
A0A2N9NTX7      ------------K-------------------------------------LEGGAPLKKQ
B9XK55          ------------Q-------------------------------------YNNGQKLKTS
A0A2E6T482      ------------N--------------------------------------EKG--LDLI
A0A3C0DQZ7      ------------N--------------------------------------EKG--LDLI
A0A1Z9CBK5      ------------H--------------------------------------YGGEELDEV
A0A2D6ZI96      ------------H--------------------------------------YGGEELDEV
A0A358KGZ3      ------------H--------------------------------------YGGKQLTDV
A0A2E9ZQX4      ------------H--------------------------------------YGGKQLTDV
A0A3D5JZU0      ------------H--------------------------------------YGGKQLTDV
A0A2E6HCR0      ------------D--------------------------------------NGGEPLTEL
A0A1Z8WN04      ------------D--------------------------------------NGGESLSEL
A0A2D7L1N4      ------------D--------------------------------------NGGESLSEL
A0A2E2R937      ------------D--------------------------------------NGGESLSEL
A0A2D5MR66      ------------D--------------------------------------NGGEALTEL
A0A2E0PDQ1      ------------D--------------------------------------NGGELLTEL
A0A2E2ZZP9      ------------D--------------------------------------NGGELLTEL
A0A2A2RGF2      ------------K-------------------------------------YRLGQ--SKV
A0A2G4I5Y6      ------------K-------------------------------------YRLGQ--SKL
A0A3M1I883      ------------RLG-----------------------------------LRDGELLNEQ
A0A1V6JZ45      ------------R-------------------------------------LKN--AVSEP
A0A356NPK0      ------------R-------------------------------------FKTDTPLTTN
A0A2D7B5P5      ------------R-------------------------------------FKTDTPLTTN
A0A3D3XGB5      ------------R-------------------------------------FKTDTPLTTN
A0A2V6F8A1      ------------R-------------------------------------YNNGVALSKA
A0A2V5TNH4      ------------R-------------------------------------YNNNIPLKTP
A0A2V5X5Q6      ------------R-------------------------------------YNNNIPLKTP
A0A139TS01      ---------------------------------------------------------TDD
A0A2V5URB2      ATAWLNSLSSQPVTA-----------------------------------NAPDVYGINS
A0A2V2DJ66      -------YKDMFTFG-----------------------------------P-------RK
R7L5A9          -------YHNMFTFG-----------------------------------I-------RK
A0A2V6JLK8      ---------D-GRPP-----------------------------------S-------RE
A0A2W5Z1A5      ---------HSAGPL-----------------------------------S-------RE
A0A2V6EA09      ---------DLGRP------------------------------------S-------RE
A0A2V6GQI7      ---------DLGRP------------------------------------S-------RE
A0A2A2XXW5      ----------------------------------------------------------SV
A0A3R5R2M8      ------QDFREIDLY-----------------------------------R-------NS
A0A411SUQ6      ------KDFRELDLY-----------------------------------H-------AT
A0A2N8HZF2      ------KDFREIDLY-----------------------------------K-------TS
A0A354E720      ------KDFRELDLY-----------------------------------H-------AS
B2UPB6          ------KDFRELDLY-----------------------------------H-------AT
A0A3C1HEJ2      ---------EIQGIL-----------------------------------S-------RA
A0A1V6JU76      -----------------------------------------------------------P
A0A1Q6UHJ9      -------FNDMFTLG-----------------------------------P-------RK
A0A2V2BXR0      -------FNDMLTLG-----------------------------------P-------RK
A0A2D8V0G3      -----------------------------------------------------------E
A0A348S017      -----------------------------------------------------------Q
A0A3C1UUV7      -----------------------------------------------------------Q
A0A350I3V2      -----------------------------------------------------------Q
A0A3D3XF90      -----------------------------------------------------------L
A0A2D7B522      -----------------------------------------------------------L
A0A356NIC2      -----------------------------------------------------------L
R7DZW0          ------NGFRKVEIY-----------------------------------Q-------DS
A0A2N8HID1      ------NGFRKVEIY-----------------------------------Q-------DS
A0A2N8HS06      ------NGFRKVEIY-----------------------------------Q-------DS
A0A3R8IT45      --------YEKGRFG-----------------------------------D-------PL
A0A1H1MGC9      --------YQKSAAS-----------------------------------S-------PP
A0A2A2PYE8      --------YER-AGT-----------------------------------D-------IT
A0A2T6CN73      --------YDT-GAP-----------------------------------E-------KP
A0A2N8HDG3      ------QDLRQIDLY-----------------------------------R-------DS
A0A2U8DZK4      ------VLEIPGPLP-----------------------------------V-------DF
A0A1D8AWD4      ------QLNDGVALP-----------------------------------S-------AI
A0A2T6DFL8      ------LKDSPAAFP-----------------------------------S-------AV
A0A178IH18      ------LLGASAPYP-----------------------------------T-------DV
A0A2T6DT99      ------SQGSSVPLP-----------------------------------T-------DV
A0A1G3ZT33      ------MLNNGEPLP-----------------------------------T-------SI
A0A3E1E2T2      ------ALDSPEPLP-----------------------------------D-------AI
B1ZMW1          ------LLGATGPLP-----------------------------------S-------AM
A0A3D1TI55      ------QFNDNQEEM-----------------------------------D-------LE
A0A2G4G428      -------YQSGNIFS-----------------------------------G-------PL
A0A3E1ET42      --------------L-----------------------------------T-------FD
A0A2A2YDW8      --------------T-----------------------------------E-------ED
A0A352XLN9      --------------T-----------------------------------E-------ED
A0A3D0YP62      --------------Q-----------------------------------D-------RK
A0A3D3DV47      --------------Q-----------------------------------D-------RK
A0A2A2QX62      --------------------------------------------------D-------RE
A0A3N5WCF1      --------------V-----------------------------------D-------KE
A0A2E5XJ49      --------------Y-----------------------------------D-------RD
A0A2E6SBY8      --------------Y-----------------------------------D-------RD
A0A2E5QMS4      --------------Y-----------------------------------D-------RD
A0A2E7YXQ3      --------------Y-----------------------------------D-------RD
A0A2E3H787      --------------F-----------------------------------D-------RD
A0A2E7AGN1      --------------F-----------------------------------D-------ED
A0A2E7AKY7      --------------F-----------------------------------D-------ED
A0A3D4CU34      --------------F-----------------------------------D-------ED
A0A2E8M146      --------------F-----------------------------------D-------QN
A0A355S8S2      --------------F-----------------------------------D-------QN
A0A2D6DVN8      --------------F-----------------------------------D-------RN
A0A3C1W2R2      --------------F-----------------------------------D-------RN
A0A2E3NAY6      --------------F-----------------------------------D-------RN
A0A2E3II01      --------------F-----------------------------------D-------RN
A0A368B8C5      --------------F-----------------------------------D-------RN
A0A3R7RBB5      --------------F-----------------------------------D-------RN
B4DB23          -------FSPPGQRL-----------------------------------P-------LQ
A0A139TUL1      ------RNIRKVELY-----------------------------------H-------TT
A0A2N8HCB0      ------RNIRKVDLY-----------------------------------H-------TT
A0A2N8HP04      ------RNIREVDLY-----------------------------------H-------TT
A0A2N8HRJ0      ------RNIREVDLY-----------------------------------H-------TT
A0A366HAG0      --------------K-----------------------------------S-------KQ
A0A3M1I8A3      -----------------------------------------------------------M
A0A0R2XQ77      -------YADVLSFT-----------------------------------G-------PL
A0A2E9IN28      -------YTDALSLS-----------------------------------G-------PL
D5ENH7          -------YEGAFSFS-----------------------------------G-------PL
A0A351WE84      ------QYNDDKSPI-----------------------------------T-------KE
A0A146GCJ0      --PDFAPPRKDGSPY-----------------------------------S-------EI
A0A2T6D6H8      --PEFAPPRSNGGKY-----------------------------------T-------DI
A0A1V5QDZ6      ------EVNDDGSPL-----------------------------------P-------LE
A0A3D4HF88      -----------YKGD-----------------------------------E-------EV
A0A351MR11      -------YQSGNIFS-----------------------------------G-------PL
A0A1V6J089      ------QLNEDKSAI-----------------------------------T-------PE
A0A3C1BZR1      ------EFNEDKSPV-----------------------------------A-------PE
A0A1H6KPB7      --------------------------------------------------D-------DA
A0A2E9ISN4      --------------------------------------------------K-------LT
B9XAX1          ----------NTNVL-----------------------------------S-------EA
I0JYY7          RKHSINPSEGIEPTS-----------------------------------E-------IN
A0A3E1EJT7      ------LEPYKSHAG-----------------------------------E-------PP
A0A317ZP96      ------PYTDALSLR-----------------------------------G-------PL
A0A2D5WGA5      ------ANG---DPL-----------------------------------S-------DV
A0A2E7SSH2      ------LYK---WDL-----------------------------------N-------DQ
A0A349GXM8      ------RLG---------------------------------------------------
B3DZK9          ------KPKKNGPLP-----------------------------------S-------SE
A0A2A2XV69      ------LYG----IA-----------------------------------G-------KE
A0A3C1VB86      ------VVTNGSKTV-----------------------------------T-------RE
A0A146G2Q9      ------PSR--------------------------------------------------E
A0A2T6D3Y2      ------PSR--------------------------------------------------E
A0A2V2SDV4      ------KYGPNGAPL-----------------------------------Q-------ST
A0A2V5PK75      ------KYH-GGVKL-----------------------------------K-------TP
A0A1V6DME1      ------KYA-GGERL-----------------------------------K-------TQ
A0A3D3DIJ3      ------KYA-SGERL-----------------------------------R-------TP
A0A2D5VY59      ------RYN-LKQPL-----------------------------------T-------LN
A0A2D8UZZ4      ------RYN-LKQPL-----------------------------------T-------LN
A0A353DV86      ------RYN-LKQPL-----------------------------------T-------LN
A0A2E5EPT8      ------RYG--IGEF-----------------------------------T-------PQ
A0A350EWA4      ------ARK-LEVNL-----------------------------------K-------PE
A0A2N8HD92      -------TD--------------------------------------------------E
A0A2N8HIT2      -------TD--------------------------------------------------E
A0A354EBD3      -------TD--------------------------------------------------E
A0A355VEB2      -------TD--------------------------------------------------E
A0A2N8IMT3      -------TD--------------------------------------------------E
R6K1U5          -------TD--------------------------------------------------E
A0A2N8IWC2      -------TD--------------------------------------------------E
A0A2N8I441      -------TD--------------------------------------------------E
A0A1Q6UTU9      -------TD--------------------------------------------------E
A0A2N8I3A6      -------TD--------------------------------------------------E
A0A410SCC4      -------TD--------------------------------------------------E
A0A3R5VEW0      -------TD--------------------------------------------------E
A0A411SSG2      -------TD--------------------------------------------------E
B2UKW3          -------TD--------------------------------------------------E
A0A1M6RLZ4      ------PMQ---------------------------------------------------
A0A354T7G8      ------PSR--------------------------------------------------Q
A0A2S7U4L6      ------STD---------------------------------------------------
A0A2E8MEZ0      ------DMD---------------------------------------------------
A0A2E3EC33      ------TSE--------------------------------------------------E
A0A2E4GN01      ------SSE--------------------------------------------------D
A0A1Z8XU55      ------NSD--------------------------------------------------E
A0A2E1RQR9      ------NSD--------------------------------------------------E
A0A2E3ISQ4      ------PTN--------------------------------------------------E
A0A2D6W6F4      ------PSD--------------------------------------------------E
A0A2D8Z5A8      ------PSD--------------------------------------------------E
                                                                            

A0A2A2XVF1      QLADKLRG-KVRAVLR--------------------------------------------
A0A2V5UHJ2      RLAGSYLL-MLEVRPV--------------------------------------------
A0A2V5PST3      VRSWILGTLNSLISPV---------------------------AKFFRESRQESAESDTP
A0A2V5PXM3      KLVTRLSK-MVDAKLR--------------------------------------------
A0A139SU05      PPLAAMLG-LLSIDPV--------------------------------------------
A0A1D8AZK8      PPVGGLLG-SMAPQSV--------------------------------------------
A0A1Q6UXG8      PLLVHFER-IDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVISIH
A0A2N8I9W1      PLLVHFER-IDKQRACTLHITPLDEKRFMLSHYNNQGESVQLEGFYGKPLTLPFAVISIH
A0A3R5SIG7      PLLVHFER-IDKQRACTLHITPLDEKRFMLSHYNNQGESVQLEGFYGKPLTLPFAVISIH
A0A2N8IBZ6      PLLVHFER-IDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVISIH
A0A2N8IJW9      PLLVHFER-IDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVISIH
R6J100          PLLVHFER-IDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVISIH
A0A139TV24      PVEVIFEN-IPSDRSCSFDITLKGDSALSLTYQGSDGKPVQLEEELKKPVHLPFATITVY
A0A2N8HT11      PITVTFDD-IAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLPFATVTVY
R7DS70          PITVTFDD-IAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLPFATVTVY
A0A2N8HNL6      PITVTFDD-IAENRFCTFDVTLEPENAVTLTYHDAAGNPIQEKGKLHAPISLPFATVTVY
A0A1V5QB01      EEVSRTIT-RISVAPV--------------------------------------------
A0A139SPN4      LPPLAAMLGLLSIDPV--------------------------------------------
A0A1V6E7N1      PPSAGAALGSMVPSPV--------------------------------------------
A0A2T6CWI7      PTNVGIPMGELSVFPI--------------------------------------------
A0A2D9MYT1      EQLKRLSD-AVSVSPI--------------------------------------------
A0A258ANJ7      NAIFMVSS-MIRISLR--------------------------------------------
A0A139TLN4      PIAVHFSE-RGNPAEAGFRVIPVSDTEFRLESGVNDSRPERETGVFGREIEFCSHTFTVE
A0A1G3ZFT0      RPYYLVSEKGNKISLFDSNHQRILEGKIGERLANQDKSIQLQINQISARAGTKFTLMQYP
A0A1Z8ZMT6      QLAGIISG-WTSSEVR--------------------------------------------
A0A2E8MCT7      QLSGMISG-WTSSEVR--------------------------------------------
A0A290QGD9      TPAEVLFK-NRRVIPR--------------------------------------------
A0A1D8AS58      TAAEVVYL-NRKIVPV--------------------------------------------
I6AQC1          TPLEVLGE-NRSIVPF--------------------------------------------
W0ITH7          TPLEVLGQ-NRSIIPF--------------------------------------------
A0A290Q2Z2      ETYNYLLKKMLRVESP--------------------------------------------
A0A2A2RGK2      RTAGALSG-MVGVIYR--------------------------------------------
A0A2A2XXF7      RVAAALSS-MSASVYR--------------------------------------------
A0A2A2R5D6      KAFVLLNN-RVDVNVQ--------------------------------------------
A0A1J4XH17      AIAEILFH-NRKIVPE--------------------------------------------
A0A3C1VJ32      ETMEILKQ-RMGLVPV--------------------------------------------
A0A2N9NTX7      QTIDKLKR-MMDPRQV--------------------------------------------
B9XK55          QSRAQLKR-MMELHPD--------------------------------------------
A0A2E6T482      KAREILKK-TIDVRQY--------------------------------------------
A0A3C0DQZ7      KAREILKK-TIDVRQY--------------------------------------------
A0A1Z9CBK5      RARKHLEK-VIDVSQY--------------------------------------------
A0A2D6ZI96      RARKHLEK-VIDVSQY--------------------------------------------
A0A358KGZ3      EARKHLEK-VIDVSQY--------------------------------------------
A0A2E9ZQX4      EARKHLEK-VIDVSQY--------------------------------------------
A0A3D5JZU0      EARKHLEK-VIDVSQY--------------------------------------------
A0A2E6HCR0      VARKRLEK-VIDVSQY--------------------------------------------
A0A1Z8WN04      RARKLLEK-VIDVSQY--------------------------------------------
A0A2D7L1N4      RARKLLEK-VIDVSQY--------------------------------------------
A0A2E2R937      RARKLLEK-VIDVSQY--------------------------------------------
A0A2D5MR66      RARKRLEK-IIDVSQY--------------------------------------------
A0A2E0PDQ1      RARKRLEK-VIDVSQY--------------------------------------------
A0A2E2ZZP9      RARKRLEK-VIDVSQY--------------------------------------------
A0A2A2RGF2      KAYEVLTK-LIDPRQV--------------------------------------------
A0A2G4I5Y6      KAYQVLTK-LIDPRQV--------------------------------------------
A0A3M1I883      EAYQYLLR-NMEVKQS--------------------------------------------
A0A1V6JZ45      EAYLLLRR-NLDVRQS--------------------------------------------
A0A356NPK0      ETFQVLKN-SIDVDQY--------------------------------------------
A0A2D7B5P5      ETFQVLKN-SIDVDQY--------------------------------------------
A0A3D3XGB5      ETFQVLKN-SIDVDQY--------------------------------------------
A0A2V6F8A1      ETFDVLKG-KIDVRQT--------------------------------------------
A0A2V5TNH4      ETFDILQG-KIDVRQT--------------------------------------------
A0A2V5X5Q6      ETFDILHG-KIDVRET--------------------------------------------
A0A139TS01      LAATNLAG-MIKVSPL--------------------------------------------
A0A2V5URB2      QLIDAYQG-MVEIEPL--------------------------------------------
A0A2V2DJ66      TEEEILQM-NRRVIPE--------------------------------------------
R7L5A9          SEEELLMD-NRSIIPQ--------------------------------------------
A0A2V6JLK8      IAYQMLRN-RLDVDEV--------------------------------------------
A0A2W5Z1A5      QTYAILRG-KLEVDEV--------------------------------------------
A0A2V6EA09      QTYKLLLS-RLDVEEV--------------------------------------------
A0A2V6GQI7      QTYKLLLR-RLDVEEV--------------------------------------------
A0A2A2XXW5      DKVTAVTK-DIKIVPI--------------------------------------------
A0A3R5R2M8      PILAVFEE-IGSNRSCRISVTPVGEQSFILAYSNSREEPAFLKGEYGQPISLPFATVSIH
A0A411SUQ6      PLLVHFEQ-IDKQRACTLHITPLDEKRFTLGHPNDQGELILLEGFYGKPLTLPFATISVH
A0A2N8HZF2      PLLVHFER-IDKQRACTLQITPLDEKRFMLSHSNNQGESVQLEGFYGKPLTLPFAVISIH
A0A354E720      PLLVNFEQ-IDKQRACTLHITPLDEKRFTLGHPNNQGELILLEGFYGKPLTLPFATVSVH
B2UPB6          PLLVHFEQ-IDKQRACTLNITPLDEKRFMLGHPNDQGELILLEGFYGKPLTLPFATISVH
A0A3C1HEJ2      KLVARVSD-LIAPRLR--------------------------------------------
A0A1V6JU76      DVARALAE-DIRINPI--------------------------------------------
A0A1Q6UHJ9      TEEELLAE-NRTIAPE--------------------------------------------
A0A2V2BXR0      TEEELLAE-NRTIAPE--------------------------------------------
A0A2D8V0G3      NIVNAVRD-CITISPI--------------------------------------------
A0A348S017      NVINAVRN-DISISPV--------------------------------------------
A0A3C1UUV7      NVINAVRN-DITISPV--------------------------------------------
A0A350I3V2      NVINAVRN-DITISPV--------------------------------------------
A0A3D3XF90      DVINAVRN-DITISPV--------------------------------------------
A0A2D7B522      DVINAVRN-DITISPV--------------------------------------------
A0A356NIC2      DVINAVRN-DITISPV--------------------------------------------
R7DZW0          PIAVQFTQ-EGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFIVEK
A0A2N8HID1      PIAAQFTQ-EGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFIVEK
A0A2N8HS06      PIAVQFTQ-EGKTADARFLVIPVSGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFIVEK
A0A3R8IT45      TPLEVLGQ-NRKIVPL--------------------------------------------
A0A1H1MGC9      SPAEIIFR-ERKIVPV--------------------------------------------
A0A2A2PYE8      YVAEILAK-NRKIIPQ--------------------------------------------
A0A2T6CN73      SVARLLKL-NRRVIPQ--------------------------------------------
A0A2N8HDG3      PITVTFDG-IAENRFCNVDITLQEGNTLVLTYHDINGNPVQEKGTFHSPIHLPFATVTVY
A0A2U8DZK4      TYDYLIKKRIVSVESP--------------------------------------------
A0A1D8AWD4      TYRYLISK-MLRVEAP--------------------------------------------
A0A2T6DFL8      TYAILTRK-MLRVESQ--------------------------------------------
A0A178IH18      TYEYLTKK-MLRVEMP--------------------------------------------
A0A2T6DT99      TYLLLVNK-MIRIETP--------------------------------------------
A0A1G3ZT33      TAQYLLRK-MLRVESQ--------------------------------------------
A0A3E1E2T2      TYHYLLQK-MLRVESQ--------------------------------------------
B1ZMW1          TYRYLLNK-MLAVESQ--------------------------------------------
A0A3D1TI55      STISRLRS-MVETVQV--------------------------------------------
A0A2G4G428      SEQEVFSR-QRSIMPQ--------------------------------------------
A0A3E1ET42      EALTKLER-MIETETE--------------------------------------------
A0A2A2YDW8      -ALMTLTG-IVQAQNI--------------------------------------------
A0A352XLN9      -ALMTLTG-IVQAQNI--------------------------------------------
A0A3D0YP62      TVIDVLRQ-IVRTTQR--------------------------------------------
A0A3D3DV47      TVIDVLRQ-IVRTTQR--------------------------------------------
A0A2A2QX62      SVRGTLRG-IVSAQNI--------------------------------------------
A0A3N5WCF1      AALGILKG-IVGTQNI--------------------------------------------
A0A2E5XJ49      MALLKVKK-ILKTEQI--------------------------------------------
A0A2E6SBY8      MALLRVKK-ILKTEQI--------------------------------------------
A0A2E5QMS4      MALVKLKQ-ILKTEQI--------------------------------------------
A0A2E7YXQ3      MALVKLKQ-ILKTEQI--------------------------------------------
A0A2E3H787      MALLKLKS-ILKTEQI--------------------------------------------
A0A2E7AGN1      MALIKLKS-ILKTEQI--------------------------------------------
A0A2E7AKY7      MALMKLKS-ILKTEQI--------------------------------------------
A0A3D4CU34      MALIKLKS-ILKTEQI--------------------------------------------
A0A2E8M146      MALLKLKS-ILKTEQI--------------------------------------------
A0A355S8S2      MALLKLKS-ILKTEQI--------------------------------------------
A0A2D6DVN8      MAVLKLKS-ILKTEQI--------------------------------------------
A0A3C1W2R2      MAVLKLKS-ILKTEQI--------------------------------------------
A0A2E3NAY6      MALLKLKS-ILKTEQV--------------------------------------------
A0A2E3II01      MALLKLKS-ILKTEQI--------------------------------------------
A0A368B8C5      MALLKLKS-ILKTEQV--------------------------------------------
A0A3R7RBB5      MALLKLKS-ILKTEQV--------------------------------------------
B4DB23          QVYIQLRN-SMKLNEV--------------------------------------------
A0A139TUL1      PLKVEFGE-EVDFQPCSLAVTPLNGREFSLSYREKGGRETALAGKFGIPLELPFATVTVR
A0A2N8HCB0      PLKVEFSE-EAAFQPCSLAVTPLNGREFSLSCREKEGGENVLHGKFGVPLKLPSATVKVC
A0A2N8HP04      PLKAEFSE-EVAFQPCSLAVTPLNGREFSLSYRAKESGENVLHGKFGVPLKLPFATVNVC
A0A2N8HRJ0      PLKAEFSE-QVAFQPCSLAVTPLNGREFSLSYRAKESGENVLHGKFGVPLKLPFATVNVC
A0A366HAG0      AAAGKLIG-NLDAQSS--------------------------------------------
A0A3M1I8A3      DIVAALAK-DITVTPI--------------------------------------------
A0A0R2XQ77      SPAALLAQ-NRRIMPQ--------------------------------------------
A0A2E9IN28      TPLEILGR-NRSIMPK--------------------------------------------
D5ENH7          TASEILGK-YRKIMPQ--------------------------------------------
A0A351WE84      DALATLSS-SIKIEQD--------------------------------------------
A0A146GCJ0      ELVDKLAQ-KIDVQLI--------------------------------------------
A0A2T6D6H8      ELADRLAS-KVSAKLR--------------------------------------------
A0A1V5QDZ6      RAHAMLSR-SLKVEQF--------------------------------------------
A0A3D4HF88      TINEVLYE-NRDVVPL--------------------------------------------
A0A351MR11      TSQEVFGR-QRGIAAQ--------------------------------------------
A0A1V6J089      LALQILQR-SIRVEQD--------------------------------------------
A0A3C1BZR1      LALQILSR-SLRVEQD--------------------------------------------
A0A1H6KPB7      TAASILRG-MIQVMPV--------------------------------------------
A0A2E9ISN4      EPERYVEF-LVTSVPG--------------------------------------------
B9XAX1          KLVNALAG-MIVTKLR--------------------------------------------
I0JYY7          LYAEYLLK-NLQVTPV--------------------------------------------
A0A3E1EJT7      SPASIIYH-NRQIIPQ--------------------------------------------
A0A317ZP96      TPTEVLGR-NRKIIPR--------------------------------------------
A0A2D5WGA5      NARKILEK-SIDIRQY--------------------------------------------
A0A2E7SSH2      QARKQLEK-VIDVSQY--------------------------------------------
A0A349GXM8      -GRHRMNP-KIAISQV--------------------------------------------
B3DZK9          KLSEIVQN-NLHILPV--------------------------------------------
A0A2A2XV69      QTIFRLRK-MIDVREI--------------------------------------------
A0A3C1VB86      NIISQFEK-NVKTSLR--------------------------------------------
A0A146G2Q9      QAYFRLVR-MINIQEI--------------------------------------------
A0A2T6D3Y2      QAYFRLVR-MINIQEI--------------------------------------------
A0A2V2SDV4      DTMKLLQA-RMGLQPV--------------------------------------------
A0A2V5PK75      DTIVMLKG-RMDLRPV--------------------------------------------
A0A1V6DME1      ETMTLLRN-RMDLNPV--------------------------------------------
A0A3D3DIJ3      ETIALLKQ-RIDLRTV--------------------------------------------
A0A2D5VY59      EAFNVLKK-SIEVDQY--------------------------------------------
A0A2D8UZZ4      EAFNVLKK-SIEVDQY--------------------------------------------
A0A353DV86      EAFNVLKK-SIEVDQY--------------------------------------------
A0A2E5EPT8      KTKLLLEK-RIDPTQV--------------------------------------------
A0A350EWA4      EAYMLLKG-DLSVSQM--------------------------------------------
A0A2N8HD92      KAASNLAG-MIKVAPV--------------------------------------------
A0A2N8HIT2      MAASNLAG-MIKVAPV--------------------------------------------
A0A354EBD3      MAATNLFG-MIKVAPV--------------------------------------------
A0A355VEB2      MAATNLFG-MIKVAPV--------------------------------------------
A0A2N8IMT3      MAATNLFG-MIKVAPV--------------------------------------------
R6K1U5          MAATNLFG-MIKVAPV--------------------------------------------
A0A2N8IWC2      MAATNLAD-MIKVAPV--------------------------------------------
A0A2N8I441      MAATNLAD-MIKVAPV--------------------------------------------
A0A1Q6UTU9      MAATNLAD-MIKVAPV--------------------------------------------
A0A2N8I3A6      MAATNLAD-MIKVAPV--------------------------------------------
A0A410SCC4      MAATNLAD-MIKVAPV--------------------------------------------
A0A3R5VEW0      MAATNLAD-MIKVAPV--------------------------------------------
A0A411SSG2      MAATNLAG-MIKVAPV--------------------------------------------
B2UKW3          MAATNLAG-MIKVAPV--------------------------------------------
A0A1M6RLZ4      EVVSIMTK-SLNTNQE--------------------------------------------
A0A354T7G8      AALAKLRA-NLETQSM--------------------------------------------
A0A2S7U4L6      EAILVLKG-GLSARQE--------------------------------------------
A0A2E8MEZ0      SAIKTLEN-VVETIPI--------------------------------------------
A0A2E3EC33      DAFXILKK-KVETQXV--------------------------------------------
A0A2E4GN01      DAFRXLKK-KVETQDV--------------------------------------------
A0A1Z8XU55      DAYRILKX-KVETQDV--------------------------------------------
A0A2E1RQR9      DAYRILKK-KVETQDV--------------------------------------------
A0A2E3ISQ4      DAYQILKR-KVETQDV--------------------------------------------
A0A2D6W6F4      DAYRILKR-KVETQDV--------------------------------------------
A0A2D8Z5A8      DAYRILKR-KVETQDV--------------------------------------------
                                                                            

A0A2A2XVF1      ---------------------------------------RGTR-LIDIIV--EDKDPV--
A0A2V5UHJ2      ---------------------------------------VSTS-LVVIKF--TTPDPA--
A0A2V5PST3      DAAARGGNLVDRQETDKNKPVVSRGLVGHYMSFLQVNSIEKTR-LVEIAF--VTPNPA--
A0A2V5PXM3      ---------------------------------------KGTR-LIDVKV--EHTSPE--
A0A139SU05      ---------------------------------------RNSF-ILRLTV--GHQDPE--
A0A1D8AZK8      ---------------------------------------RNSF-LINISV--TNRDPE--
A0A1Q6UXG8      PTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS-LLEMSL--TASNPQ--
A0A2N8I9W1      PTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS-LLEMSL--TASNPQ--
A0A3R5SIG7      PTSLMTDTWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS-LLEMSL--TASNPQ--
A0A2N8IBZ6      PTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS-LLEMSL--TASNPQ--
A0A2N8IJW9      PTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS-LLEMSL--TASNPQ--
R6J100          PTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESS-LLEMSL--TASNPQ--
A0A139TV24      PTSHMPETIPGTTITVRRVPINAAADQLLANFTVKRPDAKESS-LLQMTL--TSSNPD--
A0A2N8HT11      PTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKESS-ILQMTL--TSTNPD--
R7DS70          PTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKESS-ILQMTL--TSTNPD--
A0A2N8HNL6      PTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKESS-ILQMTL--TSTNPD--
A0A1V5QB01      ---------------------------------------GKTA-FLAITV--ESLDPV--
A0A139SPN4      ---------------------------------------RNSF-ILRLTV--GHQDPE--
A0A1V6E7N1      ---------------------------------------RNSF-LISVSV--NHQDPE--
A0A2T6CWI7      ---------------------------------------RNTY-LIAVTV--THDDPD--
A0A2D9MYT1      ---------------------------------------RLSR-LVDVSV--ESPNRN--
A0A258ANJ7      ---------------------------------------KDTR-LIDFNV--TGADPE--
A0A139TLN4      KTPRFDSRSLDAPVIVRKTFIKNAAIALIGGLTVNKASGKTN--LINISV--RCNNPV--
A0A1G3ZFT0      INDRMVRSMARRITIDD----------------------PEKLGLLTLAY--QDTNPH--
A0A1Z8ZMT6      ---------------------------------------RGTR-LIDISV--NHTDPD--
A0A2E8MCT7      ---------------------------------------RGLR-LIDISV--NHTDPD--
A0A290QGD9      ---------------------------------------RMSL-IIEVQY--RHPDRV--
A0A1D8AS58      ---------------------------------------RLSL-VLQVQF--SHPDKL--
I6AQC1          ---------------------------------------RMSL-LVAIEY--RHPDRL--
W0ITH7          ---------------------------------------RMSL-LVAIEY--RHPDRL--
A0A290Q2Z2      ---------------------------------------RGSS-MIEVGV--YSQDAA--
A0A2A2RGK2      ---------------------------------------PQTR-LIDVSI--TSRDPN--
A0A2A2XXF7      ---------------------------------------LNTR-LIDLMI--TSADPN--
A0A2A2R5D6      ---------------------------------------RNSD-ILEIRV--KSDLPK--
A0A1J4XH17      ---------------------------------------RSSL-MIMLAY--NHPDPE--
A0A3C1VJ32      ---------------------------------------RNTK-LISITV--YSDDKK--
A0A2N9NTX7      ---------------------------------------RNTS-LVEIWV--TSFNKE--
B9XK55          ---------------------------------------RNTS-LIEIKI--YSNDKK--
A0A2E6T482      ---------------------------------------RNTS-IIELRA--YDRDKE--
A0A3C0DQZ7      ---------------------------------------RNTS-IIELRA--YDRDKE--
A0A1Z9CBK5      ---------------------------------------RNTS-IIELRA--YDRDRG--
A0A2D6ZI96      ---------------------------------------RNTS-IIELRA--YDRDRG--
A0A358KGZ3      ---------------------------------------RNTS-IIELRA--YDRDKN--
A0A2E9ZQX4      ---------------------------------------RNTS-IIELRA--YDRDKN--
A0A3D5JZU0      ---------------------------------------RNTS-IIELRA--YDRDKN--
A0A2E6HCR0      ---------------------------------------RNTS-IIELRA--YDGDED--
A0A1Z8WN04      ---------------------------------------RNTS-IIELRA--YDGDEN--
A0A2D7L1N4      ---------------------------------------RNTS-IIELRA--YDGDEN--
A0A2E2R937      ---------------------------------------RNTS-IIELRA--YDGDEN--
A0A2D5MR66      ---------------------------------------RNTS-IIELRA--YDGDEN--
A0A2E0PDQ1      ---------------------------------------RNTS-IIELRA--YDGDEN--
A0A2E2ZZP9      ---------------------------------------RNTS-IIELRA--YDGDEN--
A0A2A2RGF2      ---------------------------------------RNTS-IIEINV--YSKDKA--
A0A2G4I5Y6      ---------------------------------------RNTS-IIEINV--YSKDKE--
A0A3M1I883      ---------------------------------------RNTK-LVEITV--YSPIPE--
A0A1V6JZ45      ---------------------------------------RNTS-LIEIRA--YSENRD--
A0A356NPK0      ---------------------------------------RNTS-LIEIKA--YSKDKE--
A0A2D7B5P5      ---------------------------------------RNTS-LIEIKA--YSKDKE--
A0A3D3XGB5      ---------------------------------------RNTS-LIEIKA--YSKDKE--
A0A2V6F8A1      ---------------------------------------RNTS-LIEIRV--YSDAKDK-
A0A2V5TNH4      ---------------------------------------RNTS-LIEIRV--YSDAKEKE
A0A2V5X5Q6      ---------------------------------------RNTS-LIEIRV--YSDAKEKD
A0A139TS01      ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A2V5URB2      ---------------------------------------KRSR-LVRISI--SSADPV--
A0A2V2DJ66      ---------------------------------------RMSL-MIRVTY--THPNAE--
R7L5A9          ---------------------------------------RMSL-IVTVIF--EHPDNN--
A0A2V6JLK8      ---------------------------------------RNTD-LLQISV--YDGSPQ--
A0A2W5Z1A5      ---------------------------------------RNTN-LLQISV--FDSNPQ--
A0A2V6EA09      ---------------------------------------RNTD-LLQISV--FDANPQ--
A0A2V6GQI7      ---------------------------------------RNTD-LLQISV--FDANPQ--
A0A2A2XXW5      ---------------------------------------RLSR-LVEVQV--THPKGE--
A0A3R5R2M8      PTSVMNADWNGQTVIIRHVPSQDTARALLANFSVARPDAKDSS-LLEMTL--TASNPQ--
A0A411SUQ6      PTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKESS-LLEMTL--TSSNPQ--
A0A2N8HZF2      PTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKESS-LLEMTL--TSSNPQ--
A0A354E720      PTSLMTDAWNGKTVIVRHSPVLETANALLHGLTITRPDSKESS-LLEMTL--TSSNPQ--
B2UPB6          PTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKESS-LLEMTL--TSSNPQ--
A0A3C1HEJ2      ---------------------------------------PATR-LIDVTV--QHSDPQ--
A0A1V6JU76      ---------------------------------------RLSR-LVDVVV--EHPNAS--
A0A1Q6UHJ9      ---------------------------------------RMSL-IIRIAF--EHPDPD--
A0A2V2BXR0      ---------------------------------------RMSL-IIRIAF--EHPDPD--
A0A2D8V0G3      ---------------------------------------RLSR-LVEVSV--EHPSPL--
A0A348S017      ---------------------------------------RLSR-LVEISV--QHPSPR--
A0A3C1UUV7      ---------------------------------------RLSR-LVEISV--QHPSPR--
A0A350I3V2      ---------------------------------------RLSR-LVEISV--QHPSPR--
A0A3D3XF90      ---------------------------------------RLSR-LVEISV--QHPSPR--
A0A2D7B522      ---------------------------------------RLSR-LVEISV--QHPSPR--
A0A356NIC2      ---------------------------------------RLSR-LVEISV--QHPSPR--
R7DZW0          TSKFDESSLNVPVIVRRTSVKNAAMGLGSGLTVRKA---SGKNDLINISM--RCNNPV--
A0A2N8HID1      TPKFDESSLNVPVIVRRTSVKNAAMGLGSGLTVRKA---SGKNDLINISM--RCNNPV--
A0A2N8HS06      TPKFDESSLNVPVIVRRTSVKNAAMGLGSGLTVRKA---SGKNDLINISM--RCNNPV--
A0A3R8IT45      ---------------------------------------RLSL-IVGVEY--THPDRL--
A0A1H1MGC9      ---------------------------------------RLSL-VLQVQY--AHPDRH--
A0A2A2PYE8      ---------------------------------------RLTL-VVTVAY--QHPDRF--
A0A2T6CN73      ---------------------------------------RLTL-MVWIAY--KHPNRF--
A0A2N8HDG3      PTSNMTETVPGTTITVRRTPVNAAADQLLANFTVMRPDAKESS-ILQMTL--TSTNPV--
A0A2U8DZK4      ---------------------------------------KTSS-IVEITI--DTRDPA--
A0A1D8AWD4      ---------------------------------------RASS-IIEIDV--YARDQR--
A0A2T6DFL8      ---------------------------------------RASS-VIEINV--DAEDPQ--
A0A178IH18      ---------------------------------------RNTS-LLEVNV--FSRDAA--
A0A2T6DT99      ---------------------------------------RGSS-LIEIEV--SAQDPA--
A0A1G3ZT33      ---------------------------------------RSSS-IIEIDV--YAQEPA--
A0A3E1E2T2      ---------------------------------------RSSS-LIEISV--YSEDPT--
B1ZMW1          ---------------------------------------RSSS-LIEINV--YAQEPP--
A0A3D1TI55      ---------------------------------------RGTT-IIEVQV--TSRDSA--
A0A2G4G428      ---------------------------------------RQTL-VVNVEF--THPNRE--
A0A3E1ET42      ---------------------------------------RGTE-IMTVIV--SSVRRD--
A0A2A2YDW8      ---------------------------------------RGTD-LIEITV--LHPGAE--
A0A352XLN9      ---------------------------------------RGTD-LIEITV--LHPGAE--
A0A3D0YP62      ---------------------------------------RGTD-LIEISV--RHRKKE--
A0A3D3DV47      ---------------------------------------RGTD-LIEISV--RHRKKE--
A0A2A2QX62      ---------------------------------------RGTS-LIEIRV--RYNDPK--
A0A3N5WCF1      ---------------------------------------RGTD-LISIRV--RHTNKV--
A0A2E5XJ49      ---------------------------------------RNTD-HIEIRI--RHQKPE--
A0A2E6SBY8      ---------------------------------------RNTD-HIEIRI--RHQKPE--
A0A2E5QMS4      ---------------------------------------RNTD-HIEIRI--RHQNSE--
A0A2E7YXQ3      ---------------------------------------RNTD-HIEIRI--RHQNSE--
A0A2E3H787      ---------------------------------------RNTD-HIEIRI--RHQKQE--
A0A2E7AGN1      ---------------------------------------RNTD-HIEIRI--RHQNRE--
A0A2E7AKY7      ---------------------------------------RNTD-HIEIRI--RHQNRE--
A0A3D4CU34      ---------------------------------------RNTD-HIEIRI--RHQNRE--
A0A2E8M146      ---------------------------------------RNTD-HIEVRI--RHQNRD--
A0A355S8S2      ---------------------------------------RNTD-HIEVRI--RHQNRD--
A0A2D6DVN8      ---------------------------------------RNTD-HIEIRI--RHQNRD--
A0A3C1W2R2      ---------------------------------------RNTD-HIEIRI--RHQNRD--
A0A2E3NAY6      ---------------------------------------RNTD-HIEIRI--RHQNRD--
A0A2E3II01      ---------------------------------------RNTD-HIEIRI--RHQNRD--
A0A368B8C5      ---------------------------------------RNTD-HIEIRI--RHQNRD--
A0A3R7RBB5      ---------------------------------------RNTD-HIEIRI--RHQNRD--
B4DB23          ---------------------------------------RNTG-LIEVGA--KDTDAQ--
A0A139TUL1      TTSHFSSGSIGRPIFVERLSVKEACAQMLGRLSVTRPDSKESS-LLELTL--RLSHPQ--
A0A2N8HCB0      PTSYFSSGSMGRTIFVERVSVKEAAAGMLGRLSVTRPDSKESS-LLELTL--RLSHPQ--
A0A2N8HP04      PTSYFSSGSMGRTIFVERVSVKEATDGMLGRLSVTRPDSKESS-LLELTL--RLSHPQ--
A0A2N8HRJ0      PTSYFSSGSMGRTIFVERVSVKEATDGMLGQLSVTRPDSKESS-LLELTL--RLSHPQ--
A0A366HAG0      ---------------------------------------IKSD-FITLDY--YDEDPD--
A0A3M1I8A3      ---------------------------------------RMTR-LVEVSV--EHTDPR--
A0A0R2XQ77      ---------------------------------------RGTL-MIGVGY--NHPDPV--
A0A2E9IN28      ---------------------------------------RMSL-MIHIAY--SHPDPI--
D5ENH7          ---------------------------------------RMSL-MVSVTY--THPDSQ--
A0A351WE84      ---------------------------------------RDTS-LINISV--TQEDRE--
A0A146GCJ0      ---------------------------------------RGTR-LVQIVV--EDKNPE--
A0A2T6D6H8      ---------------------------------------RGTR-LIELTV--EDKNPE--
A0A1V5QDZ6      ---------------------------------------RDTS-LISIQV--YREDPT--
A0A3D4HF88      ---------------------------------------RASL-LIAVTY--THPDAR--
A0A351MR11      ---------------------------------------RMTM-IVNVEF--THPDRD--
A0A1V6J089      ---------------------------------------RDTM-LMNISA--TSEDPK--
A0A3C1BZR1      ---------------------------------------RDTT-LMNISA--TSEDPK--
A0A1H6KPB7      ---------------------------------------RGKD-LVDVKV--VGSDPA--
A0A2E9ISN4      ---------------------------------------SNGT-MIDCLV--DSVAAE--
B9XAX1          ---------------------------------------PETR-LVDITV--THPNAE--
I0JYY7          ---------------------------------------RNTR-LVQIKF--DSVNAQ--
A0A3E1EJT7      ---------------------------------------RLSL-MTAIEF--RHPNPK--
A0A317ZP96      ---------------------------------------RMSL-MINIAY--SHPDPI--
A0A2D5WGA5      ---------------------------------------RNTS-IIELRA--YDRDPN--
A0A2E7SSH2      ---------------------------------------RNTS-IIELRA--YDGDKQ--
A0A349GXM8      ---------------------------------------RGINPMVSVAV--QSRNKD--
B3DZK9          ---------------------------------------RGTR-LIRICY--DSPNSF--
A0A2A2XV69      ---------------------------------------RNTE-LIQISV--LDQDRN--
A0A3C1VB86      ---------------------------------------RNTR-LIDITV--RNTDPG--
A0A146G2Q9      ---------------------------------------RNTE-LIHITV--FSTDNK--
A0A2T6D3Y2      ---------------------------------------RNTE-LIHITV--YSTDNK--
A0A2V2SDV4      ---------------------------------------RNTS-LIEIRV--TTDKPE--
A0A2V5PK75      ---------------------------------------RNTK-FIEIVV--YSENKD--
A0A1V6DME1      ---------------------------------------RNTS-LITIRV--FSQDAE--
A0A3D3DIJ3      ---------------------------------------RGTS-LIEIVV--YSEKPE--
A0A2D5VY59      ---------------------------------------RNTS-LIEITA--YSQDKE--
A0A2D8UZZ4      ---------------------------------------RNTS-LIEITA--YSQDKE--
A0A353DV86      ---------------------------------------RNTS-LIEITA--YSQDKE--
A0A2E5EPT8      ---------------------------------------RNTS-IIALTV--YSEDKK--
A0A350EWA4      ---------------------------------------RNTE-LIEITV--FNENKA--
A0A2N8HD92      ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A2N8HIT2      ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A354EBD3      ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A355VEB2      ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A2N8IMT3      ---------------------------------------RATD-LVDVIV--SGPDPK--
R6K1U5          ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A2N8IWC2      ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A2N8I441      ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A1Q6UTU9      ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A2N8I3A6      ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A410SCC4      ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A3R5VEW0      ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A411SSG2      ---------------------------------------RATD-LVDVIV--SGPDPK--
B2UKW3          ---------------------------------------RATD-LVDVIV--SGPDPK--
A0A1M6RLZ4      ---------------------------------------RGTD-LVEIAF--VHSNRE--
A0A354T7G8      ---------------------------------------LRSD-FVSIDY--YDQDSQ--
A0A2S7U4L6      ---------------------------------------RGTD-LIEISLRMVKDNRQ--
A0A2E8MEZ0      ---------------------------------------RGTD-FIEITV--THANPE--
A0A2E3EC33      ---------------------------------------RGTD-LIDIEV--YDTDAQ--
A0A2E4GN01      ---------------------------------------RGTD-LIDIEV--FDTDAQ--
A0A1Z8XU55      ---------------------------------------RGTD-LIDIEI--YDTDPK--
A0A2E1RQR9      ---------------------------------------RGTD-LIDIEI--YDTDPK--
A0A2E3ISQ4      ---------------------------------------RGTD-LIEIEV--YDTDPN--
A0A2D6W6F4      ---------------------------------------RGTD-LIDIEV--YDTDPN--
A0A2D8Z5A8      ---------------------------------------RGTD-LIDIEV--YDTDPN--
                                                                            

A0A2A2XVF1      ----MARDLAASFVKEFLRENFSQRLSVSRVATDFLQEESQKLKKKLEESEIKLQRY---
A0A2V5UHJ2      ----LSARLANAHASSYVRYGIDLRSQTNSEASEFLQEKLTELKERVQQSEAALNSY---
A0A2V5PST3      ----LSQKLADAHIKAFIRMNLEGRFQLTKEARDFLDIKNAELKARLERAEAELNRF---
A0A2V5PXM3      ----MAALIANSL-------------------LNFLRNEEKRLKVKLEQSERAMQEY---
A0A139SU05      ----AAAILAQRHVDQFLSYLLENISGVNDTAVDFLRERAEQLRLESEAKAQRQQEY---
A0A1D8AZK8      ----GAALLANRYVEQFMRYLLENVGGKNEFAVDYLKTRAEELRKESEIAEGRLQDY---
A0A1Q6UXG8      ----KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEF---
A0A2N8I9W1      ----KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEF---
A0A3R5SIG7      ----KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEF---
A0A2N8IBZ6      ----KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEF---
A0A2N8IJW9      ----KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEF---
R6J100          ----KAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEF---
A0A139TV24      ----KATDTLNKLIEIYNEHSREERRAIAVKTKEFIRRQLEQIGEELKRLDSERDDI---
A0A2N8HT11      ----KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGADLKEVDQKMDDI---
R7DS70          ----KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGADLKEVDQKMDDI---
A0A2N8HNL6      ----KAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGADLKEVDQKMDDI---
A0A1V5QB01      ----LGSDMANALADEYLDFKAEERLNTSQATVVSLTQQANRVHEELKRAEERALEF---
A0A139SPN4      ----AAAILAQRHVDQFLSYLLDNISGVNDTALDFLHERAEQLRLESEAKAQKQQEY---
A0A1V6E7N1      ----AAALIANRYIDQFMQQIMDSTMGKNEYATDFLRKRSDDLRKESEAAALQVQRF---
A0A2T6CWI7      ----AAALVANRFVEVFMKRLYDTAGGRTADAVKFLREQASRLEREAQEKEQALQQY---
A0A2D9MYT1      ----EAALIANTVISKFLEQDNNRKRGKLANAVDFLREEATNLSTAVHTNYMALHNF---
A0A258ANJ7      ----QVAALSNQAVLSLVSELESQKSKTLQGAIQALVAEGQRLQDKLKKSEIAMHDY---
A0A139TLN4      ----KAENVLHNLVRFYNEASLDEKKKRGMNTDKFIEERLGVINEEMGENDLAIENL---
A0A1G3ZFT0      ----LAARVVNEIAKVTQHKNTEKKSLEASKILSFLSKQLPLAKQDLTRAELALNRY---
A0A1Z8ZMT6      ----VAQVIANQIIQQFINIREGVNEEGKKSDLQHLLTAAKERESELETARRRAGTY---
A0A2E8MCT7      ----VAQVIANQIVKQFINIREGVNEEGKKSDLQHLLAAAKERESELETARRRAGSY---
A0A290QGD9      ----LASDIANMFVDEFIAYNSRVRIDESMKAVDELRARVNDQRKKVEELATRLQTY---
A0A1D8AS58      ----MAAKVANLFIDEYIAYNSRLRIEDSMKAVDDLKERADQQKKRVEEMAIILQNY---
I6AQC1          ----IAAKVANLFLEEFVQFNTRQRVDQTFGILEDLKLRAESQRKTVEDLNRQMQAY---
W0ITH7          ----IAAKVANLFLEEFVQFNTRQRVDETFGILEDLKLRAESQKKKVEDLNRQMQAY---
A0A290Q2Z2      ----LAAAIANEIARVYSDDRIMFATSEQREGLTQLRKELESQERTVSLQRDMVEQL---
A0A2A2RGK2      ----LSVKLANAYADEYIRYVFEKRSDAAKSATQFLVEEADRLRKKLRVSEEAMQSF---
A0A2A2XXF7      ----LSVKLANAYCDEYIRYVFERRSDASKSATQFLLEEADRLRKKMRVSEEAMQSF---
A0A2A2R5D6      ----EASDIANAIMDVYIEMRRADLQTRESRGFKTLDDEIAKQGEVVQRAKDYVEEL---
A0A1J4XH17      ----IAAKVANMFAEEYINYNMTLNIDGSMKAIFDLKERAKEQQKVVENIETQMAEY---
A0A3C1VJ32      ----EAADLANSIAEAYRTYRIQTSQQQATTGLEVYQTQYLEESNRIEMLQANVDNL---
A0A2N9NTX7      ----EAAKLANEIAEAYQAHRLEERAELTTGGIKSLEERWKEQEASVGKAQSNVDYL---
B9XK55          ----EAAAIANEVAIVYQKYRLDQKLDITGAGIKVFKQQVQEQDDLIAKQEAKVDKL---
A0A2E6T482      ----LATKIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRMEEINKKITGLQGNVDRM---
A0A3C0DQZ7      ----LATKIAQSLAEEYRGHRSSLQKQRVGEGIKALNRRMEEINKKITGLQGNVDRM---
A0A1Z9CBK5      ----LAQEIAQALASEYKNYRSSLQKKRVVAGIDKLRSRMTTINEEIGAMQANVDXL---
A0A2D6ZI96      ----LAQEIAQALASEYKNYRSSLQKKRVVAGIDKLRSRMTTINEEIGAMQANVDXL---
A0A358KGZ3      ----LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERMEKTNDEITAMQANVDDL---
A0A2E9ZQX4      ----LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERMKKTNDEITAMQANVDDL---
A0A3D5JZU0      ----LAQQIAQALAKEYENYRSSLQEERVKAGIDKLRERMEKTNDEITAMQANVDDL---
A0A2E6HCR0      ----LAREIAQALAEQYKNYRSNLQKRRVEAGINKLKERMEKTDEEISVMQAKVDDL---
A0A1Z8WN04      ----LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERMEKTNNEISLMQAKVDSL---
A0A2D7L1N4      ----LAREIAQALAEEYKKYRSNLQKGRVEAGINKLKERMEKTNNEISLMQAKVDSL---
A0A2E2R937      ----LAREIAQALAEEYKKYRSNLQKXRVEAGINXLKERMEKTNNEISLMQAXVDSL---
A0A2D5MR66      ----LAREIAQALAEEYKNYRSKLQKGRVEAGIGKLKERMEKTNDEISVMQAKVDAL---
A0A2E0PDQ1      ----LAREIAQALAEEYKKYRSNLQKRRVEAGINKLKERMEKTNEEISLMQAKVDSL---
A0A2E2ZZP9      ----LAREIAQALAEEYKKYRSNLQKRRVEAGINKLKERMEKTNEEISLMQAKVDSL---
A0A2A2RGF2      ----EAAEIANKIAEIYKENREAQRKLQAEKGLKILRDRLADQDALVRTALTNVNQI---
A0A2G4I5Y6      ----EAAEIANKIAEIYKENRESQRKLQAEKGIKILRARLLDQDALVRTALTNVNQI---
A0A3M1I883      ----EAADLANLIAASYKNWRQHSRREHMTNAIAVLQQKLEEQNARVERLQKQLDQL---
A0A1V6JZ45      ----EASAIANEVANVYKESRVEEKQRQTSAGISKLRAKLDEQAEAVAKLQDNVDQL---
A0A356NPK0      ----EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLTQQNKVQTKQKDLDKL---
A0A2D7B5P5      ----EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLXQQNKVQTKQKDLDKL---
A0A3D3XGB5      ----EAALIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLTQQNKVQTKQKDLDKL---
A0A2V6F8A1      -PAQEAAEIANQIATVYRDTQLGLKQEMSQKGIEVLRKELSQNDEKIKEAEAKVDEL---
A0A2V5TNH4      KPAQEAAEIANEIANVYRDTRLELKQEMSRKGIQVLREELQQNEEKVKAAEAEVDQL---
A0A2V5X5Q6      NPAQEAAKIANEIANVYRDTRLELKQEMSRKGIKVLKQELEQNDEKVKAAEIAVDQL---
A0A139TS01      ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLQDVLREQEDIVNDKMMALKKL---
A0A2V5URB2      ----LAASVANAHAIAYVRQGLKLGSQANEEARKFLETKLAELKDRVQKSEEALNHF---
A0A2V2DJ66      ----MAARIADLFVNEYITYTRMTRVQTLLDSIEELRTKVAQQETKVKELDRRLVEY---
R7L5A9          ----MAARIANLFATEFINYTHQKRVQALMGSIDELRTKVSQQEAKVKELDKKLVEY---
A0A2V6JLK8      ----LAADIANKIVSVYQDRRVEEEKEILNRAVTAMNEEVGKQQKRVEEAGAEMAKI---
A0A2W5Z1A5      ----LAADIVNKIIAVYQDKRVEEEKDILNRAVGSMNEEVDKQQKKVDDAAVEVARI---
A0A2V6EA09      ----EAADIANKIVAVYQDKRVEEEKEIMNRGVATMNEQVAREQKAVSDAAAEVARI---
A0A2V6GQI7      ----EAADIANKIVAVYQDKRVEEEKEIMNRGVATMNEQVAREQKAVSDAAAEVARI---
A0A2A2XXW5      ----QAQRIADTILQVFLQQNLDDKKSKALQGLKILEQEATGKEVELEALQGKLQKY---
A0A3R5R2M8      ----KAEDVLNHLIEVYNQISIDEKKQSALKTRKFIEGRLAELEKSLNKADKELTDF---
A0A411SUQ6      ----KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLKELGASLSDVDKKLTEF---
A0A2N8HZF2      ----KAEDTLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEF---
A0A354E720      ----KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLQELGASLSDVDKKLTEF---
B2UPB6          ----KAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLKELGASLSDVDKKLTEF---
A0A3C1HEJ2      ----LTEQIANSLAREFLQRRFEQQISASESATSFYRQKEQELLETIKTLESLLQEF---
A0A1V6JU76      ----KAAGIANALVEEFIEQNLVQKQKRTMDMLFFLRSQANGLEVDVAKAEEDIQNY---
A0A1Q6UHJ9      ----MAATIANLFAQEYLNYTHHTRVQKILDSIDELRIKVSQQEAKVKELDKRLVEY---
A0A2V2BXR0      ----MAATIANLFAQEYLNYTHHTRVQKILDSIDELRIKVSQQEAKVKELDKRLVEY---
A0A2D8V0G3      ----QAAAIANKLMQNFLTRNLDKKKQRAFESYKWLQNEVNQLADDVRATRLSVFQF---
A0A348S017      ----VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRF---
A0A3C1UUV7      ----VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRF---
A0A350I3V2      ----VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRF---
A0A3D3XF90      ----VAAQISNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRF---
A0A2D7B522      ----VAAQMSNKLLDNFLARNLDQKRERAFQSYQWXDTEVDGLQEEVKNSRLAVFRF---
A0A356NIC2      ----VAAQMSNKLLDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRF---
R7DZW0          ----KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEEMKKNDLAIEDL---
A0A2N8HID1      ----KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEEMKKNDLAIEDL---
A0A2N8HS06      ----KAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEEMKKNDLAIEDL---
A0A3R8IT45      ----IATKVANLFLEEFITFTSRQRIDQTFTILEDLKLRAETQKKKVEELQFQMQAY---
A0A1H1MGC9      ----VAAKVANLFIDEYIAYNSRLRIEDSMKAVDDLKERAEQQKKKVEELAINLQAY---
A0A2A2PYE8      ----VAAKVANLFAEAYLDHNISLRTQESNNAVEGLKGTVEEQQKRVERMARELQEY---
A0A2T6CN73      ----VAAKVANHFARAYIDYNTQLRISEGVKAVEDLKGPVETQRKLVERLASELQRY---
A0A2N8HDG3      ----KAADTLNKLIAVYNDHSTAERRTTAVKTKDFIREQRAQVGADLKQVDQKMDDI---
A0A2U8DZK4      ----LSAAIANEIVGVYTEDRINLATAAQKADLAELNNQLAAQEKIVIAQRDTVERL---
A0A1D8AWD4      ----LAADIANAIARVYAEDRITLATSDQREGLAQLRKELDKQELAVTTQRDHVEKL---
A0A2T6DFL8      ----LAADIANEVARTYSADRIALATSDQSEGMAQLRQELLKQEQAVTRQRDAVEKL---
A0A178IH18      ----LAAAIANEIARAYSEDRIAFATAEQRAGLDQLRRELAGQERAVATQRDLVEKL---
A0A2T6DT99      ----LAAAIANEIGTAYSADRIDFATSQQREGLAQLRKELEKQEKVVTSQRDLVEKL---
A0A1G3ZT33      ----LAARIANEIARVYSENRINFATAGQREGMTELKKQLAAQEEVVSKQRDLVEKL---
A0A3E1E2T2      ----LGAVIANEIARVYSDDRINLATSDQREGFVKLRGELIAQEQVVMLQRDTVERI---
B1ZMW1          ----LAAAIANEIARVYSDDRIALATSEQREGLAHLRKELEAQEQVVSAQRDTVERL---
A0A3D1TI55      ----EAAAIANKIAEVFQETRLASVKKKYSDALVQMQEEMDQQKFKVRELEDNVEDL---
A0A2G4G428      ----LARQVTTLFCKAIQKNSEDERLVITNPLVEKYRMDIDSVEDKIRKLYDKRNEL---
A0A3E1ET42      ----EAAAIANEVREAYDAQRQEIEAERIRRLTQTLDAKIKSSENDLEAARIVMNEV---
A0A2A2YDW8      ----DARDIAVEVYEAYKARRVQEETDLSENASKQLEQAVLEHSDVVEEKRKQRDNL---
A0A352XLN9      ----DARDIAVEVYEAYKARRVQEETDLSENASKQLEQAVLEHSDVVEEKRKQRDNL---
A0A3D0YP62      ----EAQRIAEAVYEAYKDRRYDLEINVRKDQLKAVKVELQNKSDRVAELRKRLMDI---
A0A3D3DV47      ----EAQRIAEAVYEAYKDRRYDLEINVRKDQLKAVKVELQNKSDRVAELRKRLMDI---
A0A2A2QX62      ----DAQAIASAVSEAYRERRTALQSEVASQAMDQLGKAVVQQKDLVEDKRKLLSQI---
A0A3N5WCF1      ----DARDIAEEVARAYKEYRAEIETRDADRQLQELNKAVRDQEDKVEERRKVLATI---
A0A2E5XJ49      ----DAQLIAQEIAKSYQLVRNADERARAGEALDALEAEVRSQEDLVEDKRRHFHTI---
A0A2E6SBY8      ----DAQLVAREIAKSYQLVRNSDERARASEALDALEAEVRSQEXLVEDKRRHFHAI---
A0A2E5QMS4      ----DARDVAKEIAESYQXGRNADERNRAGEALDALEAEVRSQEDLVEDKRRHFHSI---
A0A2E7YXQ3      ----DARDVAKEIAESYQLGRNADERNRAGEALDALEAEVRSQEDLVEDKRRHFHSI---
A0A2E3H787      ----DARDIAKEIAESYQLGRNADERKRAEEALDALESEVRSQEDLVEDRRRHFHAI---
A0A2E7AGN1      ----DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVRSQEDLVEDKRRHFHSI---
A0A2E7AKY7      ----DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVRSQEDLVEDKRRHFHSI---
A0A3D4CU34      ----DAQAVAKAIAESYKDGRNKEELKRAGDALDALESEVRSQEDLVEDKRRHFHSI---
A0A2E8M146      ----DARNIAKAIAESYKEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHAI---
A0A355S8S2      ----DARNIAKAIAESYKEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHAI---
A0A2D6DVN8      ----DARDIAKAIAKSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSI---
A0A3C1W2R2      ----DARDIAKAIAKSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSI---
A0A2E3NAY6      ----DARDIAKAIAESYQEGRNEDERKRAGDALDALEAEVRSQEDLVEDKRRHFHSI---
A0A2E3II01      ----DARDIAKAIAESYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSI---
A0A368B8C5      ----DARDIAKAIADSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSI---
A0A3R7RBB5      ----DARDIAKAIADSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSI---
B4DB23          ----RAANIANAIAVVYQEERQHELDKNVARGLEQLKDEVDRRRKEMEDTSAVAMQI---
A0A139TUL1      ----KAEDVLNYLIEVYNDHSRREKQIASTRAEDFIVKRIEKLGGQLGGVDKQVIDY---
A0A2N8HCB0      ----KAEDALNYLIEVYNDHSRREKQLAASRAEEFIVKRIGKLGGQLGGVDKQVIDY---
A0A2N8HP04      ----KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGKLGGQLGGVDKQVIDY---
A0A2N8HRJ0      ----KAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGKLGGQLGGVDKQVIDY---
A0A366HAG0      ----LAALIANTIADSYKETRLETDNARINKAIEGLNIQIAAKELQAKQSMERMIQL---
A0A3M1I8A3      ----KAKDIVDRLANEFIERNRLLKTGRMMSTLQVLRSQAQQMEREVTELEEAVQQY---
A0A0R2XQ77      ----IAARVANLFADEFINYNLTLNIDGSMKAVEDLRIRADQQKERVEELELKMAEY---
A0A2E9IN28      ----VAAEVANLFAKEFIDYNLKLNIDGSMKAVEDLRIRADQQKERVEELELKLAEY---
D5ENH7          ----MAADIANLFADEFINYKLTENIDASMVAVEGLRIRADRQKERVEELELELAEY---
A0A351WE84      ----LAARIANEMAAVYREQRLDVKRSELRRAIEVLDNEVQKQQEKVDQAESELERI---
A0A146GCJ0      ----KAQKIAATFVKEFFRENFDQKLALSRVANEFLQDEADKLKVKLEASERKLQAY---
A0A2T6D6H8      ----LAQKIAFSIVREFLRENFDQKLALSRVANEFLQEESEKLKAKLETSERKLQAY---
A0A1V5QDZ6      ----EAARIANSIAQVYHDQRLSMKRRELKRAIEALEGELAKQQEKVEKSEEELERI---
A0A3D4HF88      ----IAAHVANLFADEYINYNLRLTIENSMKAVEDLKLRVNQQRSEVEALETRLAEY---
A0A351MR11      ----LSRQVCRLFCESIQKNSEDERLTVTNPLVEKARVEIESLEERLNRLYLDKNEL---
A0A1V6J089      ----QAAAIANEIANVYRERRLADKRREIQHAIDAMSNEVRKQQERVEEAEAELERI---
A0A3C1BZR1      ----LAAEIANEVANVYRDRRLLAKRREIQRAIDAMSNEVRKQQERVEEAESELERI---
A0A1H6KPB7      ----LVKLICDAVTECYKEGREAQENEVLDKAIATIQEELTRRENELLAKTDTLRKY---
A0A2E9ISN4      ----YSKAYLVEMIQGYRSLRMEELMEVNQSALLGLKNEETRVLEDLEQAKQDLETF---
B9XAX1          ----MAQKLANAVAQEFILESLDQRFSNTKAANELLYAEAGKLKQKVEMSERNLQAY---
I0JYY7          ----AAAQIANAYAEAFIAFGLDRKLEANQHARHFLAQQLDSMRKKLALAEEKLATF---
A0A3E1EJT7      ----IAARVANLIAVEYIAYNSRLRVEESLKAVDDLKDRADQQRKRVDEIANSLLAF---
A0A317ZP96      ----VAAEVANLFAKEFIDYNLKLNIDSSMKAVEDLRIRADQQKDRVEELEFKLADY---
A0A2D5WGA5      ----LAQDIAQALAEEYKNHRTSLQKERVKTGIDTLTNRMEKINIEITGMQGRVDRL---
A0A2E7SSH2      ----LAQEIAQALAEAYEEYRQSLQQKRVQAGIDKLKERMEKTNEEISSMQSNVDAL---
A0A349GXM8      ----YTAAFLSLLIDEHREEWQTVQRQARNSAGGMLEQELARLDQKIRTAEDDLIEYQRL
B3DZK9          ----GAMQVANAYAESFITFGLDRKLEANRHARQFLAGQIELMKKKVTESEAKLARF---
A0A2A2XV69      ----EASEIANRIAEEYQRRRIGEQQGTVNRSLIQLKDEVAKQSRRVDELRAEAQRI---
A0A3C1VB86      ----LAARLANSLVKNYLGQDALVQSSVNEEAGVFLRREADRLKKKLEASDQALQDY---
A0A146G2Q9      ----EAMEIANRIAEEYQKRRLSEENEFLGKSLAQLQQEVEKQQAIVTKLQETMTRI---
A0A2T6D3Y2      ----EAMEIANRIAEEYQKRRLSEENEFLGKSLAQLQQEVEKQQAVVTKLQDTMTKI---
A0A2V2SDV4      ----EAAKLANEIAQAYCDYRVEHRKQMTMGGVDALEKKFTEQQGKVSEAQSNVDVL---
A0A2V5PK75      ----EAARLANAIAEAYQEHRQEQREKLSQGGIDAMEKRLKEQEEKVAKKAEEVEKL---
A0A1V6DME1      ----EAARIANEIAETYKEYRLAQRRELTMGGIRILEDRFQDQEKKVQAAQREVDEL---
A0A3D3DIJ3      ----EAARIANAIADAYKTHRQEQRAQLSRGGIKALEERFAEQEAKVKAAQERVDNL---
A0A2D5VY59      ----EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEKVRLKQADLDQL---
A0A2D8UZZ4      ----EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEKVRLKQADLDQL---
A0A353DV86      ----EAALIAQEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEKVRLKQADLDQL---
A0A2E5EPT8      ----EAAEIANTIAKVYAETREQNRITQVRKGIAKMREKLGEASNSVVQAQADVQRV---
A0A350EWA4      ----MARNIANEIAKVYREWRMNLSDERFQEGFDAINQQLEKAESDLKESEAEVNRL---
A0A2N8HD92      ----LVQNIAKTVPEAYKQDREMRENRLVETAIKSLKDVLREQEDTVNEKMMALKKL---
A0A2N8HIT2      ----LVQNIAKTVPEAYKQDREMRENRLVETAIKSLKDVLREQEDTVNEKMMSLKKL---
A0A354EBD3      ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
A0A355VEB2      ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
A0A2N8IMT3      ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
R6K1U5          ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
A0A2N8IWC2      ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
A0A2N8I441      ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
A0A1Q6UTU9      ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
A0A2N8I3A6      ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
A0A410SCC4      ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
A0A3R5VEW0      ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
A0A411SSG2      ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
B2UKW3          ----LVQNIAKAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKL---
A0A1M6RLZ4      ----DVKMITQAIADSYREMRIEDEEKRRTEASYELEKKIQAQEDLVADHRNRLATM---
A0A354T7G8      ----LAANIANEIAKSYMEQRNNIETEKKQKALTVLQQQISDQEELRRLAQVRSQEA---
A0A2S7U4L6      ----YVKPATEAIALAYSEMRINQETKRRDKTRVELAKKIQKYEDIVEDYRTRLLEF---
A0A2E8MEZ0      ----DAKEIAEAVSQAYIERRNSTEEGRAQEALEALNQELQDQGDLVQDYRKALTVL---
A0A2E3EC33      ----LAADIANALANAYQARRQNEEKERADTALEKLDTQIMAQMTRLEKARDMMINL---
A0A2E4GN01      ----LAADLANALAXAYQXRXQNEEKXRADKALEXLXTXIXAQMTXXEXSRDMMIGL---
A0A1Z8XU55      ----LAADIANAVADAYNIRRQEEEKNRATKALTLLDTQIKKQEGRLEAARNNMIEL---
A0A2E1RQR9      ----LAADIANAVADAYNIRRQEEEKNRATKALTLLDTQIKKQEGRXEAARNNMIEL---
A0A2E3ISQ4      ----LAADIANAVAKAYKIRRQRVEKERADTALALLDLQIQQQEKRLEDARSVMIKL---
A0A2D6W6F4      ----LAADIANAVADAYRTRRQEEEQSRAQKALALLDQQIKSQEGRLEKARNNMIEL---
A0A2D8Z5A8      ----LAADIANAVADAYRTRRQEEEQSRAQKALALLDQQIKSQEGRLEKARNNMIEL---
                                                                            

A0A2A2XVF1      --KEQNQAVS----------------LEE----RQNITVERLRELSSKATEAKSERLRLE
A0A2V5UHJ2      --RKEKGIIS----------------VDD----KSNVIIERLLDLNKGLTAAEGDRIAWE
A0A2V5PST3      --RQTHGVVS----------------IEK----GENIVIDRLVDLNRNLTTARAQRLEAE
A0A2V5PXM3      --KEQTKSVS----------------LED----RQNVVVEKLKELNQKVTEAKSLRILHE
A0A139SU05      --MQRHNLIS----------------LDN----STSIVDSRLLAVNGSLTQARLRLLEVE
A0A1D8AZK8      --RRKHNLVS----------------LDN----SINIISERLRTINATLTSARLSRIDLE
A0A1Q6UXG8      --KTKSDIVK---------------DTDT----TMSADFSTSQALEKEIFDLETQIKLAA
A0A2N8I9W1      --KTKSDIVK---------------DTDT----TMSADFSTSQALEKEIFDLETQIKLAA
A0A3R5SIG7      --KTKSDIVK---------------DTDT----TMSADFSTSQALEKEIFDLETQIKLAA
A0A2N8IBZ6      --KTKSDIVK---------------DTDT----TMSADFSTSQALEKEIFDLETQIKLAA
A0A2N8IJW9      --KTKSDIVK---------------DTDT----TMSADFSTSQALEKEIFDLETQIKLAA
R6J100          --KTKSDIVK---------------DTDT----TMSADFSTSQALEKEIFDLETQIKLAA
A0A139TV24      --KFENDIIA---------------DTQA----SLSADFSTAQTLDNSIFELQTQIMLAN
A0A2N8HT11      --KIKNDIIA---------------DTEA----SISADFNAAQTLDNSIFELQTQMKLAD
R7DS70          --KIKNDIIA---------------DTEA----SISADFNAAQTLDNSIFELQTQMKLAD
A0A2N8HNL6      --KIKNDIIA---------------DTEA----SISADFNAAQTLDNSIFELQTQMKLAD
A0A1V5QB01      --ARQNSVIA----------------IQE----RGNVAARILGTLSSQAAQFRTQKMFLE
A0A139SPN4      --MEKNNLIS----------------LDS----STSIVDNRLLTINGALTAARLRLLEVE
A0A1V6E7N1      --MEVHKLVS----------------LDE----STNLVNARLQTVSTELTRVRLARLELE
A0A2T6CWI7      --MTKHQLTS----------------LDT----SQSMSDEALKKAHTMRDDARLRLMAVD
A0A2D9MYT1      --KLEWDIIS----------------LED----SQNTTLQALLKAQTDYDAAHSRAVEAQ
A0A258ANJ7      --KRSNQAIS----------------LDE----RKDLVLSKLKELGSELNQQSKERLTLE
A0A139TLN4      --KKESNILT--------------------------DLSTALTEEYENSLNDKKDLRELT
A0A1G3ZFT0      --HTTSGKID---------------------------TKLEIKNLIQEIMVIEKQLINLR
A0A1Z8ZMT6      --TPALEAEK--------------------------------------------------
A0A2E8MCT7      --TPALEAEK--------------------------------------------------
A0A290QGD9      --RETHKMVS----------------LDQ----RRDMVTETLKARNIIVTQTNARFKDAE
A0A1D8AS58      --REKNQQVS----------------LDQ----RKDIVTEKLKALNAYVTQTTSRLNEAE
I6AQC1          --REKYNMGS----------------LDK----TKDIQTRKLMEQGSLVTQSGARLSEAT
W0ITH7          --REKYNMGS----------------LDK----TKDIQTRKLMEQGSLVTQSGARLSEAT
A0A290Q2Z2      --RKDLGISG-------------VDLNAR----YSDMEIETLRQMQNSLIALSVDAIGRK
A0A2A2RGK2      --RERERAAS----------------IET----MLSSAQSQVGEVSNNQSLIQRRIEQID
A0A2A2XXF7      --RERERAAS----------------IEN----MLASAQSQIAEILGVQNEIQKRIQQIE
A0A2A2R5D6      --RKSLNLNM-------------VGGGEN----ETQMIEEEWKRKSALLDDVRAEYLGRQ
A0A1J4XH17      --REKYGTVS----------------LEQ----QADIDHQELTEINKTVTDARRDFDIAQ
A0A3C1VJ32      --RRTLDINN-----------GTASSPEP----ELTVEQLRSY--QAQKLESEQAYNVSL
A0A2N9NTX7      --RDKLKISD---------PNSGAEMPGP----LLTTESLHRI--EGLRIESSAELVKME
B9XK55          --RKDLKVTD---------L-GGESATGP----QQTLEPMNVMHYNTLRIDAETQYIKEE
A0A2E6T482      --RTELGISD---------A----AGEES----YSIIEPEIVRRYESELITAKGIHTTQA
A0A3C0DQZ7      --RTELGISD---------A----AGEES----YSIIEPEIVRRYESELITAKGIHTTQA
A0A1Z9CBK5      --RVQLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKGLYTQQA
A0A2D6ZI96      --RVQLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKGLYTQQA
A0A358KGZ3      --RAKLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKGLYTQQA
A0A2E9ZQX4      --RAKLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKGLYTQQA
A0A3D5JZU0      --RAKLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKGLYTQQA
A0A2E6HCR0      --RVKLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKGLYTQQA
A0A1Z8WN04      --RVTLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKSLYTQQA
A0A2D7L1N4      --RVTLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKSLYTQQA
A0A2E2R937      --RVTLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKSLYTQQA
A0A2D5MR66      --RVKLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKSLYTQQA
A0A2E0PDQ1      --RVKLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKSLYTQQA
A0A2E2ZZP9      --RVKLGISD---------A----AGEDS----YSIVEPEIVRRYESELITAKSLYTQQA
A0A2A2RGF2      --HQDKGLNV---------I-HEVGGSV------MSLETDTIRALESQLIEIRGLFTKKQ
A0A2G4I5Y6      --HQDKGLNV---------I-HDGGGTI------MSLETDTIRSLESQLTDIRGIYIKKQ
A0A3M1I883      --RLELNIPD---------T-VAGTAGAY----SISTERERLSTLLQALQQARSDLVYWK
A0A1V6JZ45      --RAELNIPD---------S--INDASVY----QTSLEREKVSAMAQELTRAHSEYVYFL
A0A356NPK0      --REDLNISD---------I-YSAEGSSI----GMTTEPQIVMKLEQERTVAEANLIRYE
A0A2D7B5P5      --REDLNISD---------I-YSAEGSSI----GMTTEPQIVMKLEQERTVAEANLIRYE
A0A3D3XGB5      --REDLNISD---------I-YSAEGSSI----GMTTEPQIVMKLEQERTVAEANLIRYE
A0A2V6F8A1      --RKEYSISD---------I--SAEGPYA----ISTLEPQTVRSLEEQRIRAEAEFSGLA
A0A2V5TNH4      --GKEYKVSN---------G--SLEGA--------TLEPQTVRSLEEQRIRVEAEFSGLA
A0A2V5X5Q6      --RKEYKISD---------I--QPEGAYA----YSTLEPQTVRSLEEQRIRVEADYSGLA
A0A139TS01      --IVENDYLP------STMYRSGDNRSVM----TGAMEDEDFRNSKAQLMKFEKDEQELA
A0A2V5URB2      --RRAKGIIS----------------LND----KENIVVDRLADLNKRLTEAEAERIGLE
A0A2V2DJ66      --REKNGAIS----------------LDQ----MDDVDRRELQEMNTILTTDKRTYDAAA
R7L5A9          --REKNGAVS----------------LDT----LDDVDRTELRDINAILTNDKRIFDAAS
A0A2V6JLK8      --RDEEHIVD-----------LNPEGTED----SQAPVNSIVVKQEAEVNDAETKVTTLS
A0A2W5Z1A5      --RDTEHIID-----------LNPEGTED----SKTPLDTVVVKQEAEVNDVEAKVATLQ
A0A2V6EA09      --RDQEHIID-----------LNPEGMED----TQTAVNSIVLKQEEGVNEAEMTIEALG
A0A2V6GQI7      --RDQEHIID-----------LNPEGMED----SQTAVNSIVLKQEEGVNEAEMTIEALG
A0A2A2XXW5      --RKDKGMVS----------------LKD----AQNIDAATMRDLKIAYETLRSTADVAK
A0A3R5R2M8      --KAKSDIVK---------------DTET----TMSADFSSSQVLEKEIFELETQIKLSS
A0A411SUQ6      --KTKSDIVK---------------DADT----TMSADFSTSQALEKEIFDLETQIKLAS
A0A2N8HZF2      --KTKSDIVK---------------DTDT----TMSADFSTSQALEKEIFDLETQIKLAA
A0A354E720      --KTKSDIVK---------------DTDT----TMSADFSTSQALEKEIFDLETQIKLAS
B2UPB6          --KTKSDIVK---------------DADT----TMSADFSTSQALEKEIFDLETQIKLAS
A0A3C1HEJ2      --KKNHPGIS-----------------EE----EQAILSKQIGELNQRIAASEFNAQSLD
A0A1V6JU76      --RAQVKFVS----------------LDS----SYNIVAEALSQSQAQYAMAKAQAQTTQ
A0A1Q6UHJ9      --REQYKAIS----------------LEN----LDDVDRNELRDINTILTSDKRAYDAAS
A0A2V2BXR0      --REQYKAIS----------------LEN----LDDVDRNELRDINTILTSDKRAYDAAS
A0A2D8V0G3      --REDNQMPS----------------LEE----SQNTLSQALFLASDGFQKASDEAAQAV
A0A348S017      --REKNKMPS----------------LEE----SQDTVSKALFAASQSHQLANDEAEQAQ
A0A3C1UUV7      --REKNKMPS----------------LEE----SQDTVSKALFAASQSHQLANDEAEQAQ
A0A350I3V2      --REKNKMPS----------------LEE----SQDTVSKALFAASQSHQLANDEAEQAQ
A0A3D3XF90      --REKNKMPS----------------LEE----SQDTVSKALFAASQSHQLANDEAEQAQ
A0A2D7B522      --REKNKMPS----------------LEE----SQDTVSKALFAASQSHQLANDEAEQAQ
A0A356NIC2      --REKNKMPS----------------LEE----SQDTVSKALFAASQSHQLANDEAEQAQ
R7DZW0          --KKETDVLT--------------------------DLSTALTEEYENSLNDKKDLRELE
A0A2N8HID1      --KKETDVLT--------------------------DLSTALTEEYENSLNDKKDLRELE
A0A2N8HS06      --KKETDVLT--------------------------DLSTALTEEYENSLNDKKDLRELE
A0A3R8IT45      --REKYGL-T----------------LDP----KKDILTKKLVEQGSVLTQTQSRLGEAE
A0A1H1MGC9      --REKNKMVS----------------LDQ----RKDIVTEKLKALNAYVTQTTSRLNEAE
A0A2A2PYE8      --KEKNNMVS----------------LDQ----RKDIVSESLKAINAEKTRAQIAMNAAE
A0A2T6CN73      --KEQHKMVS----------------LDQ----RKDIVSESLKAINLEVARASIALNAAE
A0A2N8HDG3      --KIKNDIIA---------------DTEA----SISADFNAAQTLDNSIFELQTQMKLAD
A0A2U8DZK4      --RAELSISG----------------IDLTNPRNNSMEIERLRQMQSTLVALTVDANSLK
A0A1D8AWD4      --RKELDIAG----------------VDL-SQRYSDMDIETLRQMQNSLIALRVDAIGRK
A0A2T6DFL8      --RKELNISG----------------VDL-NARYSDMEIETLRQMQNTLIALSVDAIGRK
A0A178IH18      --RAQLNISG----------------VNLVTPQGGDIEIETLRQMQNTLVALRVDAIGRR
A0A2T6DT99      --RKDLNISG----------------VDL-SARYSDMEVETLRQMQNSLIALSVDAIGRK
A0A1G3ZT33      --RRDLNISG----------------VDL-NARYSDMEIERLRQMQNSLIALRVDAIGRR
A0A3E1E2T2      --RKDLNISG----------------VDL-NARYSDMEIETLRQMQNSLIALSVDAIGRK
B1ZMW1          --RKDLNISG----------------VDL-NARYSDMEIETLRQMQNSLIALSVDAIGRR
A0A3D1TI55      --RLQNQIVF----------------GAT----GAELSKERLDQLQLELERARLDLWTAE
A0A2G4G428      --IKGQKLLS----------------IAK----DTNTLTAERAALVRAREDTRKAIDEME
A0A3E1ET42      --ARKHGIV------------DNSYQGGQGFTAVVTTKPEEYADSLRSQGVLEQQVIRLR
A0A2A2YDW8      --QRRA--PS---------V-VRDFLTGN----AGNGYQSMQANVESQVEAAKTTLAELD
A0A352XLN9      --QRRA--PS---------V-VRDFLTGN----AGNGYQSMQANVESQVEAAKTTLAELD
A0A3D0YP62      --AEKVGVIW---------V-ESERGGET----IG-GELELRQLAERQLYEAERERDQLK
A0A3D3DV47      --AEKVGVIW---------V-ESERGGET----IG-GELELRQLAERQLYEAERERDQLK
A0A2A2QX62      --IRQEGIIY---------QGDSSVFQGT----SGFDKADEAETAAREYDRLDREKIQLE
A0A3N5WCF1      --VRNKGIIY---------R-GQDAFYES----GGVDEDQGARNALQIYHDIEQEKLQLE
A0A2E5XJ49      --VKAVGVPY---------I-EGVFPSGR----MGQSEEEILKMAVMQQFEHEKSKRQLE
A0A2E6SBY8      --VKAVGVPY---------I-EGVFPSGR----MGQSEEEILKMAVMQQFEHEKAKRQLE
A0A2E5QMS4      --VKAVGIPY---------I-EGVYSSGR----MGQSEEYILKSAEMQQFGAEERKAELE
A0A2E7YXQ3      --VKAVGIPY---------I-EGIYSSGR----MGQSEEYILKSAEMQQFGAEERKAELE
A0A2E3H787      --VKAVGIPY---------I-EGIXTSGR----MGQSEENILKTAEMQQFAAEXKKXXLE
A0A2E7AGN1      --VRAVGIPY---------I-EGVLTSGR----MGQSEETILKTAEMQQFTAEEKKGQLE
A0A2E7AKY7      --VRAVGIPY---------I-EGVLTSGR----MGQSEETILKTAEMQQFTAEEKKGQLE
A0A3D4CU34      --VRAVGIPY---------I-EGVLTSGR----MGQSEETILKTAEMQQFTAEEKKGQLE
A0A2E8M146      --VKAVGIPY---------I-EGVLTSGR----MGQSEEAILKSAEMQQFTAEEKKGQLE
A0A355S8S2      --VKAVGIPY---------I-EGVLTSGR----MGQSEEAILKSAEMQQFTAEEKKGQLE
A0A2D6DVN8      --VRAVGIPY---------I-EGVLTSGR----MGQSEETILRTAEMQQFTAEEKKGQLE
A0A3C1W2R2      --VRAVGIPY---------I-EGVLTSGR----MGQSEETILRTAEMQQFTAEEKKGQLE
A0A2E3NAY6      --VRAVGIPY---------I-EGVLTSGR----MGQSEETILRSAEMQQFTAEEKKGQLE
A0A2E3II01      --VRAVGIPY---------I-EGVLTSGR----MGQSEETILRTAEMQQFTAEEKKGQLE
A0A368B8C5      --VRAVGIPY---------I-EGVLTSGR----MGQSEETILRTAEMQQFTAEEKKGQLE
A0A3R7RBB5      --VRAVGIPY---------I-EGVLTSGR----MGQSEETILRTAEMQQFTAEEKKGQLE
B4DB23          --RAREGIVD----------SDPDKENSV----ISGGEGGNVLQRQQQVNEQQIKVVELE
A0A139TUL1      --KRHSRIVK---------------DMST----TLEATFSKLQEIGTELFSTRTELIQVK
A0A2N8HCB0      --KRNSRIVK---------------DMDT----TLDATFNRVQEIGTELFSTRTELIQVK
A0A2N8HP04      --KRNSRIVK---------------DMDT----TLDATFNRVQEIGTELFSTRTELIQVK
A0A2N8HRJ0      --KRNSRIVK---------------DMDT----TLDATFNRVQEIGTELFSTRTELIQVK
A0A366HAG0      --KKDLDLVT-------------LPTSMD----AKGAQDDVMTPESAMLLDTQRDVATLQ
A0A3M1I8A3      --REKQNFVS----------------FDA----GSNPVAQSLSQVQARYADAKATAEIMQ
A0A0R2XQ77      --REDNNAVS----------------LDS----QENIAGTQLSTLNTIKLENKNVYDNLE
A0A2E9IN28      --REENNAVS----------------LQS----DENIAGAQLARLNEIKLSNKNLYDQLE
D5ENH7          --REEHNAVS----------------LDS----QENIAREQLGSLNQIKLESKNNYDQFE
A0A351WE84      --RQEVGVSF----------------LGQ----GFRADKVRLQQLEADRIASRVDMLVRK
A0A146GCJ0      --REDNKAVS----------------LEE----RQNIIVEKLRELNSKVTEAKSKRLQLE
A0A2T6D6H8      --REQNKAVS----------------LEE----RQNIIVEKLRELNTKVTEAKSKRLQLE
A0A1V5QDZ6      --RKDLGVSV----------------LSQ----GVRADKLRLSQMEADRIAARVDMLVRK
A0A3D4HF88      --KERTGSIS----------------VEE----REDIDLQEIMQLNQVLTTTKQVRDQSK
A0A351MR11      --VGRERMLA----------------IVK----DTNTLGSERGALVKDREELRRQIDELA
A0A1V6J089      --RQERGIAL-------------IGRGLM----SIRVESTRLNALENERSAARVDMLVRK
A0A3C1BZR1      --RQERGISL-------------IGRGNM----SIRVEATRLNMLEGERSGARVEMLVRK
A0A1H6KPB7      --MTTSDYIG--------LLSDTGNTIPT----TVNNEEAVLTERRNKLSALDDEITQLK
A0A2E9ISN4      --ERENQILF----------------EKE----RADMDIAFVNQLLARLKSVRLERVLLE
B9XAX1          --KESNKTVS----------------LED----RQNIIVEKLKGLNQKYTSAKADRIQME
I0JYY7          --TEQTGIVK------------------------------------FPGVDRSPAEQELN
A0A3E1EJT7      --RQRGNLIS----------------LVQ----SKDIVTEKLKALNMMGTQTNAHLKEAE
A0A317ZP96      --REQKNAVS----------------LDS----QENIAREQLGSLNTMKLNNKNILDNLE
A0A2D5WGA5      --RTDLGISD-------------AAGEES----YSIIEPEIVRRYESELITAKGVHTTQS
A0A2E7SSH2      --RAKLGISD-------------AAGEDS----YSIVEPEIVRRYESELITAKGLYTQQA
A0A349GXM8      HDIARVEARGTMESRHLSALMERRNQLTT----ELMLLEAQYPALDGANAAVISDVARLT
B3DZK9          --MEKTGIVK------------------------------------LPGVNSSPTEKELA
A0A2A2XV69      --RIENEIQD-----------LNPDSVVD----PMQAANEVLLSVEQQVSTERLRVSTLR
A0A3C1VB86      --RKQVGSVS---------------------------LEQSQDVITPQLQDLNERLTQSK
A0A146G2Q9      --RQETGIQD-----LNPDTADGGTQAEN----SILLQVEQQVSQESL------RVAALR
A0A2T6D3Y2      --RQETGIQD-----LNPDTADGGTQSEN----SILLQVEQQVSQESL------RVAALR
A0A2V2SDV4      --RFKLQISD-----------PVVTENTP----GTLMTGDTLRRFESLRIEGLRELVSQQ
A0A2V5PK75      --REELQVPD-----------SMSLEAAP----VQLLSAETIHKVESLRIENEADFVKQS
A0A1V6DME1      --RAKLEISD-----------ADAAGTSP----TTLLEAEVLRRLKAQQIEGEAAYVREA
A0A3D3DIJ3      --RKELNISD-----------AMASGDGP----SPLMTAETLRKIESLRIESQAEYVRQA
A0A2D5VY59      --REELNISD-------IYSAEGSSIGMT----TEPQIVLRLEQERTV---AEAKLIRFQ
A0A2D8UZZ4      --REELNISD-------IYSAEGSSIGMT----TEPXIVLRLEQERTV---AEAKLXRFQ
A0A353DV86      --REELNISD-------IYSAEGSSIGMT----TEPQIVLRLEQERTV---AEAKLIRFQ
A0A2E5EPT8      --REELKFDV-----------IMETPGKV----ALALDSERVRALEMLNIEMNAGLTSKK
A0A350EWA4      --RASLEITD--------------------------IDEASSRNEQFFDMQTIQQFRN--
A0A2N8HD92      --IAESSYLP-------TTWRNGENRNTL----TAGMEEEDFRNAKSQAMAFEKDEKELA
A0A2N8HIT2      --IAESSYLP-------TTWRNGENRSTL----TAGMEEEDFRNAKSQAMQFEKDEKELA
A0A354EBD3      --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
A0A355VEB2      --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
A0A2N8IMT3      --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
R6K1U5          --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
A0A2N8IWC2      --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
A0A2N8I441      --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
A0A1Q6UTU9      --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
A0A2N8I3A6      --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
A0A410SCC4      --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
A0A3R5VEW0      --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
A0A411SSG2      --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
B2UKW3          --IAESSYLP-------TSWRNGEHRSTL----TAGMEEEEFRNAKAQAMDFERREKELA
A0A1M6RLZ4      --SQKTGI---------PYAGDKNSIGAG----SNPAELNFRENER-LYQEALRDRDSLK
A0A354T7G8      --RRKAGIVGDWIAGGGSSLNPGGEMRSE----KDSMVISREQAL--M--LADQDTLTLQ
A0A2S7U4L6      --SAKTGIYS--L----------DRSSGG----ATDVVRRDLQQENMLYDEAVKARDELE
A0A2E8MEZ0      --IQQYGI---------PYFDGRDSGQVG----QAEELMYRRAQE--KLDTLEQTRDQIQ
A0A2E3EC33      --MEELNIVD--LSLGEPTWLRGSQPNTG----IASLVMTAKQKE--F--QAEGAIQNLR
A0A2E4GN01      --MXELNIVX--LSLGEPTWLRGSQPXTG----XASLVMTAKQKE--F--XAEXAIQXLX
A0A1Z8XU55      --MEELNIVD--LSLGEPVWLRGSQPNTG----TASLVLAAKQRE--F--AAEEAIQNLR
A0A2E1RQR9      --MEELNIVD--LSLGEPVWLRGSQPNTG----TASLVLAAKQRE--F--AAEEAIQNLR
A0A2E3ISQ4      --MEDLNIVD--LSLGEPVWLRGSQPNTG----TASLVMAAKQRE--F--AAEEAIQNLR
A0A2D6W6F4      --MEELNIVD--LSLGEPVWLRGSQPNTG----TASLVMAAKQRE--F--AAEEAIQNLR
A0A2D8Z5A8      --MEELNIVD--LSLGEPVWLRGSQPNTG----TASLVMAAKQRE--F--AAEEAIQNLR
                                                                            

A0A2A2XVF1      SDIEQVRK------------VPANNTDELLRIGSVATIPQVAEAR------------RQ-
A0A2V5UHJ2      AQVRAARG------------------RNADEVPSVRNSAVIGSLK------------AE-
A0A2V5PST3      SLNSVVQN------------------KSTQYLSQVLTQGMIPTLR------------ST-
A0A2V5PXM3      TSYNQALQ-------------FSNNPAALLFLPAVANDPTVTDIR------------GN-
A0A139SU05      SLAKQVDD-------------YQEAGANLLEITYIGNYNTVAPLR------------GQ-
A0A1D8AZK8      NLLGQIER-------------MQQAGGNLLEIGYITAYGNIAALK------------TQ-
A0A1Q6UXG8      ILADNLKE-------------TERKQGLISVETGLPDSGIARQIE------------HY-
A0A2N8I9W1      ILADNLKE-------------TERKQGLISVETGLPDSGIARQIE------------HY-
A0A3R5SIG7      ILADNLKE-------------TERKQGLISVETGLPDSGIARQIE------------HY-
A0A2N8IBZ6      ILADNLKE-------------TERKQGLISVETGLPDSGIARQIE------------HY-
A0A2N8IJW9      ILADNLKE-------------TERKQGLISVETGLPDSGIARQIE------------HY-
R6J100          ILADNLKE-------------TERKQGLISVETGLPDSGIARQIE------------HY-
A0A139TV24      DLENNLKA-------------VSKKAELISLDTGIADSGVSRQIE------------AY-
A0A2N8HT11      GLKENLDA-------------LGHKAGLISLDTGIADSGVSRQIE------------AY-
R7DS70          GLKENLDA-------------LGHKAGLISLDTGIADSGVSRQIE------------AY-
A0A2N8HNL6      GLKENLDA-------------LGHKAGLISLDTGIADSGVSRQIE------------AY-
A0A1V5QB01      AQQPLLSRASDEAVLAALG--PAGSGIPGVGLMSIAAMGVETNAPAPAVGGLEGLVEYGV
A0A139SPN4      SIAKQVAD-------------YQESGDNLLEITYIGSYGTVAPLR------------TQ-
A0A1V6E7N1      SQVKQIET-------------YQAEGRNLFEISSIATYDQIPALN------------AQ-
A0A2T6CWI7      EKITQVEA-------------YQKEKRNLFEVVEIANYGAVPSLR------------AQ-
A0A2D9MYT1      ASADEAQR-------------VFTETGEFGTIPDVAADAEVKKMR------------GD-
A0A258ANJ7      TQLQACKE-------------GTLPRDELLSLPSIASHPKVSGIL------------SQ-
A0A139TLN4      LEIKSIEYLKEYLEKE-----AEFDSRLVPINSKIADMGIRDQIG------------VF-
A0A1G3ZFT0      MTKHEMFY-------------------------------------------------QY-
A0A1Z8ZMT6      ---------------------------------------------------------EM-
A0A2E8MCT7      ---------------------------------------------------------EM-
A0A290QGD9      VRWKQIQE-------------LRAAGRDLTELSFIAIQPIIGELK------------KQ-
A0A1D8AS58      VRWRQVQE-------------RKATPALLLELPFIASQSLIVQLV------------QQ-
I6AQC1          VRWQQVDE-------------RLKNNGDLLELPFIASNPLVSQLA------------SQ-
W0ITH7          VRWQQVED-------------RIKANGDLLELPFIANNQLVAQLA------------SQ-
A0A290Q2Z2      TRYERFKS----IPAEDRI--------NLINSELIQDPNIQNLLQ------------AY-
A0A2A2RGK2      SDLAVIRA-------------NTGEPEELLTLPSVAAEPKVAQYS------------ES-
A0A2A2XXF7      SDLAVVRT-------------NTGSVEELLFLPSVAAEPKVAQYS------------ES-
A0A2A2R5D6      VRYERLNR----LSTNEFL--------DAIVAMGIEDANLTSLRA------------KK-
A0A1J4XH17      SRKNLVDQ-------------YIKSGGKLWDLSFINSIPQVEQLL------------SD-
A0A3C1VJ32      VQLQDLQTIQQT-NQSKLR--------DVLPGVVSDAE-LGSLLA------------QY-
A0A2N9NTX7      TLLSKLEELQRT-NPAALI--------QTIPITAPDSY-LNSLME------------QV-
B9XK55          KLLSQLKQLKSD-E---LK--------QAIPTAAPDAI-LIQLLQ------------DL-
A0A2E6T482      TLLEGLKAQSRE----ELR--------ASILTAHPDAQ-LDALIR------------EL-
A0A3C0DQZ7      TLLEGLKAQSRE----ELR--------ASILTAHPDAQ-LDALIR------------EL-
A0A1Z9CBK5      TLLQGLQEQSVE----ELR--------ESIMTANPDAQ-LDALIR------------EY-
A0A2D6ZI96      TLLQGLQEQSVE----ELR--------ESIMTANPDAQ-LDALIR------------EY-
A0A358KGZ3      TLLQGLQEQSLE----ELR--------ESIMTANPDAQ-LDALIR------------EY-
A0A2E9ZQX4      TLLQGLQEQGLE----ELR--------ESIMTANPDAQ-LDALIR------------EY-
A0A3D5JZU0      TLLQGLQEQSLE----ELR--------ESIMTANPDAQ-LDALIR------------EY-
A0A2E6HCR0      TLLKGLKEQSFE----NLR--------ESILTAYPDAQ-LDALVR------------EY-
A0A1Z8WN04      TLLQGLKEQGDE----ELR--------NSILTAYPDAQ-LDALVR------------EY-
A0A2D7L1N4      TLLQGLKEQGDE----ELR--------NSILTAYPDAQ-LDALVR------------EY-
A0A2E2R937      TLLQGLKEQGXE----XLR--------NSILTAYPDAQ-LDALVR------------EY-
A0A2D5MR66      TLLQGLQEQSSE----ELR--------NSILTAYPDAQ-LDALVR------------EY-
A0A2E0PDQ1      TLLQGLQDQDSE----ELR--------NSILTAYPDAQ-LDALVR------------EY-
A0A2E2ZZP9      TLLQGLQDQGSE----ELR--------NSILTAYPDAQ-LDALFR------------EY-
A0A2A2RGF2      TSVVELKKLKPE----QLR--------NVLGPPVVNDEILARRLE------------EH-
A0A2G4I5Y6      TSFVELKKLKPE----QLK--------NALGPPVVNDEILSRRLE------------EY-
A0A3M1I883      SKLQELERIRDK-GLQDLR--------DAILTVMPSEALLPKRID------------DL-
A0A1V6JZ45      TKLEDLKKLDRT----SMR--------EAVLVTMPTEARLGELLG------------AL-
A0A356NPK0      TLFKELTSLTLE----ELR--------NTLLTAMPGNLRLTSLLN------------EF-
A0A2D7B5P5      TLFKELTSLTLE----ELR--------NTLLTAMPGNLRLTSLLN------------EF-
A0A3D3XGB5      TLFKELTSLTLE----ELR--------NTLLTAMPGNLRLTSLLN------------EF-
A0A2V6F8A1      GMLNGLLQLRADKGDAELR--------KSILTAMNDEL-LSKLMM------------DL-
A0A2V5TNH4      GLLNGLLKLREEKGNTELR--------KSILTAINDEL-LSKLMM------------DL-
A0A2V5X5Q6      GLLNGLLKLREEHGDSELR--------KSILTAINDEL-LSKLMT------------DL-
A0A139TS01      AYVAEVQR----LPDDKLM--DYVTNSDLLNAEILAADSLRKTYQ------------EY-
A0A2V5URB2      AQARLIKR------------------RDYDSLPAVISNSLIQSLR------------AQ-
A0A2V2DJ66      IQWSLLQE-------------YKRDGRDLCTLPFIADLPIISKLV------------SD-
R7L5A9          TQWTLMQE-------------YKRDGKDLCTLPFISEFQQIAKLL------------TD-
A0A2V6JLK8      SKLAQIEN----LKGDDLM--------RMLPTLDVQDPTVQKILP------------NY-
A0A2W5Z1A5      SQLSQIEH----LKGEDLM--------RMFAALNIQDPTTLKILP------------NY-
A0A2V6EA09      SRLEQIRK----LKGEELM--------RMLATLNIQDPTIQKILP------------NY-
A0A2V6GQI7      SRLEQIRK----LKGEELM--------RMLATLNIQDPTIQKILP------------NY-
A0A2A2XXW5      QIAQQAQE-------------WVAAGKDITDFAPLAKDEQVAYLR------------KQ-
A0A3R5R2M8      VLADNLKE-------------AGRNGGLISVDTGLTDNGLSRQIE------------NY-
A0A411SUQ6      TLADNLKE-------------SERKHGLISVETGLPDSGIARQIE------------HY-
A0A2N8HZF2      ILADNLKE-------------TERKQGLISVETGLPDSGIARQIE------------HY-
A0A354E720      TLADNLKE-------------SERKQGLISVETGLPDSGIARQIE------------HY-
B2UPB6          TLADNLKE-------------SERKHGLISVETGLPDSGIARQIE------------HY-
A0A3C1HEJ2      RDLSRMTG-------------LGQNVPLLVTMPVVSADPTVSAAM------------IA-
A0A1V6JU76      TIVEELDR-------------HIQAGNPLETFPKIAADGKVNSLQ------------LQ-
A0A1Q6UHJ9      TQWNLVQE-------------FKRDGKDLADLPFIAELPQISKLL------------TD-
A0A2V2BXR0      TQWNLVQE-------------FKRDGKDLADLPFIAELPQISKLL------------TD-
A0A2D8V0G3      KVVETVDNLIAEAEADSRT-------LDLSVLPYIQNSPIIQQLR------------VS-
A0A348S017      KAIDEVDKMIREAGESGQL-------LDLSQIPFVASSEIIKTIR------------AN-
A0A3C1UUV7      KAIDEVDKMIREAGESGQL-------LDLSQIPFVASSEIIKTIR------------AN-
A0A350I3V2      KAIDEVDKMIREAGESGQL-------LDLSQIPFVASSEIIKTIR------------AN-
A0A3D3XF90      KAIDEVDKMIREAGESGQL-------LDLSQIPFVASSEIIKTIR------------AN-
A0A2D7B522      KAIDEVDKMIREAGESGQL-------LDLSQIPFVASSEIIKTIR------------AN-
A0A356NIC2      KAIDEVDKMIREAGESGQL-------LDLSQIPFVASSEIIKTIR------------AN-
R7DZW0          LEIKSIEYLKDYLEQE-----AEHDARLVPINSKIADMGIRDQIS------------VF-
A0A2N8HID1      LEIKSIEYLKDYLEQE-----AEHDARLVPINSKIADMGIRDQIS------------VF-
A0A2N8HS06      LEIKSIEYLKDYLEQE-----AEHDARLVPINSKIADMGIRDQIS------------VF-
A0A3R8IT45      VRKNQVEA-------------RIKAGGDLTELPFIAANHLVAQLS------------QL-
A0A1H1MGC9      IRWRQVQE-------------RKATPAQLLDLPFISSSQLIGQLV------------QQ-
A0A2A2PYE8      GRINQIKE-------------VRQRSGDLTELPFIASQPQVVQLG------------QL-
A0A2T6CN73      NRRNQVAE-------------LKARGGNLTELPFIATQATIVELL------------KQ-
A0A2N8HDG3      GLKESLNA-------------LGQKAGLISLDTGIADSGVSRQIE------------AY-
A0A2U8DZK4      TRYESFRD----IPPDKRL--------SLVNAQLIEDPGTQRLQQ------------IY-
A0A1D8AWD4      TRWERFRN----IPAADRR--------NLVNSELIQDTNIQNLLQ------------AY-
A0A2T6DFL8      TRWERFKS----IPAGERQ--------SLVNSELIPDQNIQNLLQ------------AY-
A0A178IH18      ARYENFKK----IPEADRA--------NLVNSELITDTNIQNLLQ------------AY-
A0A2T6DT99      TRYERFKS----IPPEERL--------NLVNSELIQDPNIQNLLQ------------AY-
A0A1G3ZT33      TRWERFKN----IPAGERV--------TLANSELIQDTNIQNLLQ------------AW-
A0A3E1E2T2      TRWERFKD----IPFEERV--------SLVNSELIPDINIQNLLQ------------AY-
B1ZMW1          TRWERFKS----IAPADRL--------SLVNSELIQDTNIQNLLQ------------AY-
A0A3D1TI55      AQLQKVES----LEGKQLE----------DAIPFLVNDPSYNTLN------------QQ-
A0A2G4G428      IIWRLIGE-------------YKQTGKDLYDVAQVRSDERVASFG------------SK-
A0A3E1ET42      SQLESLMK----LEGDQLI--ANAASLDVQNDT------IKALYP------------EY-
A0A2A2YDW8      SMIASIDR----LSADEVI--RYAANLEVAGQD------LKSLFP------------EY-
A0A352XLN9      SMIASIDR----LSADEVI--RYAANLEVAGQD------LKSLFP------------EY-
A0A3D0YP62      FQIDKLLA----VADEDLP--GLAA--DLPDVG------FREAYN------------KF-
A0A3D3DV47      FQIDKLLA----VADEDLP--GLAA--DLPDVG------FREAYN------------KF-
A0A2A2QX62      SQIETLLK----YDGAQLL--AHASGLSLPDNV------IPVLLP------------QF-
A0A3N5WCF1      SQISSLLK----YDSDQLM--VYAGGLNLPDNI------IRTLYP------------QY-
A0A2E5XJ49      NQINQLVN----LKNEELM--NFAEGLKLPGSA------VPELHR------------AW-
A0A2E6SBY8      NQINQLVS----LKNEELM--NFAEGLKLPGSA------VPELHR------------AW-
A0A2E5QMS4      NQIQQLLT----LRDDELI--DFAEGLKLPGSQ------VPVLRA------------RI-
A0A2E7YXQ3      NQIQQLLT----LRDDELI--DFAEGLKLPGSQ------VPVLRA------------RI-
A0A2E3H787      NQIERLLT----LKDAELI--DFAEGLQLPGSQ------VPVLRG------------RL-
A0A2E7AGN1      NQIEQLLT----LRDEELI--DFAEGLQLPGSQ------VPVLRS------------RF-
A0A2E7AKY7      NQIEQLLT----LRDEELI--DFAEGLQLPGSQ------VPVLRS------------RF-
A0A3D4CU34      NQIEQLLT----LRDEELI--DFAEGLQLPGSQ------VPVLRS------------RF-
A0A2E8M146      NQIEQLLT----LQDEELI--DFAEGLQLPGSQ------VPVLRG------------RY-
A0A355S8S2      NQIEQLLT----LQDEELI--DFAEGLQLPGSQ------VPVLRG------------RY-
A0A2D6DVN8      NQIAQLLT----LRDEELI--DFAEGLQLPGSQ------VPVLRA------------RY-
A0A3C1W2R2      NQIAQLLT----LRDEELI--DFAEGLQLPGSQ------VPVLRA------------RY-
A0A2E3NAY6      NQIAQLLT----LRDEELI--DFAEGLQLPGSQ------VPVLRA------------RY-
A0A2E3II01      NQIAQLLT----LRDEELV--DFAEGLQLPGSQ------VPVLRA------------RY-
A0A368B8C5      NQIAQLLT----LRDDELV--DFAEGLQLPGSQ------VPVLRA------------RY-
A0A3R7RBB5      NQIAQLLT----LRDDELV--DFAEGLQLPGSQ------VPVLRA------------RY-
B4DB23          RQLEMINS----LSPEQLQ--------DALKTLGIDDTTVSRNLP------------LL-
A0A139TUL1      VLAGLLAE-------------GGRERDMIPANIGIQDAGIAKQIE------------LF-
A0A2N8HCB0      VLARLLAD-------------RSRQQDMIPANIGIQDAGIAKQIE------------LF-
A0A2N8HP04      VLARLLAD-------------RSRQQDMIPANIGIQDAGIAKQIE------------LF-
A0A2N8HRJ0      VLARLLAD-------------RSRQQDMIPANIGIQDAGIAKQIE------------LF-
A0A366HAG0      KQVRDLKA-----QHDQMMTLEGDELIRLAGEMKVENETIRRMGP------------TY-
A0A3M1I8A3      ATIRELDA-------------HLKAGRPAETFPSVANDSRVIELQ------------KR-
A0A0R2XQ77      TRMGLVET-------------FRREGRNLWELSFIAEESRVAGLL------------DR-
A0A2E9IN28      TKWNLIES-------------YRRQGKELWELSFISEQPRVSSLL------------QR-
D5ENH7          TKWKLIDS-------------YKLEGKNLWELSFISEQPRVASLL------------QN-
A0A351WE84      ARLNQLES----LEGTELMNASSYVVMDQSIAS------IRQQLI------------DT-
A0A146GCJ0      ADIDQLKR----VEKGNLD--------ALLAINSVSNLPQVALIR------------EQ-
A0A2T6D6H8      ADIEQLKR----VEKANVD--------ELLSINSVSQLPHVAVIR------------EQ-
A0A1V5QDZ6      AQLDQLVN----LSGEELMNASSYIVSDPALQA------IRAQLI------------DS-
A0A3D4HF88      HRWEQIQS-------------FKAEGKPLQDLPFIAEMPLVQDLQ------------SQ-
A0A351MR11      IIWEQIEQ-------------FKKEGKDLVLIPMVKSDDRVAALY------------NR-
A0A1V6J089      ARMDQLED----LEGDKLMDAAAYIVQDPTLLS------IRQQYI---------------
A0A3C1BZR1      ARMDQLEG----LEGDRLMDAAAYIVQDPTLMG------IRQQLI---------------
A0A1H6KPB7      THINKLKS----LKDSELM--DYVRQTDLLAETTPGSLSVRELYT------------RS-
A0A2E9ISN4      NQYEQLSDADILTVNEALA--ATRETEGRSQVTPEGAPAVDPGAETPPEAAKNYGAYDHL
B9XAX1          ADLKLIQS----LTNQP----EAILTLPSILQDPAVMETRRRVVE------------QE-
I0JYY7          RVSEAVSKARFEMIRREVYLEKAKAAMDAGKLAAIPDSPFTVDLK------------KI-
A0A3E1EJT7      VKWNQVQE-------------WTKAGRSLSELPFITSQAKVGQLL------------VQ-
A0A317ZP96      TKWNLIEN-------------YKREGKDLWELSFIAEQERVASLL------------ER-
A0A2D5WGA5      TLLEGLKA----QSDEELR--ASILTAHPDAQ-------LDALIR------------EL-
A0A2E7SSH2      TLLQGLQG----QSPDELR--ESIMTAHPDAQ-------LDALIR------------EF-
A0A349GXM8      RATGEIKPSESSRDEEE----APVPGGETKSAKEDAAQQTDETIQ------------GF-
B3DZK9          QVSDALAKARFEMIRKEVFYERAKNGLDMGKSLTIPDNQYTMDIK------------KN-
A0A2A2XV69      AKYEQISK----LSDDQIM--RSISTLDVQDPT------ITQMLP------------QF-
A0A3C1VB86      ASLVQAQG----AYQDSLK--MSTNTEDLLAYPQIAIEPDMVQIS------------TD-
A0A146G2Q9      AKYDQVSK----MTDEQIM--RSLTTLEIEDPT------ITQLYP------------QF-
A0A2T6D3Y2      AKYDQVSK----MTDEQIM--RSLTTLEIEDPT------ITQLYP------------QF-
A0A2V2SDV4      TLLDKLLA----FSPKDVV--NVL--------PTVIPDATLTSWL------------EQ-
A0A2V5PK75      TLLNKLKS----LKYQELT--QVL--------PTTVADSLLSSLL------------EQ-
A0A1V6DME1      TLLQELKT----TAPEDLK--SVL--------PTAVADPQLAELL------------QQ-
A0A3D3DIJ3      TRLDRLKNLGKELGPEGLA--QAI--------TTDAPDTLLTSLL------------DQ-
A0A2D5VY59      TLFNELEA----MTLDQLK--NTILTAMPGNLR------LTHLLN------------EY-
A0A2D8UZZ4      TLFNELEA----MTLDQLK--NTILTAMPGNLR------LTHLLN------------EY-
A0A353DV86      TLFNELEA----MTLDQLK--NTILTAMPGNLR------LTHLLN------------EY-
A0A2E5EPT8      TQLEQLKS----LSPKVLG--NALMTVLPNEIN------LPRLYE------------QL-
A0A350EWA4      --KHDLEK----LEYEKMM--KRLHGMEALTSIDQLKVALPTSFP------------DSA
A0A2N8HD92      SYVQELQR----LPDDKLL--DYVISSDLLNAESVGAKALRETYA------------EF-
A0A2N8HIT2      SYVQELQR----LPDDKLL--DYVISSDLLNAESVGAKALRETYA------------EF-
A0A354EBD3      SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
A0A355VEB2      SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
A0A2N8IMT3      SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
R6K1U5          SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
A0A2N8IWC2      SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
A0A2N8I441      SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
A0A1Q6UTU9      SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
A0A2N8I3A6      SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
A0A410SCC4      SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
A0A3R5VEW0      SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
A0A411SSG2      SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
B2UKW3          SYVQELQR----LPDDKLL--DYVISSDLLNAETVGADALRKTYA------------EF-
A0A1M6RLZ4      SIVQRLGD----LDNEALI--SAMAGLNLPEIK-----VVQNLNE------------MY-
A0A354T7G8      AEIDEIGK----LSIEELI--ARASGLKLDNPS------LASNTT------------EY-
A0A2S7U4L6      RQVKDLVG----LDDETLI--SHVSGLNRPESA-----VLALTFQ------------QY-
A0A2E8MEZ0      IQIRKLID----TPNEDLI--RTAAGLELPENQ------VTSYYT------------GY-
A0A2E3EC33      TTIKSLTD----LEGEELI--KSAVDLGIKNET------LSSGWS------------SY-
A0A2E4GN01      TTIXSLTD----LKGEELI--KSAVDLGIKNDI------LSNGWS------------SY-
A0A1Z8XU55      STISSLTQ----LEGEELI--KSAVDLGVKNET------LTSGWT------------EY-
A0A2E1RQR9      STISSLTK----LEGEELI--KSAVDLGVKNET------LTSGWT------------EY-
A0A2E3ISQ4      STIKSLTQ----LEGAELI--KSAVDLGVKNET------LNSGWS------------EY-
A0A2D6W6F4      STIKSLTQ----LEGAELI--KSAVDLGVKNET------LNSGWS------------EY-
A0A2D8Z5A8      STIKSLTQ----LEGAXLI--KSAVDLGVKNET------LNSGWS------------EY-
                                                                            

A0A2A2XVF1      ------------LSDSNMEIAAMQDRYGERHPKFIAALAKAESLKKSLRESAGKAGDILN
A0A2V5UHJ2      ------------LGKFEAEYASLAKEFKAGYPPLDNVKTRLEETRRHLNSEIDKEVKGIE
A0A2V5PST3      ------------LLTLEAEKIKQSTVFKPDHPRMIELNQQIKEATQSLNTEINNVVRGIR
A0A2V5PXM3      ------------VGRLESDLANLRQRYKEKHPKYIQTASQLVEWKNTLTNAVLNVPQVVR
A0A139SU05      ------------MTTLLQEQARLAERYLERHPRMIEVTNAIIITQEHLDLAVQGAIADLK
A0A1D8AZK8      ------------LAELQNQQSLLAERYLERHPKMISVANSIDVIAAQIQNDIAQSLSDLR
A0A1Q6UXG8      -------------NEAYLEYQKIAGSAGSQNPITVSLRDRMNSTRAAANKALSNYRSNLN
A0A2N8I9W1      -------------NEAYLEYQKIAGSAGSQNPITVSLRDRMNSTRAAANKALSNYRSNLN
A0A3R5SIG7      -------------NEAYLEYQKIAGSAGSQNPITVSLRDRMNSTRAAANKALSNYRSNLN
A0A2N8IBZ6      -------------NEAYLEYQKIAGSAGSQNPITVSLRDRMNSTRAAANKALSNYRSNLN
A0A2N8IJW9      -------------NEAYLEYQKIAGSAGSQNPITVSLRDRMNSTRAAANKALSHYRSNLN
R6J100          -------------NEAYLEYQKIAGSAGSQNPITVSLRDRMNSTRAAANKALSNYRSNLN
A0A139TV24      -------------NTAYLEYQKIAGSAGSQNPIVVSLTKKMDATRAAAFRSLSNLRDNLN
A0A2N8HT11      -------------NAAYLEYQKVAGSAGGQNPIVVTLTKRMDATRSAASRSLDNLRNNLE
R7DS70          -------------NAAYLEYQKVAGSAGGQNPIVVTLTKRMDATRSAASRSLDNLRNNLE
A0A2N8HNL6      -------------NAAYLEYQKVAGSAGGQNPIVVTLTKRMDATRSAASRSLDNLRNNLE
A0A1V5QB01      VQQRGWQEQRRVKSLLEARLAEYRTKFRDAHPLVQQTMRELKEVQDALNIELQFALRQYY
A0A139SPN4      ------------LSTLLQEQARLAERYLERHPRMIETTNAIITTQEHLDFAVQGAIADLH
A0A1V6E7N1      ------------IAELTRTQTVLGERYLERHPLMIELANKLRVAQEQLRTQVSLAIADLK
A0A2T6CWI7      ------------LSTLQQEQNILSERYYERHPRMIDVANRIDVTEKELAKAVQLAIDDLR
A0A2D9MYT1      ------------LALALAELASLRERYLEKHPKIIEKRSSIEALQESLKNAENRIFDSIM
A0A258ANJ7      ------------IASQKSALAVLAERYKPKHPKYEAVQVVIHNQEQQLTTILDDAFHLLQ
A0A139TLN4      -------------NDTLLKKTSLKVNAGDNNPIVRELEANLASLKDALKRSVNNYYTSLL
A0A1G3ZFT0      ---------------------------TKSHPSMINLKRRIAMLHEEKKELL--------
A0A1Z8ZMT6      -------------AVAEKAIQDLSIRYGLKHPKIISGTDQINLKTKILLSAMKDVLSS--
A0A2E8MCT7      -------------AVAEKAVQDLSIRYGPKHPKIISATDHIDLKTKILLSAMMDVLSN--
A0A290QGD9      ------------QAEQKVVVAQLSERYRAKHPRMIDATRMLSQIDAELAKATAEAASIVE
A0A1D8AS58      ------------VAAQKIVLAQMRERYRDKHPRMIEAHNSLTQTEKELGRAIDSMAATVE
I6AQC1          ------------IAMQTITIKQLRERYKEKHPKMIEASNALTQAQLELQKAVKIAAELVK
W0ITH7          ------------VAMQTITVKQLRERYKEKHPRMIEANNALTQAQLELQKALKIAAELTK
A0A290Q2Z2      -------------LIADQNVTKFRARLGAAHPELIGATDNRAKIKEQLDAQLRGYESALE
A0A2A2RGK2      ------------LNARQRDLTIVAQRYRSKHPTYVAIKTQIDLTKADLKRVLKDAVTLLA
A0A2A2XXF7      ------------LNARQRELTLISQRYRAKHPAYISVKTQIDLTKADLRRVLNDAVNLLE
A0A2A2R5D6      ------------YAAESDLEQMRKSGLEGNHPRIKSREAELAKIDEQINANAAGKRRALE
A0A1J4XH17      ------------LATKNIEISSLEKRYGAKHPKMIEATRAKEQTEIELKSALDSSINKVY
A0A3C1VJ32      -------------HEAQRKIAALKVDYSPANLDVTRVQTLIDTLDGQIIDRVAGIMVTLQ
A0A2N9NTX7      -------------TVADQRLVMVQKDYGPENDETKKARESVSDLKQKIKDRVDGIMLGLQ
B9XK55          -------------IGAETKLVTLLADYGDKHPEVLRTQKLVNELNAKIDDRVKGIMVGMD
A0A2E6T482      -------------HTGEQTVANQSIDLGEQHPRIKGLKKVVATLEGQIDDRIKGVLAGLE
A0A3C0DQZ7      -------------HTGEQTVANQSIDLGEQHPRIKGLKKVVATLEGQIDDRIKGVLAGLE
A0A1Z9CBK5      -------------QTGQTTLANKSIDLGEGHPTIKSLKAALESLDQQIDNRIKGILAGLE
A0A2D6ZI96      -------------QTGQTTLANKSIDLGEGHPTIKSLKAALESLDQQIDNRIKGILAGLE
A0A358KGZ3      -------------QTGQTTLANKSIDLGEGHPTIKSLKAAMESLNQQIDNRIKGILAGLE
A0A2E9ZQX4      -------------QTGQTTLANKSIDLGEGHPTIKSLKAAMESLNQQIDNRIKGILAGLE
A0A3D5JZU0      -------------QTGQTTLANKSIDLGEGHPTIKSLKAAMESLNQQIDNRIKGILAGLE
A0A2E6HCR0      -------------QTGQTTLANKSIDLGEGHPTIKSLRAALQSFDSQIQNRIQGILAGLE
A0A1Z8WN04      -------------QTGQNSLANKSIDLGEGHPTIKSLRAVLSTFEGQIQNRIKGILAGLE
A0A2D7L1N4      -------------QTGQNSLANKSIDLGEGHPTIKSLRAVLSTFEGQIQNRIKGILAGLE
A0A2E2R937      -------------QTGQNSLANKSIDLGEGHPTIKSLRAVLSTFEGQIQNRIKGILAGLE
A0A2D5MR66      -------------QTGQTTLANKSIDLGEGHPTIKSLRAALQSFEAQIENRIQGILAGLD
A0A2E0PDQ1      -------------QTGQTTLANKSIDLGDGHPTIKSLRAALQSFEAQIENRIQGILAGLE
A0A2E2ZZP9      -------------QTGQTTLANKSIDLGDGHPTIKSLRAALQSFEAQIENRIQGILAGLE
A0A2A2RGF2      -------------SAAEKEFVSKGKDLGPNHPDYVRMQALIVKLNQQVEDRVSGIMLNLE
A0A2G4I5Y6      -------------SAAEKEFVSKGKELGPNHPDYVRMQAVIVKLSQQVDDRVNGIMLSLE
A0A3M1I883      -------------DVVEQNLSKLLKDYTPENPEVQRYMALKDTLQKQITNRLNGILEGMR
A0A1V6JZ45      -------------SLAQQEVARLREDFSNDYPEMKRKLALVEQIDQQVEARLTGILTGLE
A0A356NPK0      -------------DRGHQQLSQMKAIHGPDHPQMQASNSLLLTLNDQIKKEITGVLRGLQ
A0A2D7B5P5      -------------DRGHQQLSQMKAIHGPDHPQMQASNSLLLTLNDQIKKEITGVLRGLQ
A0A3D3XGB5      -------------DRGHQQLSQMKAIHGPDHPQMQASNSLLLTLNDQIKKEITGVLRGLQ
A0A2V6F8A1      -------------ATTEANLAKLKETLGPQHPDFKGVAAMQAHLDEEINRRINGILGGLK
A0A2V5TNH4      -------------STTEANLAKLKETLGPENSDFKAMAAVQANLDTNINQRIEGMLAGLK
A0A2V5X5Q6      -------------STTEANLAKLNAGLGPRNPEFIAMAAMQANLDTNINQRINGILGGLK
A0A139TS01      ------------MEKDKERENLKAQNLGPKHPKMVALQETANILKEKLNKELVGLRSSLR
A0A2V5URB2      ------------VVQLESEHAKLAAQFLPGYPRLAQVKAQLQETRSKLAQQIRSVVEGIN
A0A2V2DJ66      ------------RSQYQVSVSTLEKRYKEKHPRMIEARKALDQVDKELAAALDSAYEKVR
R7L5A9          ------------RSTQQVFIASLEKRYKEKHPSMIEARKTLDQIEKELALAVDAAYAKVQ
A0A2V6JLK8      ------------QDTVAQEALLLNSGLGEDHPKVKSVRAARQVYTRQLEQQVGIIRQGLE
A0A2W5Z1A5      ------------QDAVAQEASLLNSGLGENHPKVKALRAQKQVFARQLQEQVGIVRSALE
A0A2V6EA09      ------------QEAVAQDAFFLNSGLGENHPKVKALRATKAVYAKQLEEQMASIRSALE
A0A2V6GQI7      ------------QETVAQDAFFLNSGLGENHPKVKALRATKAVYAKQLEEQMASIRSALE
A0A2A2XXW5      ------------VNDNSSKLAGLRTKYRERHPRVIQPATQLQADTQKLRDESERALQGIF
A0A3R5R2M8      -------------NEAWLEYRKIAGSAGSRNPIAAGLRDRMESTRAAANKALANYRNNLD
A0A411SUQ6      -------------NEAYLEYQKIAGSAGSQNPIAVSLRDRMNSTRAAANKALSNYRSNLD
A0A2N8HZF2      -------------NEAYLEYQKIAGSAGSQNPIAVSLRERMNSTRAAANKALSNYRSNLN
A0A354E720      -------------NEAYLEYQKIAGSAGSQNPITVSLKDRMNSTRAAANKALSNYRSNLD
B2UPB6          -------------NEAYLEYQKIAGSAGSQNPIAVSLRDRMNSTRAAANKALSNYRSNLD
A0A3C1HEJ2      ------------VLTQENAMDLVKRDLKPKHPDYIKAQTQLAAAQSQLTNAVLKVVGAYA
A0A1V6JU76      ------------LSGQENELAGLLKRYKDKHPAVIQARSKIEETHRSVQGAAQQVAEILR
A0A1Q6UHJ9      ------------KSSQQVFVASAEKRYKEKHPRMIEARKALDQINKELASAIESAEQKVQ
A0A2V2BXR0      ------------KSSQQVFVASAEKRYKEKHPRMIEARKALDQINKELASAIESAEQKVQ
A0A2D8V0G3      ------------LAAAEAELASLEVKYLEKWPAVIVAKEQIRKLTDEIQQQAGQELKILR
A0A348S017      ------------LVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQKVAQDEIDLLR
A0A3C1UUV7      ------------LVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQKVAQDEIDLLR
A0A350I3V2      ------------LVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQKVAQDEIDLLR
A0A3D3XF90      ------------LVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQKVAQDEIDLLR
A0A2D7B522      ------------LVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQKVAQDEIDLLR
A0A356NIC2      ------------LVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQKVAQDEIDLLR
R7DZW0          -------------NDTLLKRTSLKVNAGDNNPIIRELEANLNSLKDALKRSVNNYYTSLL
A0A2N8HID1      -------------NDTLLKRTSLKVNAGDNNPIIRELEANLNSLKDALKRSVNNYYTSLL
A0A2N8HS06      -------------NDTLLKRTSLKVNAGDNNPIIRELEANLNSLKDALKRSVNNYYTSLL
A0A3R8IT45      ------------VSMRKIEVKQLRDRYKDKHPKMIEANNALAQAELELKRAVDSAAASVI
A0A1H1MGC9      ------------VSAQKIVMSQLREHYRDKHPKMIEAVNSLAQTERELSRAIDSTAAMFE
A0A2A2PYE8      ------------LAERKIAIATLRERYRDKHPKMIEALNSFQQTERELKRAVENVSAQVE
A0A2T6CN73      ------------LAAQKVQLEQLGARYRAKFPKMIEAQNSYDQIKRELDRAIASACAQVE
A0A2N8HDG3      -------------NTAYLEYQKVAGSAGGQNPIVVTLTKKMDATRSAAARSLDNLRNNQK
A0A2U8DZK4      -------------LEAEQNVTKLSARLGEAHPEMIVARENLSKIKTQLEAQLTGYEFTLK
A0A1D8AWD4      -------------LISDQTVTRLMARLGAAHPDLIAAIDNSAKIQQQLDSQLRGYESSLE
A0A2T6DFL8      -------------LVADQKVTQLQGRLGEAHPDLIAAVDNRAKIKEQLDAQLRGYENSLE
A0A178IH18      -------------LVADQNVTRLRSRLGEAHPELITATDNRAKIREQLDAQLRGYENGLE
A0A2T6DT99      -------------LVADQNVAKLKTRLGEAHPELIAAMENRAKIREQLDGQLRGYENALE
A0A1G3ZT33      -------------LVADQTVARLKSRLGEAHPDLIAAVDNRAKISEQLDALLTGYEKSLE
A0A3E1E2T2      -------------LLADQNVTKLKARLGEAHPDLISAIDNRAKIKEQLDAQLRGYENALE
B1ZMW1          -------------LVADQNVTRLQSRLGEAHPDLIAAVDNRAKIREQLDGQLRGYESALE
A0A3D1TI55      ------------LVEAEIAYRAAEENYGPKHPEMVKFQTTIDELRRAKEQKLVAIKEGLA
A0A2G4G428      ------------ISDLRVAVRTMEEKYTDEHPTLIQARAQLKQTEAELQNAIVTSVNRIQ
A0A3E1ET42      ------------QKSVIEESRLLNSGFGKNHPKIRGLRESINTTRKTLETAVSGFKDSLK
A0A2A2YDW8      ------------QEQVRMLSGMQVQGLGPRHPNVLAQESTVDSLFKQLQASVVSFKDSLK
A0A352XLN9      ------------QEQVRMLSGMQVQGLGPRHPNVLAQESTVDSLFKQLQASVVSFKDSLK
A0A3D0YP62      ------------EDAKAELQTAKASGLGNKHPDIVMRTTRIEELKKGLEKRAVNVRQSLT
A0A3D3DV47      ------------EDAKAELQTAKASGLGNKHPDIVMRTTRIEELKKGLEKRAVNVRQSLT
A0A2A2QX62      ------------QSAKREYDSAMSSGLGERHPKMVSLATNLVAMEKQLDEAVANLRETLK
A0A3N5WCF1      ------------QEAKRQLDGLKISGLGDRHPTILVAVDQIENMKRQLDEGVVNLRATLQ
A0A2E5XJ49      ------------MAGKRSIATMEASGLGRKHPNIRMALIAQDKLEEDLRSAVVTLKDLLR
A0A2E6SBY8      ------------MAGKRSIATMEASGLGRKHPNIRMALIAQDKLEEDLRAAVVTLKDLLR
A0A2E5QMS4      ------------QESKLNMAAMEASGLGRKHPSMEMSLIAQNKMQEDLGGAVVVLRELLK
A0A2E7YXQ3      ------------QESKLNMAAMEASGLGRKHPSMEMSLIAQNKMQEDLGGAVVVLRELLK
A0A2E3H787      ------------QESKVNIAAXEASGLGRKHPQVEMGLIAQAKIEEDLKAAVVVLRELLK
A0A2E7AGN1      ------------QESKVNIAALQASGLGRKHPSVEMALIAQEKLQEDLKASVVVLRELLK
A0A2E7AKY7      ------------QESKVNIAALQASGLGRKHPSVEMALIAQEKLQEDLKASVVVLRELLK
A0A3D4CU34      ------------QESKVNIAALQASGLGRKHPSVEMALIAQEKLQEDLKASVVVLRELLK
A0A2E8M146      ------------QESRVNIAALEASGLGRKHPSVEMAYIAQSKLQEDLKSSVVVLRELLK
A0A355S8S2      ------------QESRVNIAALEASGLGRKHPSVEMAYIAQSKLQEDLKSSVVVLRELLK
A0A2D6DVN8      ------------QEGKVNIAALEASGLGRKHPSVEMAYIAQEKLSEDLKSSVVVLRELLK
A0A3C1W2R2      ------------QEGKVNIAALEASGLGRKHPSVEMAYIAQEKLSEDLKSSVVVLRELLK
A0A2E3NAY6      ------------QESKVNIAALEASGXGRKHPSVEMAYIAQEKLKEDLKSSVVVLREXLX
A0A2E3II01      ------------QESKVNIAALEASGLGRKHPSVEMAYISQKKLSEDLKSSVVVLRELLK
A0A368B8C5      ------------QESKVNIAALEASGLGRKHPSVEMAYISQEKLSEDLKSSVVVLRELLK
A0A3R7RBB5      ------------QESKVNIAALEASGLGRKHPSVEMAYISQEKLSEDLKSSVVVLRELLK
B4DB23          ------------QDAAAEHARLTNLGLGVNHPRIKALDAQMATYQKILGDQLNTIKITQA
A0A139TUL1      -------------NDNFLQYKKLSASAGKQNPMVSSLAENMKEMRESIVRSISNYCDVLR
A0A2N8HCB0      -------------NDNFLQHKKLFASAGRQNPMVSSLAENMKEMRESIGRSIANYCNALE
A0A2N8HP04      -------------NDNFLQHKKLFASAGRQNPMVSSLAENMKEMRESIGRSIANYCNALE
A0A2N8HRJ0      -------------NDNFLQHKKLFASAGRQNPMVSSLAENMKEMRESIGRSIANYCNALE
A0A366HAG0      ------------QELLLKQQSLATAGLGRKHPTMRGIAGSLEQTRALLLEAAQDYRKNLG
A0A3M1I8A3      ------------LTGYRTDLGAMLQRYGEKHPAVVTLRSQIAETEKELQQTVKDVIETLR
A0A0R2XQ77      ------------ISGVKIGISSSSKRYREKHPVMIEQLQILQESEVELVTAVKDSINKLS
A0A2E9IN28      ------------ISGTRISISSLSKRYREKHPAMIQLLQTLQESEQELAIAVKNSVDKIY
D5ENH7          ------------ISATKIEIASLSKRYREKHPMMIQQLQTLQESEVELGEAVQNSVDKVY
A0A351WE84      ----------------EVALKLMLENMGVNHPDVKRLQAGVDELKKKLNESLVGLKIGLN
A0A146GCJ0      ------------LLNAEGDLAGLKERYLPKHPKYIAASMRIANLRQSLATEATQASETLS
A0A2T6D6H8      ------------LVSAEAELAALKDRYLPKHPKYIAGVTRIANLKQALDSEVKQAGETLS
A0A1V5QDZ6      ----------------EVTLKLMLENYGAKHPEVLRVQAGVDELRKKLENALNGMKTGLR
A0A3D4HF88      ------------LSELKVSQSSAAKRYREGHPRMISINQSIDETQSELTAAVNSAVQKVH
A0A351MR11      ------------VSELQVTIETLEKKYTESHPTLRISREQLDVTKRELKTAIEMSVNRLA
A0A1V6J089      ------------DSQVSLQLMLKNGVVGENHPDVLRLRGAQDELRRQLDSALAGLKAGVK
A0A3C1BZR1      ------------DSQVSLQLMLKNGVMGENHPDVLRLKGAVEELRRQLASALEGLKAGIK
A0A1H6KPB7      ------------QTEESTLSKMHMDGYGEKHPALLSMVQEHENTKQKLTEGLVGLKDALE
A0A2E9ISN4      NTGIQWQETQVRLDELQNEYKQLAAVFKDTHPRMIDLKGEITKAQSSLAHQNELALKRFE
B9XAX1          -----------------AQVATLLLRYKPNYPKMLQAQRQLDDLKDALRSLASKAPKLVQ
I0JYY7          ------------LLKEQAKYRELEDIYKEEYPKMSRLRTEIEGLNKEISEEKEATIEKLE
A0A3E1EJT7      ------------VTTQKLSVTQLRDRYKDKHPRLIEAVNALNQTEQELQASLATAAESIK
A0A317ZP96      ------------ISGARISISSLSKRYREKHPVMIQQIQTLQEAEMELESAVKNAVDKIY
A0A2D5WGA5      -------------HTGQQTLANQSIDLGEQHPRIKGLKKVVSTLEGQIDDRIQGVLAGLE
A0A2E7SSH2      -------------QTGQTTLANKSIDLGEGHPTIKSLKAALDSLNQQIDNRISGILAGLE
A0A349GXM8      ------QNLRVRLMRLEADQAELLKVLKDDHPRLKAVRDEIKSIQDQLASMAEVQMRNLR
B3DZK9          ------------LLKEQAKYRELEEIYKEDYPKMVRLKAGIDGLNQQLAEEKQAVVEKLE
A0A2A2XV69      ------------QEVASEEARLLNSGLGVNHPTVKSMRAKKEVMATQLVTQIASLRASME
A0A3C1VB86      ------------LARLENDFAVIRQRYREAHPKYILAASSLAGLKGQLAANALKARARIQ
A0A146G2Q9      ------------QEAASEEARMLNAGLGANHPNVKALRAKKEVMQRQLAEQTAILRKTLE
A0A2T6D3Y2      ------------QEAASEEARMLNAGLGVNHPNVKSLRAKKEVMQRQLAEQTAILRKTLE
A0A2V2SDV4      ------------RNMLQQRFIALTNILGERHADVVTVQSQLDDLNAKIAAKATGILQGVQ
A0A2V5PK75      ------------KNMTEQALVIRQKEYGDKHVEVIKLQRQLDDLQDKIAKRVEGIITSLE
A0A1V6DME1      ------------LNLVEQERIRLARDLTDDHPAVVTVTRQIKDIETKIAQRADGIIRGLE
A0A3D3DIJ3      ------------LTMAEQRLIALEADYGPENTEVLKCKGLAEDLHKKIKSRVEGIMLGLD
A0A2D5VY59      -------------DTTRQALARLSAIHGPEHPERKSLYTLLEEIETQVTSEITGVLRGLQ
A0A2D8UZZ4      -------------DTTRQALARLSAIHGPEHPERKSLYTLLEEIETQVTSEITGVLRGLQ
A0A353DV86      -------------DTTRQALARLSAIHGPEHPERKSLYTLLEEIETQVTSEITGVLRGLQ
A0A2E5EPT8      -------------ATAQQELVAKGKELGPKNPEIERMTKVILEIQLQIEGRVKGIMSGLE
A0A350EWA4      LIVNFAGMFQSEADAERQLAGLLGQ-FGRDHPTVMSAQAELDKARETIKSRVEAMLIGQK
A0A2N8HD92      ------------SEKLKEKENLKAQNIGPKHPKMLALVETERILSDKLNKELIGLRSSLK
A0A2N8HIT2      ------------SDKLKEKENLKAQNIGARHPKMLALLETERILGEKLNKELIGLRSSLK
A0A354EBD3      ------------SDKLKEKENLKSQNIGPKHPKMLALLETERILGDKLNKELIGLRSSLK
A0A355VEB2      ------------SDKLKEKENLKSQNIGPKHPKMLALLETERILGDKLNKELIGLRSSLK
A0A2N8IMT3      ------------SDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLK
R6K1U5          ------------SDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLK
A0A2N8IWC2      ------------SDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLK
A0A2N8I441      ------------SDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLK
A0A1Q6UTU9      ------------SDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLK
A0A2N8I3A6      ------------SDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLK
A0A410SCC4      ------------SDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLK
A0A3R5VEW0      ------------SDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLK
A0A411SSG2      ------------SDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLK
B2UKW3          ------------SDKLKEKENLKSQNIGARHPKMLALLETERILGDKLNKELIGLRSSLK
A0A1M6RLZ4      ------------LDASRERGSLIAAGLGANHPRVKMSRTRVEALRKQLDEKVTEVRDVLK
A0A354T7G8      ------------NKLIVQREGLMNAGMGRRHPNVESLSSQIDKLKTFIEAEARAHVQGLQ
A0A2S7U4L6      ------------QDAKRERAGVIAQGLGENHPQVKHHDSQISILRETLDAKVRRVRDLLK
A0A2E8MEZ0      ------------RAADEQVSAMIASGLGPNHPEVKAMRLRADGALENAGKEVMSLKEVLE
A0A2E3EC33      ------------QALELSRAALVESGVGNKHPKIINIDSQLALRMKQLLDAVDVHKKALE
A0A2E4GN01      ------------QTLELSRAALVESGVGKKHPKILNIDKQLKLRMMQLLDAVEVHKKALQ
A0A1Z8XU55      ------------QSLELNRAALVDSGVGIKHPKILNIDSQLNLRMKQLLGAVETHKKALS
A0A2E1RQR9      ------------QSLELXRAALVDSGVGXKHPKILNXXSQLNLRMKQLLGAVETHKKALS
A0A2E3ISQ4      ------------QTLELSRAALIDSGVGVKHPKIVNIDSQLKLRMNQLLDAVETHKKALT
A0A2D6W6F4      ------------QTLELSRAALIDSGVGVKHPKIVNIDSQLNLRMNQLLDAVETHKKALT
A0A2D8Z5A8      ------------QTLELSRAAXIDSGVGVKHPKIVNIDSQLNLRMNQLLDAVETHKKALT
                                                                            

A0A2A2XVF1      RQYEAACQTE----SKLTVALKEQE-VAALDLNKMAIPFNV--LQREVESDRVLYESVIK
A0A2V5UHJ2      AGFAAARNKE----SELRVAMEDQK-KATLNLKDSAVQYAI--LAREVDTNKQLYDGVLQ
A0A2V5PST3      ENYVAARAKE----QALEVETGKQQ-QAALNLKEVGVQYAV--LQEEVNVNKNLYDSILK
A0A2V5PXM3      SLYESARTAE----AALETALREQE-SAALELSSQALHYSS--LSREVDSDRALYEAVLN
A0A139SU05      TSLIEVKKTI----AQLENEYAENE-KEALSLRNMRVDFES--LQNEAAVARANYMQILD
A0A1D8AZK8      TQYTKVKETE----ASYQKEYKEAE-MGQLRLGELSVEFKS--LENQATVAKNNYIEILN
A0A1Q6UXG8      LKLNQLISKR----DSLTERLTETA--------SREQEIIP--LVREHKVKEELYLMLLS
A0A2N8I9W1      LKLNQLISKR----DSLTERLTETA--------SREQEIIP--LIREHKVKEELYLMLLS
A0A3R5SIG7      LKLNQLISKR----DSLTERLTETA--------SREQEIIP--LIREHKVKEELYLMLLS
A0A2N8IBZ6      LKLNQLISKR----DSLTERLTETA--------SREQEIIP--LVREHKVKEELYLMLLS
A0A2N8IJW9      LKLNQLISKR----DSLTERLTETA--------SREQEIIP--LVREHKVKEELYLMLLS
R6J100          LKLNQLISKR----DSLTERLTETA--------SREQEIIP--LVREHKVKEELYLMLLS
A0A139TV24      LRLQELTRKR----EDITRRLAATS--------GKARKLTP--LNREHGVKEEYYLTLLT
A0A2N8HT11      LKLQELTRKR----QDIAKRLTATS--------GKARELTP--LDREHRVKEELYLTLLS
R7DS70          LKLQELTRKR----QDIAKRLTATS--------GKARELTP--LDREHRVKEELYLTLLS
A0A2N8HNL6      LKLQELTRKR----QDIAKRLTATS--------GKARELTP--LDREHRVKEELYLTLLS
A0A1V5QB01      AQLEALSIR-----EQASKRVEQEWEEEALEVSRKQQEYQN--IQRNFGRLQSLYDLAFN
A0A139SPN4      ASLTEVNKTI----SQLETEYTAAE-QEALNLRNMRVDFES--LQNEALVARSNYMQILD
A0A1V6E7N1      SRLAKTADSE----RTFEQEKQLQE-TEFFKLRDLRGEYNS--LKNQADVAQKNYIDILD
A0A2T6CWI7      ARQAEARQAY----ESFSAEFAQRE-KDAMRLGELRVEFNS--LVQQSQVARENYQNIFK
A0A2D9MYT1      NKAKLAKATD----VQLAGVLTIRK-SEQQSMNQKSIEYNN--LSRTATQSETMYNLALQ
A0A258ANJ7      SSWEHARELE----HRLQEQLKKQE-SEALDLEQLAVQYNV--LKREMESDQAVYESVLT
A0A139TLN4      VKKKNVEEQH----EGTRAHIRAVS--------GKERAVNQ--IAREQRVRESLYIFLLN
A0A1G3ZFT0      --------------------------NEVKKLPLMDQMMLN--LLRDVKMKNALNTILLS
A0A1Z8ZMT6      ---DLETDYW----RGFQDQIDDIENEENFKDLRNAMKLRASLLTNSVETKNELYNTLLS
A0A2E8MCT7      ---DLETDYW----RGFQDQIDDIKNEENFRELRNAMKLRASLLTNSVETKNELYNTLLS
A0A290QGD9      GDYQSALRNA----DEARSGLVEQE-TQSLGIDRAGVEYES--LDRELKIEEQVLQHLMG
A0A1D8AS58      ADFQTARRND----EDARANLARQE-KESLDLDRDAVEYSN--LERDLAINEHLLNTLLS
I6AQC1          SEYEAALNSN----KEARAILAQIE-KESFEIDKAAVDYQM--IERDFLVNSSILDNTIK
W0ITH7          SEYQTAFNAD----KEARGALAQIE-RDSLNMDKIGVDYQM--LEQDFLINREILDRTIG
A0A290Q2Z2      IAYKEADARV----AELKNQLAQAKVDQILSARDRMRPFEE--AARKLEDETRLLSTLKV
A0A2A2RGK2      NSRNRLEVQS----TEMKTAREAAE-KRLLEVTHKSIEYND--IKREQETDQALYNSVIS
A0A2A2XXF7      SARNRLEVQA----NETKIAREKAE-GRLIEVTAKSIEYND--IKREQETDQALYNSVLS
A0A2A2R5D6      IDVQVTKARV----TQLEKEVGVLTDQVRMQKTTELAKFRE--AKKEQDRQQLLYDQFVI
A0A1J4XH17      ANYDHARDFL----IQSEKRLAQKE-KGIINLSKIKVEYST--LSRDFEVNQGLYQSMVL
A0A3C1VJ32      SQVNSKKASL----DSLVQQVEEAK-QKDHDNATKNQPYYD--EKRKLDQLLDSHKLLYT
A0A2N9NTX7      AKVASVRESL----DQMKKEVDEAT-KTDISKASESAPYWK--AKRELEEQEHFRAILDL
B9XK55          ARVASLLAVV----KNSEDKVNEAK-SNDLVLAESSRPYFI--EKSQLDHLKKFREILEF
A0A2E6T482      LRVKSSKAQV----EELQRDVDEAK-QRESDMREKGREYFD--AKRELANTTRIRDTILL
A0A3C0DQZ7      LRVKSSKAQV----EELQRDVDEAK-QRESDMREKGREYFD--AKRELANTTRIRDTILL
A0A1Z9CBK5      LRVQSSLAQV----XELQKAVDDAK-AKEAKVQEEGREYFD--AKRKLSNTTRMRDTILF
A0A2D6ZI96      LRVQSSLAQV----XELQKAVDDAK-AKEAKVQEEGREYFD--AKRKLSNTTRMRDTILF
A0A358KGZ3      LRVNSSLAQV----RELQKSVDDAK-AKEAKVQEEGREYFD--AKRKLSNTTRMRDTILF
A0A2E9ZQX4      LRVNSSLAQV----RELQKSVDDAK-AKEAKVQEEGREYFD--AKRKLSNTTRMRDTILF
A0A3D5JZU0      LRVNSSLAQV----RELQKSVDDAK-AKEAKVQEEGREYFD--AKRKLSNTTRMRDTILF
A0A2E6HCR0      LRVSSSLAQV----NELQMAVDDAK-SKEAKVQEEGREYFD--AKRRLSNTTRMRDTILF
A0A1Z8WN04      LRVKSSLAQV----NELQKAVDSAK-SKEAKVQEEGREYFD--AKRKLSNTTRMRDTILF
A0A2D7L1N4      LRVKSSLAQV----NELQKAVDSAK-SKEAKVQEEGREYFD--AKRKLSNTTRMRDTILF
A0A2E2R937      LRVKSSLAQV----NELQKAVDSAK-SKEAKVQEEGREYFD--AKRKLSNTTRMRDTILF
A0A2D5MR66      LRVKSSLAQV----KELQKAVDNAK-SKEAKIQEEGREYFD--AKRKLSNTTRMRDTILF
A0A2E0PDQ1      LRVKSSLAQV----NELQKAVDNAK-TKEAKIQEEGREYFD--AKRKLSNTTRMRDTILF
A0A2E2ZZP9      LRVKSSLAQV----NELQKAVDNAK-TKEAKIQEEGREYFD--AKRKLSNTTRMRDTILF
A0A2A2RGF2      TDLKAQAAAL----ALTETKLEEAK-VRNRTAAEKNRTYQM--ALTDLEDLKRLRATMNA
A0A2G4I5Y6      TDLKAQAAAL----ELTETKLEEAK-VRNRTAAEKNRTYQM--ARDDLDDLKRLRATMNA
A0A3M1I883      AQVASFKARY----DEISNQVAQAE-RAVAEEAARFSQYFD--LKRQWENEQRIRDTLLL
A0A1V6JZ45      NQVISLKARR----DELQKAVDDGK-KLVVEEAKRSREYWS--SKRELENKQKIRDAILM
A0A356NPK0      TQVNAARNQL----TELTSAVESAK-ASDAEKTAEYRPYFT--AKRDLENLSKISDMIMI
A0A2D7B5P5      TQVNAARNQL----TELTSAVESAK-ASDAEKTAEYRPYFT--AKRDLENLSKISDMIMI
A0A3D3XGB5      TQVNAARNQL----TELTSAVESAK-ASDAEKTAEYRPYFT--AKRDLENLSKISDMIMI
A0A2V6F8A1      VRVDAFKANL----DTLAKSVDDAR-KKDADMTEKYRPYFE--AKRRLDNLQKLRDAVHL
A0A2V5TNH4      LKVDAFRLHL----DSLAGAVDHAR-TNDAFMTEQYRPYFK--AKRRLDDLTKLRDAVHL
A0A2V5X5Q6      LKVDAFKLNL----DTLASAVDHAR-TNDAFMTEQYRPYFK--AKRKLDDLQKLRDAVHL
A0A139TS01      SKLEMVTASR----VKWAKIVAQKE-EDLRKHVMKMPVYEQ--TSREYDTALDQLKTLDA
A0A2V5URB2      SAYLAAAGKE----RALKLQMDKQK-SDALALKDASVEYAI--LARETNTNSQLYDGVLE
A0A2V2DJ66      STYLTMKNNY----EMSQQRLNKKR-EEILQLGRKAIVYKA--LERERKVAEGMHAEFIA
R7L5A9          ASYETARQNY----EQSQKRLAEKK-EEILSLGKKAIIYKS--LERERMVAEGMHASLIS
A0A2V6JLK8      RNLKTAQGTR----DELRKRLEQIN-AKQLQTKNLSANYAR--AKNAYIKEKTLFDGVRT
A0A2W5Z1A5      KNLKTAEKTR----DELRARLNEIN-EKQLSTKNLSANYTR--AKNNYIKEKLLLDSVRQ
A0A2V6EA09      KNLKTAQTTR----ERMDKRLAEIN-TRQLATKTLSANYVR--AKNAYIKERLLLDGIRM
A0A2V6GQI7      KNLKTAQTTR----ERMDKRLSEIN-TRQLATKTLSANYVR--AKNAYIKERLLLDGIRM
A0A2A2XXW5      QMAELEKSRE----VEALRKYTESV-ERVFALDEAKISYDI--MEQQLKRVEGFYQTILT
A0A3R5R2M8      IKLKELNAKR----DSLAERMARTA--------TREQELTP--LVREHKVKEELYLILLS
A0A411SUQ6      LKLNQLINKR----NSLTERLTETA--------IKEQEIIP--LIREHKVKEELYLMLLS
A0A2N8HZF2      LKLNQLISKR----NSLTERLTETA--------IREQEIIP--LVREHKVKEELYLMLLS
A0A354E720      LKLNQLIDKR----NSLTERLTETA--------IKEQEIIP--LIREHKVKEELYLMLLS
B2UPB6          LKLNQLINKR----NSLTERLTETA--------IKEQEIIP--LIREHKVKEELYLMLLS
A0A3C1HEJ2      TKLSAAKAEE----QELKAGLSGLE-SRRRDLDAAAGEYGI--IQNKLKFNRELYERIVK
A0A1V6JU76      SEARLAKASE----QILAANVKEWE-DQQMEWNKAKMQYDV--LMRKAQSSKALFDTVLA
A0A1Q6UHJ9      AAYEAARQNY----EQSQKRLLEKK-EQILDLGRKAIVYKS--IEREKQVAEGMHAAFIA
A0A2V2BXR0      AAYEAARQNY----EQSQKRLLEKK-EQILDLGRKAIVYKS--IEREKQVAEGMHAAFIA
A0A2D8V0G3      EQARFANERA----DRARVTYDEAQ-VAMNRLNELKVEYDN--LVMEKEQSEQLYTAMLA
A0A348S017      EQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLA
A0A3C1UUV7      EQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLA
A0A350I3V2      EQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLA
A0A3D3XF90      EQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLA
A0A2D7B522      EQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLA
A0A356NIC2      EQARYQQARA----VRALDSLNARQ-ADMNRLNQLKVEYDN--LVMQKMQSEELYTSMLA
R7DZW0          VKKKNVQDQH----EQTREHIRNVS--------SRERAVNH--IEREQRVRESLYVLLLN
A0A2N8HID1      VKKKNVQDQH----EQTREHIRNVS--------SRERAVNH--IEREQRVRESLYVLLLN
A0A2N8HS06      VKKKNVQDQH----EQTREHIRNVS--------SRERAVNH--IEREQRVRESLYVLLLN
A0A3R8IT45      SEYETAKNAD----TEARAILEQIK-TESLSTDKEGVAYQM--LERDFMMNEQLFLKTVE
A0A1H1MGC9      ADFQTAKRND----EEARANLVRQE-SESLELDRYAVEYSN--LVRDYDINEHLLNSILG
A0A2A2PYE8      SDFQAASRTF----KNLEEDLAKRT-EDSLQLDRAALEYND--REREYRTNEKILDAIVA
A0A2T6CN73      SDYQSALNTY----RQNQEELKRRT-QDSLAVDHAALDYEN--MQRELKIQEDILTTITA
A0A2N8HDG3      LQLQELTKKR----ENIGKRLTATS--------GKARELTP--LDREHRVKEELYLTLLS
A0A2U8DZK4      SKAEEAEARV----TELKKQLEEAKASQIENASKRMRPFEE--AMQKLDEATRLYTTFKL
A0A1D8AWD4      MAFKEAEARV----TELERQLAQAKVDQILSARERMRPFEE--ATGKLDDEQRLLTTLKL
A0A2T6DFL8      IAYKEAEARV----AELKSQLAQAKVDQILSARDRMRPFEE--AAQKLEDETRLLTTLKL
A0A178IH18      ISCKEAEARV----AELEKQLEEARARQITSSTDRMRPFEE--AVRKLDDETRLLSTVKL
A0A2T6DT99      IAYKEADARV----AELKNQLGQAKVDQILSARERMRPFEE--ALQKLEDDTRLLSTTKL
A0A1G3ZT33      ISCKEAEARV----TELESQLAQARVDQILSARERMRPFEE--AATRLDDEARLLTTLKL
A0A3E1E2T2      IAYKEAEARV----TELKRQLSQAKVDQILSARDRMRPFEE--AAQKLEDETKLLTTLKL
B1ZMW1          IAYQEADSRV----AELKNQLAQAKVAQILSARERMRPFEE--AAQKLEDETRLLTTLKL
A0A3D1TI55      SRYDVAQRRV----ENLEQEMDLLRNQDLERHREAFLPFER--ALRDRDAAKQVLTALEH
A0A2G4G428      VAIQNAHANY----AAIISNLDKKD-DEIARLTVANNELER--VDKEIKSQEDFLSRQKQ
A0A3E1ET42      VQISQAEQTL----AKGQELTDTKK-LSTVEDRAKQSEYAT--EKTKFEMQRQLLQQVKE
A0A2A2YDW8      IKRETKNVEL----VELNNRLVEVK-DMSKENIIAMTQIQN--VHDEFTTQQKLLDEMKQ
A0A352XLN9      IKRETKNVEL----VELNNRLVEVK-DMSKENIIAMTQIQN--VHDEFTTQQKLLDEMKQ
A0A3D0YP62      HKLGIIEGRV----NKMREVRDKKQ-DEGTDRARAFQEFNI--ARKDYETAQGIKDQMQI
A0A3D3DV47      HQLGIIEGRV----NKMREVRDKKQ-DEGTDRARAFQEFNI--ARKDYETAQGIKDQMQI
A0A2A2QX62      VKLELSKEQL----ARLKSRKESTN-EDAIGKGIANQTFID--AKNEFESALRLLETLQA
A0A3N5WCF1      AQLDLAVNRL----KSVEVMKDESR-DEAIKRGLDAQDYVD--AKREFETDQQLLETMKL
A0A2E5XJ49      TQLELVDGQL----EKLRQVVEESR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKI
A0A2E6SBY8      TQLELVDGQL----ENLRKVVEESR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKI
A0A2E5QMS4      TQLRLVNGQL----AKIKERVEERR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A2E7YXQ3      TQLRLVNGQL----AKIKERVEERR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A2E3H787      TQLSLVXGXL----EKIKDRVEDRR-FDAVXKAXQSQDYVE--AKQDYETAKAMLSQMKL
A0A2E7AGN1      TQLDLVNGQL----VKIKDRVEDRR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A2E7AKY7      TQLDLVNGQL----VKIKDRVEDRR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A3D4CU34      TQLDLVNGQL----VKIKDRVEDRR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A2E8M146      TQLSLVNGQL----VKIKDRVEDRR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A355S8S2      TQLSLVNGQL----VKIKDRVEDRR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A2D6DVN8      TQLNLVNGQL----DKIKDRVEDRR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A3C1W2R2      TQLNLVNGQL----DKIKDRVEDRR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A2E3NAY6      TQLNLVDGQL----EKIKDRVEDRR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A2E3II01      TQLNLVNGQL----EKIKDRVEDRR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A368B8C5      TQLNLVDGQL----EKIKDRVEDRR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
A0A3R7RBB5      TQLNLVDGQL----EKIKDRVEDRR-FDAVDKALQSQDYVE--AKQDYETAKAMLSQMKL
B4DB23          NRLRLEKDKL----SGLQEMSKASR-TDDIKEKASLVEYVD--AKNKYIQARKLYESVEL
A0A139TUL1      VRMGELERER----DELNRGLSDMA--------SKDEGLVP--LLREQKVMEELYLMLLK
A0A2N8HCB0      VRMSELEKER----DELNRLLSDMA--------SKDEGLVP--LLREQKVMEELYLMLLK
A0A2N8HP04      VRMGELEKER----NELNRLLSDMA--------SKDEGLVP--LLREQKVMEELYLMLLK
A0A2N8HRJ0      VRMGELEKER----NELNRLLSDMA--------SKDEGLVP--LLREQKVMEELYLMLLK
A0A366HAG0      VRITTVERQL----EEAEKHNKDTR-AKSLDSQAGHHEYLA--AKREWETLQQDTAKLKD
A0A3M1I8A3      KSAELRQIEL----ANLEENLRYWE-QKQQEWNKAKTTYDV--LQRKADASRALFNMVLS
A0A0R2XQ77      SAFAESKNNF----ELASQRLAEKE-AELIELSKTRVEYSS--LEREMDVQQGFLQALVG
A0A2E9IN28      ASYSEAKSNF----ELASQRLAEKE-QELIDLSKTRIEYNS--LLRDLSVQQNFFQALNS
D5ENH7          ASYIEAKSNF----ELASQRLAEKE-SELIGLSKVRVEYNS--LLRELEVQQSFFQALNS
A0A351WE84      ADYEVAKAKF----DALEAELQAAKHSDIEDEKKKFLPFDR--AERNVIIQRDILNALRA
A0A146GCJ0      RLYEAAKDSE----VKLEAALQEQE-AKALELNKVAIPYNV--LQRDVESDRALYESVTK
A0A2T6D6H8      RLYEASRESE----MKLETALQEQE-ERALELDKVAIPYNV--LQRDVESDRALYESVTK
A0A1V5QDZ6      ANYEVALQRY----EVLEKELEATRASDIDSERDRFLPFDK--AEREVLVQRQILDALRA
A0A3D4HF88      AAYVISDTNY----NHAKAEISRKE-KDLIGLAKTKVEFNA--IKTDLEANRDLHRAMVL
A0A351MR11      GLRSSSQQRL----IAAERSLSGKE-AEIARLQGANIELER--IEKEIRLGEDFLNRLKL
A0A1V6J089      ADYEVARQKY----EALDSELASIKATDIESESENYLPFDR--AERNVAVNRDILTALRA
A0A3C1BZR1      ADYEVARQKY----EALDEELSLIKTSDIESEGENYLPFDR--AERNVSVNRDILTALRA
A0A1H6KPB7      QTLSLKEEGR----KSIKRAFDEVT-EIVRNKTQSDILVMS--AIRDYRTEKSRYEDLEN
A0A2E9ISN4      AHYEALKLQE----AGIESVLNNWR-SEQFLSVANQSEYKQ--LSSKVAHFERKYNLVYG
B9XAX1          SAYDGALARE----NNLEAALKEVQ-MESLDLDRKGIEYNV--LMREVQSDLALYDSVLK
I0JYY7          ADYEAAKRHY----ESLEEEWKEAM-VKVKKEGRLLSQYAL--LKREADTDREMYTGLLK
A0A3E1EJT7      AEYENAVQTD----EGARKALADQE-TKSLEIDKYAVEYDN--LNRDFRVNEQLLESMMS
A0A317ZP96      AGYIEAQKNY----EIATKRLVEKE-KELIELSRTRVEYNS--LLRDLEVEQNFYQALNS
A0A2D5WGA5      LRVKSSKAQV----EQLQRDVEEAK-RRESDVREKGREYFD--AKRELANTTRIRDTILF
A0A2E7SSH2      LRVNSSLAQV----QELQKSVDDAK-AKEAKVQEEGREYFD--AKRKLSNTTRMRDTILF
A0A349GXM8      DRHRALSIQL----NAIETAEYKWQ-AKNLTASQRQAEYSR--LRSEVGRLAAHYNTLYT
B3DZK9          AEYEAAKKNF----ESLEEEWKKTL-LKLKDENSLLAKYAM--LKREADANQQMYMGLLK
A0A2A2XV69      ANIRIGEDSI----TQLEQRLRESQ-AKQQTSKTRASGYYE--AKNNYIQAKKILEAAEM
A0A3C1VB86      ESLRIAYQNVLTAKQGLETQMHEVE-TNAMKLSDSAVRFNV--LTRELRSDQALFDSVIG
A0A146G2Q9      TNLAIAEQGL----KSLQDKLDKVR-SDWQTSKTSSIGYYE--AKNNWLQARKVLEAAQT
A0A2T6D3Y2      TNLTIAEQGL----TSLQEKLTKVR-ADWQTSKTSSIGYYE--AKNNWLQARKVLEAAQT
A0A2V2SDV4      TRVAAVKDSL----AKLEHEVDQAM-TNDLVKAVQSQPYFE--AKRKVEEAETKLKLLTM
A0A2V5PK75      ARVAAVQTNL----ALLQAQVDKAT-ANDIGNSKRWRPYFD--KKRELDEQQRFRQILTM
A0A1V6DME1      KRVASMKAYL----DSLTRNVEEAM-RVDIEKAEKSRPYFE--AKQRLEEVMRFRSILNL
A0A3D3DIJ3      TRVISLSNSL----VNLQQEVGRAT-TNDVTQANLTRPYFE--AKRALEELQRFRQVLDA
A0A2D5VY59      SQVNAAQNEL----NELTAAVENAK-ANDALKTAKYRPYFT--AKRDLENLSKISDMIMI
A0A2D8UZZ4      SQVNAAQNEL----NELTAAVENAK-ANDALKTAKYRPYFT--AKRDLENLSKISDMIMI
A0A353DV86      SQVNAAQNEL----NELTAAVENAK-ANDALKTAKYRPYFT--AKRDLENLSKISDMIMI
A0A2E5EPT8      AEAKALQSGY----DNRMTQLDKAR-EQNRTAAENGQRYMD--VQKKLERLERIRDTIEL
A0A350EWA4      NDALALSNNL----VELERTIAAKE-AEFRQKSSNIMPYIS--AKEEYLRRRNVRDSVAM
A0A2N8HD92      SKLEMVSASR----KHWEETVALKE-KALQDHVLKVPMYEQ--ASRDYDAALDQLKDLSS
A0A2N8HIT2      SKLEMVSASR----KHWEATVAQKE-EALQKHVLQVPMYEQ--ASRDYDAALDQLKDLDS
A0A354EBD3      SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
A0A355VEB2      SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
A0A2N8IMT3      SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
R6K1U5          SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
A0A2N8IWC2      SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
A0A2N8I441      SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
A0A1Q6UTU9      SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
A0A2N8I3A6      SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
A0A410SCC4      SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
A0A3R5VEW0      SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
A0A411SSG2      SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
B2UKW3          SKLEMVAASR----KHWEATVAQKE-EDLQKHVLQVPMYEQ--ASRDYDAALDQLKELDS
A0A1M6RLZ4      DKLDLENQRV----QRLSKSKDSAK-GERLATAYDYTLFNA--LVQEYEQARAVLSQIKI
A0A354T7G8      NRLDGAKRKR----DSFQTYNDDAK-KELQDMQSLYNEYKT--AKDEVTYLEDLLVKMRS
A0A2S7U4L6      VLLEQAGAKI----ARLQISKDASQ-SDAKNTAEDYTRFQS--YQDEYKDSVNNLNTLRT
A0A2E8MEZ0      TRLNLVDKQV----EKMKQMVREKK-DGTVDLSMRQHQYNS--AKEEYEQSRMMYREMSV
A0A2E3EC33      TQLSMAEQQF----QNSKETKERTE-KASLKERKDNVRYIE--AKKEYELCKEMLNGMQS
A0A2E4GN01      TQLSMAEQQF----QNSKETKERTE-KASLKERKDNVRYIE--AKKEYELSKEMLNGMQS
A0A1Z8XU55      TQLTMAEQQF----ENSRESKERTE-KMSLQERKQNVRYIE--AKKEYELSKEMLNGMQS
A0A2E1RQR9      TQLTMAEQQF----ENSRESKERTE-KMSLQERKQNVRYIE--AKKEYELSKEMLNGMXS
A0A2E3ISQ4      TQLSMAEQQY----ENSKESKERTE-KMSLQERKQNVQYIE--AKKEYELSKEMLNGMQS
A0A2D6W6F4      TQLAMAEQQY----ENSKESKERTE-KMSLQERKQNVRYIE--AKKEYELSKEMLNGMQS
A0A2D8Z5A8      TQLAMAEQQY----ENSKESKERTE-KMSLQERKQNVRYIE--AKKEYELSKEMLNGMQS
                                                                            

A0A2A2XVF1      RMKETAVTGAVDQAP-YTL--IEEPLVASL--PSKPNRTRTLAMALIMAFFFAIGAVIFF
A0A2V5UHJ2      RLKEIGVAAEVRTSN-IYV--MGKALPPGS--PSYPDKRRSMLLGVLLGLAAGIGLAFFL
A0A2V5PST3      RLNETTISNDIAVSN-MQI--TQSAERPEF--PNSPNIPIDLTMYAAMGLFIGAGLAFFL
A0A2V5PXM3      RIKETALTKEIKPGK-VRV--IQHAEVPEL--PAKPEKLRVILLGLLAGLGSGLLLALFL
A0A139SU05      RLNQTTTTKYLEKVP-IRL--LDRAQVSGR--PYTPNFPKIVRMCVMMFCVVFFGTAFGL
A0A1D8AZK8      RLNQVTTSKNLENIP-VKP--LDRALPAGA--PFTPNIRSIIKTSIGLGLLVFAAVAIGL
A0A1Q6UXG8      KEQENALAMAVTESS-ARV--LETAHGPNF--PISPKTIQYIAGGTAGGALFSIFAFMGA
A0A2N8I9W1      KEQENALAMAVTESS-ARV--LETAHGPNF--PISPKTIQYIAGGTAGGALFSIFAFMGA
A0A3R5SIG7      KEQENALAMAVTESS-ARV--LETAHGPNF--PISPKTIQYIAGGTAGGALFSIFAFMGA
A0A2N8IBZ6      KEQENALAMAVTESS-ARV--LETAHGPNF--PISPKTIQYIAGGTAGGALFSIFAFMGA
A0A2N8IJW9      KEQENALAMAVTESS-ARV--LETAHGPNF--PISPKTIQYIAGGTAGGALFSIFAFMGA
R6J100          KEQENALAMAVTESS-ARV--LETAHGPNF--PISPKTIQYIAGGTAGGALFSIFAFMGA
A0A139TV24      KEQENELALETTPSS-ARV--LETAHGSNA--PIAPNTRKFVLGGAAGGAALCLFAFMGV
A0A2N8HT11      KELENDLTLALTESS-ARV--LESAHGTDY--PISPNTRKSVLTAAAGGAIVCILGFLGL
R7DS70          KELENDLTLALTESS-ARV--LESAHGTDY--PISPNTRKSVLTAAAGGAIVCILGFLGL
A0A2N8HNL6      KELENDLTLALTESS-ARV--LESAHGTDY--PISPNTRKSVLTAAAGGAIVCILGFLGL
A0A1V5QB01      RLKEIDISVGIEPES-VQI--MERARPASS--PVTPRKLQSIFIAALIGLGVGLGLVFGL
A0A139SPN4      RLNQTTTTKYLEKVP-IRL--LDRAQVASH--PYTPNFPKIIRVCVMMFLVVFFGTAFGL
A0A1V6E7N1      RLNQTTTTKSLEKLP-LQP--LDRAVPAGA--PFTPDLARIIRTSSLLFVALFLAVAIGL
A0A2T6CWI7      RLTDTTTVKNLDKIP-LHP--LDHAVANRW--PVSPNRQKITRTAIGLGLMVFLGVALGL
A0A2D9MYT1      RXKETELQEKDIVQN-MHV--IDLATAQMH--AIKPKKLLTAFLGIIGGLGAGFGLAFFV
A0A258ANJ7      RIKQVDVSKGMETPP-IWV--HQLAMVPGD--PVSPNAKKVVGSSTAGGFMLGLAIIGLI
A0A139TLN4      KREENSLALAATEDN-ARI--VDAVRGGDG--PLAPNVPKILLVGFLVGLAVPVLGCVIA
A0A1G3ZFT0      KIQEMKIIQAGLLSD-VRI--LSYAKIPDS--AVPIERAKLYGGSIIIGLIASIILIFGR
A0A1Z8ZMT6      RVGVLKTDAEGVE---AEV--IKHEDAPRAWAPFSPNRKKIMIKNTLLGLCGGLALAFMF
A0A2E8MCT7      RVGVLKTDAEGVE---AEV--IKHEDAPRAWAPFSPNRKKIMVKTTMLGLCGGLALAFMF
A0A290QGD9      RMRETTMSSTLDTQN-ARV--IDRAFPSQPEQYVKPVILLNLGLGLVGGLGLGLAVAIFV
A0A1D8AS58      RMRETSMSSTIETQS-ARV--VDRASPALKP--ASPNVLLNLALGFLGGLALGTAFAFFV
I6AQC1          RIRELDITSTIEGQN-IQISPISRAVPAREDQYVEPRIVLNLAGGFVLGIGFGLAFAFVV
W0ITH7          RIREIDLTSTIEGQN-VQIRPISRAVPAREDEYVEPRIVLNLAGGFILGIGFGLAFAFVV
A0A290Q2Z2      TLRQREIDFQVPKRS-IEI--LNYAEPARR--AAKPSWPLNIAFAVLFGGVLGIGTAVLI
A0A2A2RGK2      RLKEVDVSKQLTESP-VRI--HETAVGAG---PIRPSATKKWIQSLLGGAAIGVGLALLM
A0A2A2XXF7      RLKEVDITKQLTESP-VRI--HEPAVGAA---PIRPSATKTWIQNLLGGLAIGIGIAIAI
A0A2A2R5D6      RKKQSVVDKQITNDP-ATI--ISKAEPNDM--PFRPNLTINLIASGVAGLVLGIVLAFFI
A0A1J4XH17      RLNTEMAQIDLKKPS-ARI--IDFAVAPGH--PAKPKKVIILALGLMGGIASGLGAVFAI
A0A3C1VJ32      KIVIDTIDAQIPKTTMVEV--IDRAEPGKA--PVKPNKTLNITLGLIFGLIMGVGLAFFI
A0A2N9NTX7      KIISEKVDLSLPKTTMVEI--VDRAVAPLF--ASSPNKTLNIALGVIVGLVVGIGLAFFI
B9XK55          RAAQEQVDRALPKTTMVQI--VDTAEEIDK--PVRPNKALNIALGIIIGLVVGVGLAFFI
A0A2E6T482      RIMQEEVDLELPTESTVEI--IDDADXPDK--AIKPNIPLNISLGVVVGLILGVGLAFFI
A0A3C0DQZ7      RIMQEEVDLELPTESTVEI--IDDADVPDK--AIKPNIPLNISLGVVVGLILGVGLAFFI
A0A1Z9CBK5      RIMQEEVDLDLPKESSVEI--IDKADTPLN--PVRPNKPLNIALGVIVGLILGVGLAFFI
A0A2D6ZI96      RIMQEEVDLDLPKESSVEI--IDKADTPLN--PVRPNKPLNIALGVIVGLILGVGLAFFI
A0A358KGZ3      RIMQEEVDLDLPKTSSVEI--IDKADTPLR--AVRPNVPLNISLGVIVGLILGVGLAFFI
A0A2E9ZQX4      RIMQEEVDLDLPKTSSVEI--IDKADTPLR--AVRPNVPLNISLGVIVGLILGVGLAFFI
A0A3D5JZU0      RIMQEEVDLDLPKTSSVEI--IDKADTPLR--AVRPNVPLNISLGVIVGLILGVGLAFFI
A0A2E6HCR0      RIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNIPLNIALGVIVGLILGVGLAFFI
A0A1Z8WN04      RIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNIALNISLGVIVGLILGVGLAFFI
A0A2D7L1N4      RIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNIALNISLGVIVGLILGVGLAFFI
A0A2E2R937      RIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNIALNISLGVIVGLILGVGLAFFI
A0A2D5MR66      RIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNITLNIVLGVIVGLILGVGLAFFI
A0A2E0PDQ1      RIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNITLNIALGVIVGLILGVGFAFFI
A0A2E2ZZP9      RIMQEEVDLDLPKESSVEI--IDKADNPIR--PVRPNITLNIALGVIVGLILGVGFAFFI
A0A2A2RGF2      KIIVEESDVAMSRSNSVRV--TDFAEAAIK--AAYPKMVLNVALGAFVGLLLGIGLAFFI
A0A2G4I5Y6      KIIVEESDIDMSRSNAVRV--TDFAEAAIK--AAYPKMPLNVALGAFVGLLLGIGLAFFI
A0A3M1I883      RTLQETIDSALPTESVVEV--TDPAVPALK--PVRPDLFLNLVLGVVFGLVMGVGLAFFI
A0A1V6JZ45      RMLQEEVDAELPKESMVRI--VDPAEPALR--PVRPNIPLNIALGIMVGLVMGVGLAFFI
A0A356NPK0      RILQETVDAALPTDSIVEI--YDPAEPNPD--PVRPKIFLNIALGVVVGLVVGIGLAFFI
A0A2D7B5P5      RILQETVDAALPTDSIVEI--YDPAEPNPD--PVRPKIFLNIALGVVVGLVVGIGXAFFI
A0A3D3XGB5      RILQETVDAALPTDSIVEI--YDPAEPNPD--PVRPKIFLNIALGVVVGLVVGIGLAFFI
A0A2V6F8A1      RVLQETVDAALPKTSIVEI--TDHAEPGRK--PVSPDFKLNIILGILVGLIVGVGLAFFI
A0A2V5TNH4      RILQETVDAALPKTSIVEI--TDQAEPGRK--PVSPSFKLNIALGIIVGLIVGISLAFFI
A0A2V5X5Q6      RILQETVDAALPKTSIVEI--TDNAEPGRR--PVSPNFKLNIALGIIVGLIVGIGLAFFI
A0A139TS01      RYKDEIARLRVPRES-VEM--YDNPLLPTA--PYKPDVTLNLAVGAVAGLLLGMGLALLL
A0A2V5URB2      RFKEINVAGEIPASN-ISI--LDRAEIPRQ--PSQPQKRRNLMLGALLGLMGGLGLALLL
A0A2V2DJ66      AMNVRLAQVSLITDT-AKV--IDKAGISPL--PSSPNYILNFVGGFILALFGGIAMAFAV
R7L5A9          AMNVRTAQVSLINEG-ASI--IDRAAPALR--PSSPNYVLNIILGIIAGIIGGICMAFLV
A0A2V6JLK8      RAQTQTMEMAMPRFA-VSV--KQVAEAPSY--PARPRVGLNLTLGMLVGLVIGIGLAFFI
A0A2W5Z1A5      RAQTQTMEMAMPRVA-VSV--KQVAEPPTF--PARPRVGLNLALGGLIGLGIGLGLAFFI
A0A2V6EA09      RAQTQTMELAMPRIA-VSV--KQVAEPPNF--PARPRVVLNLALGALVGLMIGLGLAFFI
A0A2V6GQI7      RAQTQTMELAMPRIA-VSV--KQVAEPPNF--PARPRVVLNLALGALVGLMIGLGLAFFI
A0A2A2XXW5      KAKDFDIGAKDLLQN-MKV--QDPAFAPLK--PVSPNKPLIFVGSVVGGLAVALGLALFF
A0A3R5R2M8      KEQENAMALAATEAS-ARV--LESAHGPDI--PIAPQTVQYLAAGILGGGALCFFALLGI
A0A411SUQ6      KEQENALAMAVTESN-ARV--LETAHGSNL--PISPKTIKYVAGGTAGGALLSILAFMGA
A0A2N8HZF2      KEQENALAMAVTESS-ARV--LETAHGPNI--PISPKTIKYVAGGTAGGVLLSILAFMGA
A0A354E720      KEQENALAMAVTESN-ARV--LEAAHGPNL--PISPKTIKYVAGGTAGGALLSILAFMGV
B2UPB6          KEQENALAMAVTESN-ARV--LETAHGSNL--PISPKTIKYVAGGTAGGALLSILAFMGA
A0A3C1HEJ2      ERQVTKVVQTLNKDP-VAI--EQRATVPER--PIKPNRKQVMLMGALAGLVSGLAVAFGL
A0A1V6JU76      KMKEIELVQRDKGNN-IRV--IDYAYAATM--PVKPRVLLTLFLGAFGGLGLAIGLAFFV
A0A1Q6UHJ9      SMNVRLAQVNLINEG-ANI--IDKASPGIR--PVRPNIPMNITLGILGALAGGVMVAFIV
A0A2V2BXR0      SMNVRLAQVNLINEG-ANI--IDKASPGIR--PVRPNIPMNITLGILGALAGGVMVAFIV
A0A2D8V0G3      KTKEMDLNTKDMMQN-LEV--VDLAYEPFN--PIKPRKALTLLLGLVGGLGMGFAFAFFA
A0A348S017      KTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFA
A0A3C1UUV7      KTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFA
A0A350I3V2      KTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFA
A0A3D3XF90      KTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFA
A0A2D7B522      KTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFA
A0A356NIC2      KTKEMDLSTKDMMQN-LVV--VDKAFEPIN--PVKPRKSLTLALGVIGGLGLGFALAFFA
R7DZW0          KREENSLALAATEDN-ARM--VDGVRGGNG--PLEPNVPKILMVGFLAGMAIPVFLCVVA
A0A2N8HID1      KREENSLALAATEDN-ARM--VDGVRGGNG--PLEPNVPKILMVGFLAGMAIPVFLCVVA
A0A2N8HS06      KREENSLALAATEDN-ARM--VDGVRGGNG--PLEPNVPKILMVGFLAGMAIPVFLCVVA
A0A3R8IT45      RIKETELTNTIEAQN-VQVMPLARAVQPREDEYVEPRIVLNLAAGFVLGIGFGLAFAFVV
A0A1H1MGC9      RMRETSMSSTIETQS-ARV--VDRAA--PALKPFSPNIPLNLALGFLGGLALGTAFAFFV
A0A2A2PYE8      RSRETSMTSGITTQN-ARI--VDKAAPSPESKPISPNVPLNLGLGIAGGLGLGLAFAFFV
A0A2T6CN73      RRTETSMSSNIATQN-ARI--IDLAQESPEGRPISPNVPLNLGLGVIGGLGLGLAFAFFV
A0A2N8HDG3      KELENDLTLALTESS-ARV--LEAAHGSDS--PIAPNTRKSVLTAAAGGAIVCILGFLGL
A0A2U8DZK4      TLRQREIDYNQPKRP-VEI--LSKAEPKLE--PERPSWPINITFAILFGVVLGIGTALLI
A0A1D8AWD4      TLRQREIDFQVPKKT-IEI--LNTAEPARF--ASRPNWPLNILFACVFGTILGVGAAVLL
A0A2T6DFL8      TLRQREIDFQVPKKT-IEI--LNTAEAPRF--PIRPSWPLNLTFAFVFGAVLAVGVAVVL
A0A178IH18      VLRQREIDYQVPKRT-IEI--LNTAEPARR--AARPSWPLNLTFAFLFGAVLGVGAAVLI
A0A2T6DT99      TLRQREIDFQVPKRT-IEI--LNVAEPARR--ASRPNWSLNLVFAVLFGTILGVGTAVLV
A0A1G3ZT33      TLRQREIDFQVPKRT-IEI--LNQAEPARR--PSRPNWPLNIFFALLFGSLLGVGAAVLV
A0A3E1E2T2      TLRQREIDFQVPKRT-IEI--LNTAEPARR--PSRPSWPLNSAFAVLFGSILGVGAAVLL
B1ZMW1          TLRQREIDFQVPKRT-IEI--LNTAEPPRY--PSRPNWTLSIALALVFGSLLGVGAALLL
A0A3D1TI55      RVAQEVIELEIPSTP-VEV--VETAVEPRS--PFSPSWTLNILASIFGGLFLGVALAYFI
A0A2G4G428      SFEEAKIRSSTTGTT-TSI--KVLDSPSVADRPTNKNFYLNAIIGLAMGAIFGLGLIILL
A0A3E1ET42      HSMKTAVDKEVPRKP-IEV--LQVATPEPR--PSKPNMMLLFSIGAGLGLVLGLLLAFFL
A0A2A2YDW8      KLTTDRINLRQPQNI-IQL--HEEPVVARF--PSSPKVNIALILGAVVGLVFGIGIAFFL
A0A352XLN9      KLTTDRINLRQPQNI-IQL--HEEPVVARF--PSSPKVNIALILGAVVGLVFGIGIAFFL
A0A3D0YP62      KYDIEKTKLAIPPTN-III--HQIPEINDI--AVSPNIPLNLALGAVVGVIFGLGIAFCL
A0A3D3DV47      KYDIEKTKLAIPPTN-III--HQIPEINDI--AVSPNIPLNLALGAVVGVIFGLGIAFCL
A0A2A2QX62      KEIVERMQDKVTDDP-III--HEEPVVSQV--PVSPNVTLNLALGTVVGLIFGIAVAFFL
A0A3N5WCF1      KQMGETISRKIPGES-VEV--HDPPVISNS--PVSPNVTLNLVLGAVVGLIFGVGIAFFL
A0A2E5XJ49      TNSARRIALKIPKNP-ITI--LEEPKQAKD--AVYPKVSLFLGLGAAVGLIFGVAIAFFL
A0A2E6SBY8      TNSARRIALKIPKNP-ITI--LEDPKQAKD--AVYPKVSLFLGLGAAVGLIFGIAIAFFL
A0A2E5QMS4      TNSARRIALKIPKNP-ITI--LEDPKMSKN--PVYPKVTLFLSLGAAVGLIFGISIAFFL
A0A2E7YXQ3      TNSARRIALKIPKNP-ITI--LEDPKMSKN--PVYPKVTLFLSLGAAVGLIFGISIAFFL
A0A2E3H787      TNSARRIALKIPKNP-ITI--LEDPKLGKX--PVYPKVTLFLSLGAAVGLIFGVAIAFFL
A0A2E7AGN1      TNSARRIALKIPKTP-ITL--LENPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFFL
A0A2E7AKY7      TNSARRIALKIPKTP-ITL--LENPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFFL
A0A3D4CU34      TNSARRIALKIPKTP-ITL--LENPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFFL
A0A2E8M146      TNSARRIALKIPKTP-ITI--LEHPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSL
A0A355S8S2      TNSARRIALKIPKTP-ITI--LEHPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSL
A0A2D6DVN8      TNSARRIALKIPKTP-ITI--LEEAKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSL
A0A3C1W2R2      TNSARRIALKIPKTP-ITI--LEEAKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSL
A0A2E3NAY6      TNSARRIALKIPKTP-ITI--LEDPKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSL
A0A2E3II01      TNSARRIALKIPKTP-ITI--LEEAKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSL
A0A368B8C5      TNSARRIALKIPKTP-ITI--LEEAKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSL
A0A3R7RBB5      TNSARRIALKIPKTP-ITI--LEEAKIGMD--PVYPKVTLFLSLGAAVGLIFGIAIAFSL
B4DB23          SYVTQKMNNSVKGDS-AKI--WEKAEKAEY--PSEPNVPAYMGMAAIIGLVLGVGLAFFI
A0A139TUL1      KREENALALATTEPS-ARI--LEPAFGSNS--PVAPKLPLMTLGGMAGGAFLCLLSLMVS
A0A2N8HCB0      KREENALALATTEPS-ARI--LEPAFGSNA--PVAPKLFLMTVGGMTGGALVSLLALLAG
A0A2N8HP04      KREENALALATTEPS-ARI--LEPAFGSNA--PVAPRLPLMTMGGMAGGAFASLLALLAG
A0A2N8HRJ0      KREENALALATTEPS-ARI--LEPAFGSNA--PVAPRLPLMTMGGMAGGAFASLLALLAG
A0A366HAG0      TKAQKEIERDGSKTP-ITV--YQPAEPDTT--PSKPNVKLNLLLGGIIGLMFGFGMAFFL
A0A3M1I8A3      RLSEAEVMQRDTANN-INI--VDPATIPTE--FVKPNIPVVLTAGVLGGILLGIGLALFV
A0A0R2XQ77      RMTQERAAVNLKNPN-SRV--IDQAFPPLRH--SSPNIAMNLAAGFFGGLAVGAGLIFAV
A0A2E9IN28      RMTTEKAQVNLKNPN-ARI--VDEAFPPSEDNPSSPNVTMNLAAGFFGGIAVGVGLIFVV
D5ENH7          RMTQEQAQVSLKEAS-ARI--VDKAFAPLRH--SSPNILMNLAAGIFGGLVVGAGLVFLV
A0A351WE84      RITQQGIEVEVPRTP-VEV--VEPAEPANK--PSSPLVMLNILLSIFLGFGAGIGLAYFI
A0A146GCJ0      RLKETAITQGIEQAP-YRV--IEEPMVPNV--PSKPRIKLILLVSLVAGLGLGVALVVVI
A0A2T6D6H8      RLKETAITQGVEQPP-FRI--IEEPMVPSA--PAKPRVKVILAAGLLLGVMAGVGLVFVL
A0A1V5QDZ6      RIAQEGIAVEVPRTP-VEI--VDPAVPPSR--PVSPNLFLNILLSVLLGLGAGVGLAYFI
A0A3D4HF88      RLNTEIAQVNLKNPT-ARI--VDKATPPIY--PSHPKILLNLFLGFSGGIMLSLIFVGLL
A0A351MR11      SYEDAKLRTSTTGTS-TSV--RILDTPVVSERPINKNYYLNVFVGIGLGLASGVGLVVLL
A0A1V6J089      RITQTGIEVEVPRTT-VDI--VEEADPPDR--PSSPLVVLNIFLSVVLGLMAGTGLAFFV
A0A3C1BZR1      RITQTGIEVEVPRTA-VEI--IEEAEAPQR--PSSPLVVLNIFLSVVLGLLAGTGLAFFV
A0A1H6KPB7      EYINQTMNRRASRPI-IQI--HTQAREAKV--PSSPNVKMNLILGAVVGVVFGIGVAFLL
A0A2E9ISN4      RLLENTGTTEP-----FFL--RKIQAPQASEKPIKPQVIKIIAASLFLGAAFGAGAILGL
B9XAX1          RLKETDLSKGLEKAS-IAV--VEPAMLPGA--TVKWSLLLVIGGAVVTGLLMSLCMIYLM
I0JYY7          RLKETDITSALNSGN-IEV--IETSPIPKV--PVKPQKIRNILFALVFGSLTSCGLALGL
A0A3E1EJT7      RMRETSVTSSIETES-ARI--IDRAYEPGN--PVSPKVFFNLTLGVLAGLVAGFSVAFLI
A0A317ZP96      RMTTEKAQVNLKNPN-ARI--VDEAYPPADDNPSSPNVVMNLAAGFFGGLAVGTALVFAV
A0A2D5WGA5      RIMQEEVDLALPKSSTVQI--IDDADLPEK--PVKPNIPLNIALGMVVGLILGVGLAFFL
A0A2E7SSH2      RIMQEEVDLDLPKTSSVEI--IDKADIPLR--PVRPNKPLNIALGVIVGLILGVGLAFFI
A0A349GXM8      RLHDMRVSEELKSEH-FVP--EDITTRED---PVWPDPLKILMAALAGGLGLGFGLAFLA
B3DZK9          RLKETDITSALNSGN-IEV--VETASIPKK--PVKPKKMLNLLLGLFGGSVGGIGLALGL
A0A2A2XV69      RLSTETMQRTMPQDP-TVI--WERAEPAEY--PSRPRVLLNMILGVVVGIGFGVGLAFFI
A0A3C1VB86      RLGETSVAGQITAER-IRV--IQPALVPEL--PASPKIKLIFALALFGGLAVGLGISFVL
A0A146G2Q9      RLATEKMEQTIPQSP-TTI--WESAEISLV--PAKPNVVLNMVLGVIVGLVFGVGLAFFI
A0A2T6D3Y2      RLATEKMEQTIPQSP-TTI--WETAEISLV--PAKPNVVLNMVLGVIVGLVFGVGLAFFI
A0A2V2SDV4      KIYTEKLDNELPKTA-MAF--ITTHAVPDA-HAVRPNKPFNIALGIIVGLVVGVGLAFFI
A0A2V5PK75      KIASEKIDQKLPKTL-MVE--IMDKAEPGT-KPVKPNKALNIALGIIIGLVVGIGLAFFI
A0A1V6DME1      KLAQERIDVDLPRTA-MVE--IVDTAKPGL-RPVRPNKPLNIALGVIIGLVVGVGLAFFI
A0A3D3DIJ3      KIAFEKIDVELPKTL-MVE--VVDRAMPGL-RPVRPNKPLNIALGIIIGLVVGVGLAFFI
A0A2D5VY59      RILQETVDASLPTES-IVE--IYDPAEPND-EPVRPKKVLNIALGVLVGLIAGVGLAFFI
A0A2D8UZZ4      RILQETVDASLPTES-IVE--IYDPAEPND-EPVRPKKVLNIALGVLVGLIAGVGLAFFI
A0A353DV86      RILQETVDASLPTES-IVE--IYDPAEPND-EPVRPKKVLNIALGVLVGLIAGVGLAFFI
A0A2E5EPT8      KIESEEIDADIGRTA-AVE--VIDPAEPAI-RPAKPKVALNIALGVVLGAVMGIGMAFFI
A0A350EWA4      KIAQEKINYALNSTF-IVG--VINPAEEGL-RPVRPNKTLNIALGVIVGLVVGVGLAFFI
A0A2N8HD92      RYTDEIARLRVPRDA-VEM--YDLPEYPAV--AYKPSITINLAVGASVGLLLGIGLALFL
A0A2N8HIT2      RYKDEIARLRVPREA-IEM--YQLPTYPAA--PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A354EBD3      RYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A355VEB2      RYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A2N8IMT3      RYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLL
R6K1U5          RYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A2N8IWC2      RYKDEIARLRVPREV-IEM--YQLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A2N8I441      RYKDEIARLRVPREV-IEM--YQLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A1Q6UTU9      RYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A2N8I3A6      RYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A410SCC4      RYKDEIARLRVPREA-IEM--YQLPTYPVA--PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A3R5VEW0      RYKDEIARLRVPREA-IEM--YQLPTYPAA--PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A411SSG2      RYKDEIARLRVPREA-IEM--YQLPTYPAA--PYKPNVTINLAVGAGAGLLLGIGLALLL
B2UKW3          RYKDEIARLRVPREA-IEM--YQLPTYPAA--PYKPNVTINLAVGAGAGLLLGIGLALLL
A0A1M6RLZ4      NLTNELLKDNLMVDP-IRF--SKVPSEPAADEYVSPNWTLNMALGAVAGLVFGVGIAFAL
A0A354T7G8      RFFEEKAGIELVKSP-ATI--YAEAEPE--GKPAKPNVPLHLALGGVLGLMFGLGLAFFL
A0A2S7U4L6      SNVIEELQENMSIEP-IEF--YSYPQEPEVADYVSPNWILNMALGSVAGMIFGIGIAFSL
A0A2E8MEZ0      KQQQQRVLLKMPRTP-ITL--HERAKKAKA--PAYPNVTLNLLLGAGVGLIFGIGIAFLL
A0A2E3EC33      QLAKEKIDAAGQRTP-MVI--HEIAEAADPGNPARPNIKLHLVLGATVGLVFGIGMAFFL
A0A2E4GN01      QLAKEKIDAAGQRTP-MVI--HEKAEASDPDNPARPNIKLHLVLGAAVGLVFGIGMAFFL
A0A1Z8XU55      QLAKETIDKEGQRTP-LVI--HEQAEPSDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFL
A0A2E1RQR9      QLAKETIDKEGQRTP-LVI--HEQAEPSDVDKPARPNIKXHLVLGAAVGLIFGIGMAFFL
A0A2E3ISQ4      QLAKETIDSAGQRTP-LVI--HEEAEPQDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFL
A0A2D6W6F4      QLAKETIDSAGQRTP-LVI--HELAEPQDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFL
A0A2D8Z5A8      QLAKETIDSAGQRTP-LVI--HELAEPQDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFL
                                                                            

A0A2A2XVF1      DSLNSSLRSVDEAESFLHLPALVGIPNRTLKGFS-QLKQTLERECAALPGRLRQARNIGK
A0A2V5UHJ2      EQLDNTLKSPEEAERYLRLPSLAMVPDFVSVNGT-NG------------S----------
A0A2V5PST3      EYLNSRLETPEHVWRAVDLSTFGVVPDLASLNRP-LI------------S----------
A0A2V5PXM3      NSLDRSLKTVDQTEEYLGIPVLSAIPKFASVAGD-QR------------K----------
A0A139SU05      DFIDDRIKSAWDIENFLGTSLLGIVPDLASVKDE-DK------------Y----------
A0A1D8AZK8      SFIDDRVKSAWDIEGFIGAHLLGIIPELGDVPDT-EK------------H----------
A0A1Q6UXG8      AMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESR-NT------------G----------
A0A2N8I9W1      AMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESR-NT------------G----------
A0A3R5SIG7      AMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESR-NT------------G----------
A0A2N8IBZ6      AMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESR-NT------------G----------
A0A2N8IJW9      AMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESR-NT------------G----------
R6J100          AMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESR-NT------------G----------
A0A139TV24      AILNNKVKNRHDLDAITTLPVIAELPAMSKKEQK-QV------------S----------
A0A2N8HT11      ALLNNKIKNRKDLNAVTHLPVVAELPAMTKKEQR-QV------------A----------
R7DS70          ALLNNKIKNRKDLNAVTHLPVVAELPAMTKKEQR-QV------------A----------
A0A2N8HNL6      ALLNNKIKNRKDLNAVTHLPVVAELPAMTKKEQR-QV------------A----------
A0A1V5QB01      EYIDDSLRYPEEVTDLLGLPFFGLVPAASWDPEDLRT------------H----------
A0A139SPN4      DFIDDRIKSAWDIENFLNTSLLGIVPDLNNVKDE-DK------------Y----------
A0A1V6E7N1      NFIDDRIKSTWDVEHYIGTTLLGIVPDLADTPDD-DR------------Y----------
A0A2T6CWI7      SFIDDRIKSAWDVESFVGANLLGIVPDLGNLKDE-EK------------Y----------
A0A2D9MYT1      NFLDDSIKSQEDIETYLKLPFLGYVPNIKTTSII-ER------------D----------
A0A258ANJ7      VIQDRSIRSVDDARQKLRVPVLGMIA---------NQ------------R----------
A0A139TLN4      AMMDSRVKRREEIESLTDIPVYGVLPRKPRKLKNQE------------------------
A0A1G3ZFT0      KFIFPRIEDPYWTETRFNIPNLAIIPYSKEQFKD--------------------------
A0A1Z8ZMT6      QFVDNKIHGVADVEQTFGISILSAIQKLPPEEELLEK------------M----------
A0A2E8MCT7      QFVDNKIHGVADIEQTFGISILSAIQKLPPEEELLKE------------M----------
A0A290QGD9      AFIDDRVKSSFDIEGQMGLHLLGIIPQVRKMPAP-EK------------A----------
A0A1D8AS58      AYVDDRVKSSFDIESVIGLPLVGIIPEIKRMDQP-DK------------A----------
I6AQC1          AFIDDRVKSSFDIESVVGLPLLGVIPQIKKMDQA-DK------------A----------
W0ITH7          AFIDDRVKSSFDIESVVGLPLLGVIPQIKKMDQA-DK------------A----------
A0A290Q2Z2      EFFDTSFRNVAELEGRLGKPVLGVIPHSSEAVPP--------------------------
A0A2A2RGK2      FFMDTSMKTVDQVESVTGVGVIAAIPKLSLNARA-SV-----------------------
A0A2A2XXF7      FMLDTSIKTVDQVEQFTGVNVIAAIPKLSLSTRA-SV-----------------------
A0A2A2R5D6      EYLDTSVKTMDDVEKLLDLPVLAVIP-------D-GV------------G----------
A0A1J4XH17      AFFDDRIKTAFDIESVVGLPLLGVIPRMANLNTQ-EK------------A----------
A0A3C1VJ32      EYLDTSVKTIDDVERTFQAPVLGVIP-------Q-NI------------G----------
A0A2N9NTX7      EYLDTSVKTIDDVERSLQSPVLGVIP-------Q-NV------------G----------
B9XK55          EYLDTSVKTIDDVERTLQAPVLGVIP-------Q-NV------------G----------
A0A2E6T482      EYLDTSVKTIDDVERSLGAAVLGVIP-------Q-NV------------G----------
A0A3C0DQZ7      EYLDTSVKTIDDVERSLGAAVLGVIP-------Q-NV------------G----------
A0A1Z9CBK5      EYLDTSVKTIDDVERALNAAVLGVIP-------Q-NV------------G----------
A0A2D6ZI96      EYLDTSVKTIDDVERALNAAVLGVIP-------Q-NV------------G----------
A0A358KGZ3      EYLDTSVKTIDDVERALDAAVLGVIP-------Q-NV------------G----------
A0A2E9ZQX4      EYLDTSVKTIDDVERALDAAVLGVIP-------Q-NV------------G----------
A0A3D5JZU0      EYLDTSVKTIDDVERALNAAVLGVIP-------Q-NV------------G----------
A0A2E6HCR0      EYLDTSVKTIDDVERALNAAVLGVIP-------Q-NV------------G----------
A0A1Z8WN04      EYLDTSVKTIDDVERALNTAVLGVIP-------Q-NV------------G----------
A0A2D7L1N4      EYLDTSVKTIDDVERALNTAVLGVIP-------Q-NV------------G----------
A0A2E2R937      EYLDTSVKTIDDVERALNTAVLGVIP-------Q-NV------------G----------
A0A2D5MR66      EYLDTSVKTIDDVERALNTAVLGVIP-------Q-NV------------G----------
A0A2E0PDQ1      EYLDTSVKTIDDVERALNTAVLGVIP-------Q-NV------------G----------
A0A2E2ZZP9      EYLDTSVKTIDDVERALNTAVLGVIP-------Q-NV------------G----------
A0A2A2RGF2      EYLDTSVKTIDDVERALSAPVLAVIP-------Q-NV------------G----------
A0A2G4I5Y6      EYLDTSVKTIDDVERALQAPVLAVIP-------Q-NV------------G----------
A0A3M1I883      EYLDTSVKTIDDVERSLEATVVGVIP-------Q-NI------------G----------
A0A1V6JZ45      EYLDTSVKTIDDVERSLSAPVLGVIP-------Q-NV------------G----------
A0A356NPK0      EYLDTSVKTIDDVEQALDAPVLGVIP-------Q-NV------------H----------
A0A2D7B5P5      EYLDTSVKTIDDVEQALDAPVLGVIP-------Q-NV------------H----------
A0A3D3XGB5      EYLDTSVKTIDDVEQALDAPVLGVIP-------Q-NV------------H----------
A0A2V6F8A1      EYLDTSVKTIDDVERALQAPVLGVIP-------Q-NV------------G----------
A0A2V5TNH4      EYLDTSVKTIDDVERALQAPVLGVIP-------Q-NV------------S----------
A0A2V5X5Q6      EYLDTSVKTIDDVERALQAPVLGVIP-------Q-NV------------S----------
A0A139TS01      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A2V5URB2      EHLNNTLRTPDEVERYLRLPNLAIVPDFYRLPNHRNG------------Q----------
A0A2V2DJ66      AFLDDRAKSAYDVETVIGLPLLGVIPRIKRLSSA-EK------------A----------
R7L5A9          AFLDDRAKSAYDIEAVIGLPLLGVIPRIKRLNSA-EK------------A----------
A0A2V6JLK8      EYLDTSVKTMDDVESLLGVPVLAIIP-------K-NI------------N----------
A0A2W5Z1A5      EYLDTSVKTMEDVETLLGVPVLAIIP-------K-NV------------T----------
A0A2V6EA09      EYLDTSVKTMEDVENLLGLPVLAIIP-------K-NI------------K----------
A0A2V6GQI7      EYLDTSVKTMEDVENLLGLPVLAIIP-------K-NI------------K----------
A0A2A2XXW5      NFLDDSIKSQEDVENILHLPFLGYIPNIKSISIV-ER------------D----------
A0A3R5R2M8      AMLNNKVKNKYDLPAQVRQPVIAELPKMSKKERK-NN------------T----------
A0A411SUQ6      AMLNNKVNNKHDLPAANRQPVIAELPQMSKKESK-NT------------K----------
A0A2N8HZF2      AMLNNKVNNKHDLPAANRQPVIAELPQMNKKESR-NT------------G----------
A0A354E720      AMLNNKVNNKHDLPSVNRQPVIAELPQMSKKESR-NT------------K----------
B2UPB6          AMLNNKVNNKHDLPAANRQPVIAELPQMSKKESK-NT------------K----------
A0A3C1HEJ2      AATDSSLKSVEQAENFLKVPLLGAIPQMKELQSSDSS------------Q----------
A0A1V6JU76      NFLDDSIKSQDDVELYLHLPFLGYIPNIKTNSVV-ES------------G----------
A0A1Q6UHJ9      AFMDDRAKSAYDIESVVGLPLLGVIPRIRRLNSS-QK------------A----------
A0A2V2BXR0      AFMDDRAKSAYDIESVVGLPLLGVIPRIRRLNSS-QK------------A----------
A0A2D8V0G3      NYLDDSVKSQDDIESYLKLNFLGYIPNIKSQSLV-ER------------D----------
A0A348S017      NYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLV-ER------------D----------
A0A3C1UUV7      NYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLV-ER------------D----------
A0A350I3V2      NYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLV-ER------------D----------
A0A3D3XF90      NYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLV-ER------------D----------
A0A2D7B522      NYMDDSIKSQDDIETHLRLNFLGYXPNIKTNSLV-ER------------D----------
A0A356NIC2      NYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLV-ER------------D----------
R7DZW0          AMLDSSVKRRKEIETLTSIPVYGELPRKPRKLKNQE------------------------
A0A2N8HID1      AMLDSSVKRRKEIETLTSIPVYGELPRKPRKLKNQE------------------------
A0A2N8HS06      AMLDSSVKRRKEIETLTSIPVYGELPRKPRKLKNQE------------------------
A0A3R8IT45      AFIDDRVKSSFDIESVVGLPLLGVIPQIKKMDQA-DK------------A----------
A0A1H1MGC9      AYIDDRVKSSFDIESVVGLPLIGIVPEIKRLDQP-EK------------A----------
A0A2A2PYE8      AFIDDRVKSSYDIEGVVGLPLIGIIPQIKRMDQP-DK------------A----------
A0A2T6CN73      AFIDDRVKSSFDIEGVVGLPLIGIIPEIKKLEQV-EK------------A----------
A0A2N8HDG3      ALLNNKVKNKKDLNAITSLPVVAELPAMTKKEQR-QV------------A----------
A0A2U8DZK4      DMFDASFRSVADVERRLQRPVLGVIPSSLTARKP-AE------------E----------
A0A1D8AWD4      EYFDTSFRNVADVEGKLSLPVLGVIPHMAEAGEL-H------------------------
A0A2T6DFL8      EYFDTSFRNVADVEARLGLPVLGVIPFAQDPLAR-G------------------------
A0A178IH18      EFFDASFRGVADVERRLQRPVLGVIPASATARRP-NE------------D----------
A0A2T6DT99      EYFDTSFRNVAEVEARLQRPVLGVIPNAPDPLKK-DA------------A----------
A0A1G3ZT33      EYFDTSFRNVADVEDHLKLPVLSVIPLSRTPARL-D------------------------
A0A3E1E2T2      EYFDTSFRNVADVETRLKLPVLGVIPFHRDPLDE-E------------------------
B1ZMW1          EYFDTSFRTVGDVETRLKLPVLGVIPRQTDPLGG-D------------------------
A0A3D1TI55      EYMDTSVKTIDDVERFLGLPVLGIIP-------Q-RV------------R----------
A0A2G4G428      GTFDDRIKSPKEVEIALGIPILGTIPQITKSVGP-ER------------A----------
A0A3E1ET42      EYLDTSVKSLDDVERYLGVPVLAVIP-------K-DV------------G----------
A0A2A2YDW8      EYLDTSVKTLEDVERYLQVPVLAVIP-------K-DI------------G----------
A0A352XLN9      EYLDTSVKTLEDVERYLQVPVLAVIP-------K-DI------------G----------
A0A3D0YP62      EYLDTSVKSLEDVERFLQVPVLAVIP-------K-DV------------G----------
A0A3D3DV47      EYLDTSVKSLEDVERFLQVPVLAVIP-------K-DV------------G----------
A0A2A2QX62      EYLDTSVKTLEDVERYLQVPVLAVIP-------K-DV------------G----------
A0A3N5WCF1      EYLDTSVKTLEDVERYLQVPVLAVIP-------K-DV------------G----------
A0A2E5XJ49      EYLDTSVKSLEDVERYLQVPVLAVIP-------K-DV------------G----------
A0A2E6SBY8      EXLDTSVKSLEDVERYLQVPVLAVIP-------K-DV------------G----------
A0A2E5QMS4      EYLDTSVKSLEDVERYLQVPVLAVIP-------K-DV------------G----------
A0A2E7YXQ3      EYLDTSVKSLEDVERYLQVPVLAVIP-------K-DV------------G----------
A0A2E3H787      EYLDTSVKTLEDVERYLQIPVLAVVP-------T-DV------------N----------
A0A2E7AGN1      EYLDTSVKTLEDVERYLQVPVLAVIP-------T-DV------------G----------
A0A2E7AKY7      EYLDTSVKTLEDVERYLQVPVLAVIP-------T-DV------------G----------
A0A3D4CU34      EYLDTSVKTLEDVERYLQVPVLAVIP-------T-DV------------G----------
A0A2E8M146      EYLDTSVKTLEDVERYLQVPVLAVIP-------T-DV------------G----------
A0A355S8S2      EYLDTSVKTLEDVERYLQVPVLAVIP-------T-DV------------G----------
A0A2D6DVN8      EYLDTSVKTLEDVERYLQVPVLAVIP-------T-DV------------G----------
A0A3C1W2R2      EYLDTSVKTLEDVERYLQVPVLAVIP-------T-DV------------G----------
A0A2E3NAY6      EYLDTSVKTLEDVERYLQVPVLAVVP-------T-DV------------G----------
A0A2E3II01      EYLDTSVKTLEDVERYLQVPVLAVIP-------T-DV------------G----------
A0A368B8C5      EYLDTSVKTLEDVERYLQVPVLAVIP-------T-DV------------G----------
A0A3R7RBB5      EYLDTSVKTLEDVERYLQVPVLAVIP-------T-DV------------G----------
B4DB23          DYLDTSVKTLDDVERYLQIPVLAVIP-------N-NV------------S----------
A0A139TUL1      NALNTNVKDKNDLVGLVSLPLAGELPLLSGKERK-KL------------P----------
A0A2N8HCB0      NALNTKVRDKKDLAGLTDLPLAGALPLLSGKERA-KL------------P----------
A0A2N8HP04      NALNTKVRDKKDLAGLTDLPLAGELPLLSGKERK-KL------------P----------
A0A2N8HRJ0      NALNTKVRDKKDLAGLTDLPLAGELPLLSGKERK-KL------------S----------
A0A366HAG0      EYLDTSVRTMDDLERTLSVPVLAVVP-------K-GV------------G----------
A0A3M1I8A3      NYLDDSIKSQDDVELHLQMPFLGYVPSIKSAKEV-ER------------Y----------
A0A0R2XQ77      AFLDDRVKSVFDIEGTIGLSMLGVVPRIKKLDSS-SK------------A----------
A0A2E9IN28      AFLDDRVKSAFDIEGTIGLPMLGVVPRIKKLDSN-TK------------A----------
D5ENH7          AFLDDRVKSAFDIEGTIGLPLLGVVPRIKKLDSN-SK------------A----------
A0A351WE84      EYLDTSVRTVDDVEQFLGLPVLGVIP-------Q-KI------------R----------
A0A146GCJ0      DLLDASLRTVDEAESYLGLPALTAVPEQRSKSVGEQV------------AEAWNDKTLGS
A0A2T6D6H8      DLLDHSLRTVDEAESFLDLPALAAIPEKRIETVLNQV------------GEAIREKKLSK
A0A1V5QDZ6      EYLDTSVKTVDDIERYLGLSVLGIIP-------Q-KV------------R----------
A0A3D4HF88      AFFDDRVKTAYDVEGILNLPLIGVVAKLQELSAK-EK------------A----------
A0A351MR11      GVFDDRVKSAVDIEGGLGLPLVGTVPRTTDTYGP-DR------------A----------
A0A1V6J089      EYLDVSIKTVDEVEKYLGLPVLAVIP-------Q-QS------------R----------
A0A3C1BZR1      EYLDVSIKTVDEVEKYLGLPVLAVIP-------Q-QS------------R----------
A0A1H6KPB7      NYMDTSVKTLEDVERNLNLPVLGVIP-------Q-DI------------G----------
A0A2E9ISN4      EYLKPNPINVTHLEREYHIDLLGQIR---------RW------------D----------
B9XAX1          SLFDSSIRTVDQAEFVLGLPVLAAIPVAKKGRNG-TP------------A----------
I0JYY7          AKLDTRIRSKEEIEKQLGIPVLGSIP---------DI------------E----------
A0A3E1EJT7      ATLDDRIKTISAVETLVDLPLLGVIPEVKRMDQP-DK------------A----------
A0A317ZP96      AFLDDRVKSAFDIEGTIGLPMLGVIPRIKKLDTN-TK------------A----------
A0A2D5WGA5      EYLDTSVKTIDDVEHALGAAVLGVIP-------Q-NV------------G----------
A0A2E7SSH2      EYLDTSVKTIDDVERALDAAVLGVIP-------Q-NV------------G----------
A0A349GXM8      QVVDNKVQTIKDVENILGVRFLGGIPYWAHSQLESSI------------R----------
B3DZK9          ALLDNRFRGKDDIEKFLKIPVLGVIP---------DI------------E----------
A0A2A2XV69      EYLDTSVKTLQDLESILKIPVLAVIP-------K-EI------------S----------
A0A3C1VB86      NSMDTSFRTVDEVEHYLALPVLGAIPKLPKTEGK-GN------------D----------
A0A146G2Q9      EYLDTSVKTMEDVESFLKVPVLAVIP-------K-GI------------S----------
A0A2T6D3Y2      EYLDTSVKTMEDVESFLKVPVLAVIP-------K-GI------------S----------
A0A2V2SDV4      EYLDTSVKTIDDVERSLNSPVLGVIP-------Q-NV------------G----------
A0A2V5PK75      EYLDTSVKTIDDVERSLQSPVLGVIP-------Q-NV------------G----------
A0A1V6DME1      EYLDTSVKTIDDVERALQSPVLGVIP-------Q-NV------------G----------
A0A3D3DIJ3      EYLDTSVKTIDDVERALQCPVLGVIP-------Q-NV------------G----------
A0A2D5VY59      EYLDTSVKTIDDVEQALGAPVLGVIP-------Q-NV------------Q----------
A0A2D8UZZ4      EYLDTSVKTIDDVEQALGAPVLGVIP-------Q-NV------------Q----------
A0A353DV86      EYLDTSVKTIDDVEQALGAPVLGVIP-------Q-NV------------Q----------
A0A2E5EPT8      EYLDTSVKTIDDVEHTLQAPVLAVIP-------Q-NV------------G----------
A0A350EWA4      EYLDTSVKTIDDVERALQAHVLGVIP-------Q-NV------------G----------
A0A2N8HD92      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A2N8HIT2      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A354EBD3      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A355VEB2      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A2N8IMT3      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
R6K1U5          EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A2N8IWC2      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A2N8I441      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A1Q6UTU9      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A2N8I3A6      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A410SCC4      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A3R5VEW0      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A411SSG2      EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
B2UKW3          EFMDTSVKTMEDVERALQVPVLGIIP-------K-NV------------P----------
A0A1M6RLZ4      ELMDTSVKTLEDVERFLQVPVLAVIP-------R-DV------------G----------
A0A354T7G8      EYMDTTVKSLDDVERHLGVPVLAVVP-------K-GV------------G----------
A0A2S7U4L6      ELMDTSVKSLEDVERYLQVPVLAVVP-------R-DV------------G----------
A0A2E8MEZ0      EHLDTSVKSLEDVERYLQVPVLAVIP-------K-DV------------G----------
A0A2E3EC33      EYLDTSVKSMDEVEHFLELPVLAVIP-------Q-AV------------G----------
A0A2E4GN01      EYLDTSVKSLDEVEHFLELPVLAVIP-------Q-DV------------G----------
A0A1Z8XU55      EYLDTSVKSLDEVEYYLDLPVLAVIP-------K-DV------------G----------
A0A2E1RQR9      EYLDTSVKSLDEVEYYLDLPVLAVIP-------K-DV------------G----------
A0A2E3ISQ4      EYLDTSVKSLDEVEYYLDLPVLAVIP-------K-DI------------N----------
A0A2D6W6F4      EYLDTSVKSLDEVEYYLDLPVLAVIP-------K-DI------------N----------
A0A2D8Z5A8      EYLDTSVKSLDEVEYYLDLPVLAVIP-------K-DI------------N----------
                                                                            

A0A2A2XVF1      PHKKKESSVLGDIQELIRPAPIARTDSEKYPIATIEEPESGLAE----------------
A0A2V5UHJ2      --YVSRLLKSAQAELPVSARKAAKAKHADSSVLLDHHSLSVVAE----------------
A0A2V5PST3      -----YQPVSSGKPKRIAQLQAQQKTSNGKDLIVSYHPLSIFSE----------------
A0A2V5PXM3      -------------------------------LINAEDAESGEAE----------------
A0A139SU05      -------------------------------TLLLKDTHPTAVE----------------
A0A1D8AZK8      -------------------------------SLVNSNKTSPGSE----------------
A0A1Q6UXG8      --------------------------------LFIQDEHSVIAE----------------
A0A2N8I9W1      --------------------------------LFIQDEHSVIAE----------------
A0A3R5SIG7      --------------------------------LFIQDEHSVIAE----------------
A0A2N8IBZ6      --------------------------------LFIQDEHSVIAE----------------
A0A2N8IJW9      --------------------------------LFIQDEHSVIAE----------------
R6J100          --------------------------------LFIQDEHSVIAE----------------
A0A139TV24      --------------------------------LMLPDEHSVMAE----------------
A0A2N8HT11      --------------------------------RMFTDEHSVISE----------------
R7DS70          --------------------------------RMFTDEHSVISE----------------
A0A2N8HNL6      --------------------------------RMFTDEHSVISE----------------
A0A1V5QB01      -------------------------------ILSNIDQKSGMVE----------------
A0A139SPN4      -------------------------------TLLLKDTNPTAVE----------------
A0A1V6E7N1      -------------------------------RMVLDHRQSPGLE----------------
A0A2T6CWI7      -------------------------------TLMLTEKQVQGAE----------------
A0A2D9MYT1      -------------------------------LQAHLHPQSNSAE----------------
A0A258ANJ7      -------------------------------QIATASEQQKGHDFTQGLTPALIAHKAVA
A0A139TLN4      -------------------------------IVVNLEEPSELSE----------------
A0A1G3ZFT0      ------------------FQDLKRNVKKPIMLLSQKDPRNLSIE----------------
A0A1Z8ZMT6      --------------ESLRDLPVSMKHISPTLAVPGWKTDFVHSE----------------
A0A2E8MCT7      --------------ESIRDLPVSMKHICPTLAVPGWKTDFVHSE----------------
A0A290QGD9      -------------------------------QVVANHADRQVSE----------------
A0A1D8AS58      -------------------------------QIVINNQDKQVVE----------------
I6AQC1          -------------------------------QVALNNADRQVAE----------------
W0ITH7          -------------------------------QVALNNADRQVAE----------------
A0A290Q2Z2      -------------------------------AKSGIVEDPAELE----------------
A0A2A2RGK2      -------------------------------LVTNEERSGIVAE----------------
A0A2A2XXF7      -------------------------------LVTNEERSGIVAE----------------
A0A2A2R5D6      -------------------------------PLIREGADSPHAE----------------
A0A1J4XH17      -------------------------------KTVVKGTEKTVLE----------------
A0A3C1VJ32      -------------------------------YLLEEGAESKHAE----------------
A0A2N9NTX7      -------------------------------LLVDEGVESPHAE----------------
B9XK55          -------------------------------LLLDEGAESPHAE----------------
A0A2E6T482      -------------------------------SLLEEGDESPHAE----------------
A0A3C0DQZ7      -------------------------------SLLEEGDESPHAE----------------
A0A1Z9CBK5      -------------------------------SLVDEGDESPHAE----------------
A0A2D6ZI96      -------------------------------SLVDEGDESPHAE----------------
A0A358KGZ3      -------------------------------SLMDEGDESPHAE----------------
A0A2E9ZQX4      -------------------------------SLMDEGDESPHAE----------------
A0A3D5JZU0      -------------------------------SLMDEGDESPHAE----------------
A0A2E6HCR0      -------------------------------SLVDEGEESPHAE----------------
A0A1Z8WN04      -------------------------------SLVDEGEESPHAE----------------
A0A2D7L1N4      -------------------------------SLVDEGEESPHAE----------------
A0A2E2R937      -------------------------------SLVDEGEESPHAE----------------
A0A2D5MR66      -------------------------------SLVDEGEESPHAE----------------
A0A2E0PDQ1      -------------------------------SLVDEGEESPHAE----------------
A0A2E2ZZP9      -------------------------------SLVDEGEESPHAE----------------
A0A2A2RGF2      -------------------------------ALLDEGMDSPHAE----------------
A0A2G4I5Y6      -------------------------------ALLDEGMDSPHAE----------------
A0A3M1I883      -------------------------------LLIKEGPDSPHAE----------------
A0A1V6JZ45      -------------------------------ILVNEGPDSPHGE----------------
A0A356NPK0      -------------------------------SLLMEGPDSPHAE----------------
A0A2D7B5P5      -------------------------------SLLMEGPDSPHAE----------------
A0A3D3XGB5      -------------------------------SLLMEGPDSPHAE----------------
A0A2V6F8A1      -------------------------------SLIQEGPESPHAE----------------
A0A2V5TNH4      -------------------------------SLILEGSESPHAE----------------
A0A2V5X5Q6      -------------------------------SLILEGPESPHAE----------------
A0A139TS01      -------------------------------ILHSAGSLGPDAE----------------
A0A2V5URB2      -------KSLIHYDKYNKVKFDNKLCLPSKKSSLSDRRISVVTE----------------
A0A2V2DJ66      -------------------------------QVAASNADRASTE----------------
R7L5A9          -------------------------------QVAASNADRATTE----------------
A0A2V6JLK8      -------------------------------LLHKAEGDTPDAE----------------
A0A2W5Z1A5      -------------------------------LLHHEIGDSPDAE----------------
A0A2V6EA09      -------------------------------LLHREAGDTPDAE----------------
A0A2V6GQI7      -------------------------------LLHREAGDTPDAE----------------
A0A2A2XXW5      -------------------------------LQSHLHPTSSPAE----------------
A0A3R5R2M8      --------------------------------PLIRNDHSVIAE----------------
A0A411SUQ6      --------------------------------LFIQDEHSVIAE----------------
A0A2N8HZF2      --------------------------------LFIQDEHSVIAE----------------
A0A354E720      --------------------------------LFIQDEHSVIAE----------------
B2UPB6          --------------------------------LFIQDEHSVIAE----------------
A0A3C1HEJ2      -------------------------------VIMADPRLVAGAE----------------
A0A1V6JU76      -------------------------------LQAHLHPQSNAAE----------------
A0A1Q6UHJ9      -------------------------------QVAVSNADRATTE----------------
A0A2V2BXR0      -------------------------------QVAVSNADRATTE----------------
A0A2D8V0G3      -------------------------------LQAHLHPQSNAAE----------------
A0A348S017      -------------------------------MQAHLHPQSNAAE----------------
A0A3C1UUV7      -------------------------------MQAHLHPQSNAAE----------------
A0A350I3V2      -------------------------------MQAHLHPQSNAAE----------------
A0A3D3XF90      -------------------------------MQAHLHPQSNAAE----------------
A0A2D7B522      -------------------------------MQAHLHPQSNAAE----------------
A0A356NIC2      -------------------------------MQAHLHPQSNAAE----------------
R7DZW0          -------------------------------IVVNLEEPSELSE----------------
A0A2N8HID1      -------------------------------IVVNLEEPSELSE----------------
A0A2N8HS06      -------------------------------IVVNLEEPSELSE----------------
A0A3R8IT45      -------------------------------QVVSNNADRQVSE----------------
A0A1H1MGC9      -------------------------------QIVANNQDKQVVE----------------
A0A2A2PYE8      -------------------------------QIVINNADRQVSE----------------
A0A2T6CN73      -------------------------------QIVATNTDRLASE----------------
A0A2N8HDG3      --------------------------------RMFTDEHSVISE----------------
A0A2U8DZK4      ------------------------------------PLDPAEDE----------------
A0A1D8AWD4      ------------------------------------DPSSPEGE----------------
A0A2T6DFL8      ------------------------------------GDDPAELE----------------
A0A178IH18      ------------------------------------SGDPADAE----------------
A0A2T6DT99      ------------------------------------GEDPAELE----------------
A0A1G3ZT33      ------------------------------------PDNPAESE----------------
A0A3E1E2T2      ------------------------------------GD-PAETE----------------
B1ZMW1          ------------------------------------ED-PAEAE----------------
A0A3D1TI55      -------------------------------PLVEEGPDSPHAE----------------
A0A2G4G428      -------------------------------LLAMHEKDVVAVE----------------
A0A3E1ET42      -------------------------------ILHKQSGLSPDAE----------------
A0A2A2YDW8      -------------------------------VLHKQSGMSPDAE----------------
A0A352XLN9      -------------------------------VLHKQSGMSPDAE----------------
A0A3D0YP62      -------------------------------VLHRQSGMSPDAE----------------
A0A3D3DV47      -------------------------------VLHRQSGMSPDAE----------------
A0A2A2QX62      -------------------------------VLYKQSGMSPDAE----------------
A0A3N5WCF1      -------------------------------ILHKQSGMSPDAE----------------
A0A2E5XJ49      -------------------------------VLHKQSGMSPDAE----------------
A0A2E6SBY8      -------------------------------VLHKQSGMSPDAE----------------
A0A2E5QMS4      -------------------------------TLHKQSGMSPDAE----------------
A0A2E7YXQ3      -------------------------------ILHKQSGMSPDAE----------------
A0A2E3H787      -------------------------------VLHKQSGMSPDAE----------------
A0A2E7AGN1      -------------------------------VLHKQSGMSPDAE----------------
A0A2E7AKY7      -------------------------------VLHKQSGMSPDAE----------------
A0A3D4CU34      -------------------------------VLHKQSGMSPDAE----------------
A0A2E8M146      -------------------------------VLHKQSGMSPDAE----------------
A0A355S8S2      -------------------------------VLHKQSGMSPDAE----------------
A0A2D6DVN8      -------------------------------VLHKQSGMSPDAE----------------
A0A3C1W2R2      -------------------------------VLHKQSGMSPDAE----------------
A0A2E3NAY6      -------------------------------VLHKQSGMSPDAE----------------
A0A2E3II01      -------------------------------VLHKQSGMSPDAE----------------
A0A368B8C5      -------------------------------VLHKQSGMSPDAE----------------
A0A3R7RBB5      -------------------------------VLHKQSGMSPDAE----------------
B4DB23          -------------------------------ILMKNAGDTSDAE----------------
A0A139TUL1      --------------------------------LVVINSRSFMEE----------------
A0A2N8HCB0      --------------------------------LVVMNGRSLMEE----------------
A0A2N8HP04      --------------------------------MVVTNGRSFMEE----------------
A0A2N8HRJ0      --------------------------------LVVTNGRSFMEE----------------
A0A366HAG0      -------------------------------TLMHATGITPDAE----------------
A0A3M1I8A3      -------------------------------LQCHLHPQSNASE----------------
A0A0R2XQ77      -------------------------------QAVASNIDRHVTE----------------
A0A2E9IN28      -------------------------------QAVASNVDRHVTE----------------
D5ENH7          -------------------------------QAVASNVDRHVTE----------------
A0A351WE84      -------------------------------PLIHEGPESPHGE----------------
A0A146GCJ0      LPKDLAQKQVLEPLRRSLNRKEREAQLKKHPLIFVEDPSSMQAE----------------
A0A2T6D6H8      IPQEIAGKGVVEPVRKFLNAREATAQAKRHPLVFIDDPASLQAE----------------
A0A1V5QDZ6      -------------------------------PLTEEGPDSPHAE----------------
A0A3D4HF88      -------------------------------IAVASNADRRVTE----------------
A0A351MR11      -------------------------------LLARQTKDKMAIE----------------
A0A1V6J089      -------------------------------PLTEAGQSSGQGE----------------
A0A3C1BZR1      -------------------------------PLTEAGQSSGQGE----------------
A0A1H6KPB7      -------------------------------LLHLMNGSSPDAE----------------
A0A2E9ISN4      -------------------------------LYLPIDKFNPESD---IFVAAKGTNQIAT
B9XAX1          -------------------------------HIVADDPGSICSE----------------
I0JYY7          -------------------------------LIKGEGIDEIPKDIPFALTTYSSPESFVS
A0A3E1EJT7      -------------------------------QIVSNGSDPAIVE----------------
A0A317ZP96      -------------------------------QAVASNVDRHVTE----------------
A0A2D5WGA5      -------------------------------SLLDEGDESPHAE----------------
A0A2E7SSH2      -------------------------------SLMDEGDESPHAE----------------
A0A349GXM8      -------------------------------PIVTEEHSTGAIE----------------
B3DZK9          -------------------------------KLKKHQPETYEGDIPYALMTYALPESEVS
A0A2A2XV69      -------------------------------LLINGNDDNPDAE----------------
A0A3C1VB86      -------------------------------LAAAQDSNSPNAE----------------
A0A146G2Q9      -------------------------------LLVNEAKDNADAE----------------
A0A2T6D3Y2      -------------------------------LLVNETKENADAE----------------
A0A2V2SDV4      -------------------------------AILDEGAESPHAE----------------
A0A2V5PK75      -------------------------------LILDEGVDSPHAE----------------
A0A1V6DME1      -------------------------------SLLQEGAESPHAE----------------
A0A3D3DIJ3      -------------------------------LLVDEGTESPHAE----------------
A0A2D5VY59      -------------------------------SLLLEGPDSPHAE----------------
A0A2D8UZZ4      -------------------------------SLLLEGPDSPHAE----------------
A0A353DV86      -------------------------------SLLLEGPDSPHAE----------------
A0A2E5EPT8      -------------------------------VLMNEDPDTPHAE----------------
A0A350EWA4      -------------------------------SLLDEGPDSPHAE----------------
A0A2N8HD92      -------------------------------ILHSSDVLGPDAE----------------
A0A2N8HIT2      -------------------------------ILHSSDVMGPDAE----------------
A0A354EBD3      -------------------------------ILHSSGVMGPDAE----------------
A0A355VEB2      -------------------------------ILHSSGVMGPDAE----------------
A0A2N8IMT3      -------------------------------ILHSSDAMGPDAE----------------
R6K1U5          -------------------------------ILHSSDAMGPDAE----------------
A0A2N8IWC2      -------------------------------ILHSSDAMGPDAE----------------
A0A2N8I441      -------------------------------ILHSSDAMGPDAE----------------
A0A1Q6UTU9      -------------------------------ILHSSDAMGPDAE----------------
A0A2N8I3A6      -------------------------------ILHSSDAMGPDAE----------------
A0A410SCC4      -------------------------------ILHSSDAMGPDAE----------------
A0A3R5VEW0      -------------------------------ILHSSDVMGPDAE----------------
A0A411SSG2      -------------------------------ILHSSDVMGPDAE----------------
B2UKW3          -------------------------------ILHSSDVMGPDAE----------------
A0A1M6RLZ4      -------------------------------VLHKQSGASPDAE----------------
A0A354T7G8      -------------------------------VLHRSSGFNPDAE----------------
A0A2S7U4L6      -------------------------------VLYKMSTASPDAE----------------
A0A2E8MEZ0      -------------------------------VLHKQSGMSPDAE----------------
A0A2E3EC33      -------------------------------VLXRQSGLSPDAE----------------
A0A2E4GN01      -------------------------------ILHRQSGLSPDAE----------------
A0A1Z8XU55      -------------------------------VIHKQSGLSPDAE----------------
A0A2E1RQR9      -------------------------------VIHKQSGLSPDAE----------------
A0A2E3ISQ4      -------------------------------VLHKESGLSPDAE----------------
A0A2D6W6F4      -------------------------------VLHKESGLSPDAE----------------
A0A2D8Z5A8      -------------------------------VLHKESGLSPDAE----------------
                                                           :                

A0A2A2XVF1      -AYRTLRVSISML-GPEEER--RVLLFVSAIPEEGKTYTSLNTAVVFAQQGLKTLLIDAD
A0A2V5UHJ2      -AYRSFRSALLLS-QAGGPP--HTILVTSAARGEGKTTTLVNSAIVFAQLGIRVLIIDAD
A0A2V5PST3      -SYRTIRTALLLS-EPEATR--KVILLTSPSPGEGKTATTLNLGIALAQDSFKVLIIDAD
A0A2V5PXM3      -AFRTLRTAISML-GRKEER--RVFLFTSAVPSEGKTFCSLNFAISLAQQGLRTLIIDCD
A0A139SU05      -AFMGIYGAAKTH-SLVDYP--KSMLVTSTIPGEGKTLVSANLAASFARHGKRTLLVDCD
A0A1D8AZK8      -AFLSVYSAVKIQ-SKLDFP--KSVLVTSTIPGEGKTMISCNLAASFARHGKRVLIIDCD
A0A1Q6UXG8      -CFHILRNNVDSM-LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGD
A0A2N8I9W1      -CFHILRNNVDSM-LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGD
A0A3R5SIG7      -CFHILRNNVDSM-LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGD
A0A2N8IBZ6      -CFHILRNNVDSM-LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGD
A0A2N8IJW9      -CFHILRNNVDSM-LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGD
R6J100          -CFHILRNNVDSM-LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGD
A0A139TV24      -YFHIMCHNVDSM-LPFSEHQGHVILLASTTPGEGKTFISANLAQAFSKIGKRVLLIDGD
A0A2N8HT11      -YFQILCHNADSM-LPVTRNQGHVILLTSTMQGEGKTFISANLAMSFANIGKRVLVIDGD
R7DS70          -YFQILCHNADSM-LPVTRNQGHVILLTSTMQGEGKTFISANLAMSFANIGKRVLVIDGD
A0A2N8HNL6      -YFQILCHNADSM-LPVTRNQGHVILLTSTMQGEGKTFISANLAISFANIGKRVLVIDGD
A0A1V5QB01      -AYRNVRSALLFS-VAGSQS--KFIAMTSAVPKEGKTTTCLNLAVSLAQAGARILMVDSD
A0A139SPN4      -AFTGIYSAAKTH-SLVDYP--KAMLVTSTIPGEGKTLVSANLAASFARHGKRTLLVDCD
A0A1V6E7N1      -AFLSIYSSVKIH-SKLDFP--KSILVTSTIPGEGKTLVSANLAASFARHGRRTLLIDCD
A0A2T6CWI7      -SFLSVYSSIKIH-SKLDFP--KSVLVTSTIPGEGKTLISCNVAGCFARHGKKTLLIDCD
A0A2D9MYT1      -AFRTVRAAISLS-VRAGDL--QILSVTSTVPSEGKSLVASNHAIVTAQTGAKTLLVDCD
A0A258ANJ7      ESFREFRAIIARM-ARCPH---TCHMVVSAVPDEGKTFVSTHLAVSLASQGFRTLLIDMD
A0A139TLN4      -SFPLLAERLVSL-ADENGPGGFSILLTSSCPGEGKTYLAVNLALSLAVAGKKVLLMDMD
A0A1G3ZFT0      -SLRSLRTSLQVN-LSCANN--NIISILGASPGVGKTFVSTNLAYLLATADKRILLVDAD
A0A1Z8ZMT6      -MFRVLRASISLL-GDANQR--KITMITSSIPGEGKTFCAANLALAYAKQGTRTLLIDFD
A0A2E8MCT7      -MFRVLRASISLL-GDTNQR--KITMITSSVPGEGKTFCAANLALAYAKQGTRTLLVDFD
A0A290QGD9      -AFLTLHSSLRLK-DDARAA--KCILVTSTIPGEGKSFTTTNLALTFAAHGEKVVVIDCD
A0A1D8AS58      -SFLTLHSSLRLK-DESKAA--QAILVTSTIPGEGKSFTTTNLALTFAAHGEKVVVIDCD
I6AQC1          -AFLTLHSSLRLR-NDSKNA--QTFLTTSTVPGEGKSFTTTNLALTFAAHGDRVVVLDCD
W0ITH7          -AFLTLHSSLRLR-NDSKNA--QTFLTTSTVPGEGKSFTTTNLALTFAAHGDRVVVVDCD
A0A290Q2Z2      -PFRVLHTNLNLALKGVTPG--RSLVMLSAGPGEGKSTTVLRLARSMGAAGERVLLVDSD
A0A2A2RGK2      -SFRSLRASLTLH-RINEDA--RTFLFTSSMPSEGKTFCSSNFAVTLAQQGFNTLFIDAD
A0A2A2XXF7      -SFRSLRASLTLH-RLNESA--RTFLFTSSMPSEGKTFCSSNFAVTLAQQGFNTLFIDAD
A0A2A2R5D6      -GYRILRAKIDLN-PKSGAG--NTLTVVSGGPGEGKSTTLFNLAYVCAQSGQSVLLVDAD
A0A1J4XH17      -SFRAIDSLLRLN-KASKPA--RVITVTSTLPSEGKSFFTTNLGLTFAANDEKVLIIDAD
A0A3C1VJ32      -AYRVLRTNLLFS-RKDEKL--NTIVIVSAGAGEGKSTTTINLSTVFAQAGNRVLIVDSD
A0A2N9NTX7      -AYRVLRTNLLFS-RKDEKL--NTVAVVSAGAGEGKSTTVFNLACVFAQGSQRVLIVDSD
B9XK55          -AYRVLRTNLMFS-RKDDKL--NTMAVVSAGAGEGKSTTVYNMATVFAQSGHRVVMVDSD
A0A2E6T482      -AYRVLRTNILFAGRKSEDQ--TTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRCLIVDSD
A0A3C0DQZ7      -AYRVLRTNILFAGRKSEDQ--TTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRCLIVDSD
A0A1Z9CBK5      -AYRVLRTNILFAGRTSEXX--TTFSVVSGGAGEGKTTTMFNLAVIFAQMGDRILVVDSD
A0A2D6ZI96      -AYRVLRTNILFAGRTSEXX--TTFSVVSGGAGEGKTTTMFNLAVIFAQMGDRILVVDSD
A0A358KGZ3      -AYRVLRTNILFAGRKSEDQ--TTFTVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSD
A0A2E9ZQX4      -AYRVLRTNILFAGRKSEDQ--TTFTVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSD
A0A3D5JZU0      -AYRVLRTNILFAGRKSEDQ--TTFSVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSD
A0A2E6HCR0      -AYRVLRTNILFAARKSEDQ--TTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVVDSD
A0A1Z8WN04      -AYRVLRTNILFAGRQSEDQ--TTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSD
A0A2D7L1N4      -AYRVLRTNILFAGRQSEDQ--TTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSD
A0A2E2R937      -AYRVLRTNILFAGRQSEDQ--TTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSD
A0A2D5MR66      -AYRVLRTNILFAGRQSEDQ--TTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSD
A0A2E0PDQ1      -AYRVLRTNILFAGRQSEDQ--TTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSD
A0A2E2ZZP9      -AYRVLRTNILFAGRQSEDQ--TTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSD
A0A2A2RGF2      -AYRVLRTNVLFT-RKDDQA--NAITVVSGGAGEGKSTTVLNLATIFAQNGDKVLLVDSD
A0A2G4I5Y6      -AYRVLRTNVLFT-RKDDAA--NAITVVSGGAGEGKSTTVLNLATIFAQNGDKVLLVDSD
A0A3M1I883      -AYRVLRTNVLFS-RKNPND--NTITVVSGGAGEGKSTTIMNLATVFAQNGERVLLVDSD
A0A1V6JZ45      -AYRVLRTNILFS-RKEPGA--NTLTVVSGGAGEGKSTTILNLATVFAQNGQRVLVVDSD
A0A356NPK0      -AYRVLRTNILFS-RKSEKA--TTLTVVSGGAGEGKSTTIFNLATVFAQNDSRILIVDSD
A0A2D7B5P5      -AYRVLRTNILFS-RKXEKA--XTLTVVSGGAGEGKSTTIFNLATVFAQNXSRILIVDSD
A0A3D3XGB5      -AYRVLRTNILFS-RKNEKA--NTLTVVSGGAGEGKSTTIFNLATVFAQNGSRILIVDSD
A0A2V6F8A1      -AYRVLRTNVLFS-RKREDA--NSITVVSGGAGEGKSTTIFNLGVVFAQNGQRVLLVDSD
A0A2V5TNH4      -AYRVLRTNVLFS-RKREDA--NSLTVVSGGAGEGKSTTIFNLAVVFAQNGQRALLVDSD
A0A2V5X5Q6      -AYRVLRTNVLFS-RKREDA--NSLTVVSGGAGEGKSTTIFNLAVVFAQNGQRALLVDSD
A0A139TS01      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
A0A2V5URB2      -SYRKLRAAIFLS-RPEAPP--KTILFTSGTASEGKTITVANTAIMFARLGNRVLLMDAD
A0A2V2DJ66      -AFRTLYSTLKIN-NVSKDA--KVILATSTTPSEGKSFVISNLAFTCALNGEKCIIIDAD
R7L5A9          -AFRSLHSTLKVN-NFSKNA--KVILFTSTTPSEGKSFIVTNLAFTYALHGEKTIIIDAD
A0A2V6JLK8      -AYRILRTNIEFN-RANPEA--NTISLVSGGPGEGKSTTIANLAFICAQGGYSTLIVDAD
A0A2W5Z1A5      -AYRILRTNIEFN-RRNPEA--NTISIASGGPGEGKSTTVTNLGYICAQGGYSTLIVDAD
A0A2V6EA09      -AYRILRTNIEFN-RKNPEA--NTISLVSGGPGEGKSTTIANLAFVCAQGGYSTLIVDAD
A0A2V6GQI7      -AYRILRTNIEFN-RKNPEA--NTISLVSGGPGEGKSTTIANLAFVCAQGGYSTLIVDAD
A0A2A2XXW5      -GFRTLRAAISLA-KNADKL--RVMAFTSTIPSEGKSLVASNFAIVTSQTGLKTLLVDAD
A0A3R5R2M8      -CFHILRNNVDSL-LPRPDAGGYVILLTSTCPAEGKTFASANLAAAFAKAGRKVLLIDGD
A0A411SUQ6      -CFHILRNNVDSM-LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGD
A0A2N8HZF2      -CFHILRNNVDSM-LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGD
A0A354E720      -CFHILRNNVDSM-LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGD
B2UPB6          -CFHILRNNVDSM-LPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGD
A0A3C1HEJ2      -AFRSLRTTLSML-GPVNER--RTFLFTSAVPDEGKTFCTINFAYSLAQQGMRTLLIDCD
A0A1V6JU76      -SFRTVRAAIALG-AKAEKM--RVFTVTSTIPSEGKSLVASNLAVVVAQTGLRTVLVDAD
A0A1Q6UHJ9      -AFRSVHSMLKVN-NIAKDS--KVLLFTSTTPSEGKSFVVTNLALMCAMHGEKTIIIDAD
A0A2V2BXR0      -AFRSVHSMLKVN-NIAKDS--KVLLFTSTTPSEGKSFVVTNLALMCAMHGEKTIIIDAD
A0A2D8V0G3      -GFRTVRAAVSLV-HKSDKF--KVLSMTSTIPSEGKSLVASNLAIVTAQTGVKTLLIDAD
A0A348S017      -GFRTVRAAISLV-HKADKF--KVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDAD
A0A3C1UUV7      -GFRTVRAAISLV-HKADKF--KVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDAD
A0A350I3V2      -GFRTVRAAISLV-HKADKF--KVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDAD
A0A3D3XF90      -GFRTVRAAISLV-HKADKF--KVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDAD
A0A2D7B522      -GFRTVRAAISLV-HKADKF--KVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDAD
A0A356NIC2      -GFRTVRAAISLV-HKADKF--KVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDAD
R7DZW0          -CFPLLAERMVAL-SDGNEGNPLSVLITSTCSGEGKTYLSVNLALSLAVAGKKVLLMDMD
A0A2N8HID1      -CFPLLAERMVAL-SDGNEGNPLSVLITSTCSGEGKTYLSVNLALSLAVAGKKVLLMDMD
A0A2N8HS06      -CFPLLAERMVAL-SDGNGGNPLSVLITSTCSGEGKTYLSVNLALSLAVAGKKVLLMDMD
A0A3R8IT45      -AFLTLHSSLRLR-NDSKNA--QTFLTTSTVPGEGKSFTTTNLALTFAAHGDKVVIVDCD
A0A1H1MGC9      -SFLTLHSSLRLK-DESKRA--QAILVTSTIPGEGKSFTTTNLALTFAAHGEKVVIVDCD
A0A2A2PYE8      -AFLTLHSSLRLK-DESKNA--KCILVTSTIPGEGKSFTTTNLALTFAAHGERVVVIDCD
A0A2T6CN73      -AFLTLHSSLRLK-DESKNA--KCILTTSTIPGEGKSLTTTNLALTFAAHGEKVIVVDCD
A0A2N8HDG3      -YFQILCHNADSM-LPVTRNQGHVILLTSTMQGEGKTFISANLALAFANIGKRVLVIDGD
A0A2U8DZK4      -PFRVLQTNITLALRNKPSHGAQTLVMLSAGPGEGKSTTLLRLARAMGAAGERVLLIDAD
A0A1D8AWD4      -PYRVLQTNLNLAL--TAGKTS-VLVVLSSGPGEGKSTTLRQLALCMAAAGEKVLLIDSD
A0A2T6DFL8      -PYRVLYTNLNLAL--KPGQAH-ALVFSSAGPGEGKSTTLHRLTRLMGEMGDRVLLIDAD
A0A178IH18      -PFRVLQTNISLAR--KDAAPGRTLVMLSAGPGEGKSTTLLRLARAMGEAGARVLLIDSD
A0A2T6DT99      -PFRVLHTNLNLAL--KSDARGRTLILLSAGPGEGKSTTLLRLARAMAKAGERVLLIDSD
A0A1G3ZT33      -PFRVLQTNLNLAL--PPGQPG-SLVVVSAGPGEGKSTTVHHLVRVMAAAGERVLLVDSD
A0A3E1E2T2      -PFRVLHTNLNLAL--KPGEAA-SLVLFSAGPGEGKSTTLHRLVRVMAAGGERVILIDSD
B1ZMW1          -PYRVLQTNLNLAL--KPGQPA-SLVIFSAGPGEGKSTTLFRLARLAAAAGERVVLIDSD
A0A3D1TI55      -AYRVLRTNLQFA-AKDPGA--NAITIVSGGVGEGKSTTLFNLAYVCAQLGDKVLLVDSD
A0A2G4G428      -AVRTIYSSMRVN-PASMSS--HVFLITSTRPSEGKTFVATNLALGFSQHGERVLVIDAD
A0A3E1ET42      -AYRILRTNIEFN-RRSADA--NAITIVSGGAGEGKSTTLVNLAYICAQGGYNTLMIDGD
A0A2A2YDW8      -AYRILRTNIEFN-RKNPED--NSITVVSGAAGEGKSTTLVNLAYICAQGGYTTLMIDAD
A0A352XLN9      -AYRILRTNIEFN-RKNPED--NSITVVSGAAGEGKSTTLVNLAYICAQGGYTTLMIDAD
A0A3D0YP62      -AYRILRTNIEFN-RKNPED--NSITVVSGGAGEGKSTTLCNLAYICAQGGYTTLMIDAD
A0A3D3DV47      -AYRILRTNIEFN-RKNPED--NSITVVSGGAGEGKSTTLCNLAYICAQGGYTTLMIDAD
A0A2A2QX62      -AYRILRTNIEFN-RKNPED--NSITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDAD
A0A3N5WCF1      -AYRILRTNIEFN-RKNPED--NAITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDAD
A0A2E5XJ49      -AYRILRTNIEFN-RKNPED--NAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A2E6SBY8      -AYRILRTNIEFN-RKNPED--NAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A2E5QMS4      -AYRILRTNIEFN-RNNPED--NAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDSD
A0A2E7YXQ3      -AYRILRTNIEFN-RNNPED--NAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDSD
A0A2E3H787      -AYRILRTNIEFN-RNNPED--NSITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A2E7AGN1      -AYRILRTNIEFN-RSNPED--NSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A2E7AKY7      -AYRILRTNIEFN-RSNPED--NSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A3D4CU34      -AYRILRTNIEFN-RSNPED--NSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A2E8M146      -AYRILRTNIEFN-RNNPED--NSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A355S8S2      -AYRILRTNIEFN-RNNPED--NSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A2D6DVN8      -AYRILRTNIEFN-RNNPED--NSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A3C1W2R2      -AYRILRTNIEFN-RNNPED--NSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A2E3NAY6      -AYRILRTNIEFN-RNNPED--NSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A2E3II01      -AYRILRTNIEFN-RNNPED--NSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A368B8C5      -AYRILRTNIEFN-RNNPED--NSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
A0A3R7RBB5      -AYRILRTNIEFN-RNNPED--NSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDAD
B4DB23          -AYRILRAAVEFN-KPYRDA--NTFTLISGGPGEGKSTTLNNLAYTCAKGGYNVLVVDAD
A0A139TUL1      -CFHILRNNTELLLLPNPEKASRVVFLTSTRTGEGKTFTALNLAAAYAQTGKKVLLIDGD
A0A2N8HCB0      -CFHILRNNAELMLLPNPEEASRVLFMTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGD
A0A2N8HP04      -CFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGD
A0A2N8HRJ0      -CFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGD
A0A366HAG0      -AYRILRTNLEFN-RRDPNA--NCISVASGSPGEGKSTTMVNLATICAQGGYNTLIIDAD
A0A3M1I8A3      -SIRSIRAAVALG-DHGEKL--RVLTVTSTIPSEGKSIIAANLAIAMAQTGYRTLLVDAD
A0A0R2XQ77      -SFRSIHSALRLS-DESRHA--KVLVTTSTVPGEGKSFISSNLALTFANHGEKTLLLDGD
A0A2E9IN28      -TFRTIHSALKLN-DESKNA--KIILTTSTVPSEGKSFVSSNLSLTFANHGEKTLLIDCD
D5ENH7          -TFRSIHSAMKLN-DESKNA--KIIVTTSTVPSEGKSFVSSNLALTFANHGEKTLLLDAD
A0A351WE84      -PYRVLRTNMQFS-NKGIHG--GAFAVISGGVGEGKSTTLFNLAYTCAQLGYKTIVVDSD
A0A146GCJ0      -AIRTLRTSISLL-GKQDDR--KTFLFASAIPQEGKSFTSLNFAHALAQKGLRTVVIDAD
A0A2T6D6H8      -AIRTLRTSLSLL-GKQETR--RTFLFASSIPEEGKTFTSLNFAHSLAQQGLRTVIIDAD
A0A1V5QDZ6      -AYRVLKTNLQFA-NKGTLG--GAFALVSGGVGEGKSTTLFNLAYVCAQLGDKVLIVDSD
A0A3D4HF88      -AFRSVHSALNLN-EISKNA--QIILMTSTVPSEGKSFVSTNLAYTYASHGERVVLIDCD
A0A351MR11      -SLRAIHSVMKIN-PSAANA--KVLLTTSTRPGEGKTFVTTNIALTFAQHGERVLVVDAD
A0A1V6J089      -AYRSLRTSMALL-GREDNK--KIFAVISGGVGEGKSTTLFNLAYVCAEQGSKVLVIDSD
A0A3C1BZR1      -AYRALRTSLALL-AREGKQ--KIFTVISGGVGEGKSTTLFNLAYVCAEQGSKVLIIDSD
A0A1H6KPB7      -AYRILRTNIELK-RKDTNV--VTLALVSGNAGEGKTTTLCNLAYVFAQGGFSTLMIDAD
A0A2E9ISN4      ETYRRIRLNLLKQ-FGQDEN--ISFTVTSSQSGDGKTFNVANIALPFAWVGKRVLLIDAD
B9XAX1          -AFRTLRTTTGIL-GHEEGK--RITLFTSADPNEGKTFFSLNHAICQAQGGKLTLLIDLD
I0JYY7          NAFRQIRTLLHYA-IPNRKP--QLIAITSTYPSEGKSSTIVNLATVLGQQG-TVLIIDGD
A0A3E1EJT7      -AFLSLYSNLRIN-DESRNA--RLILVTSTLPSEGKSFITTNLGLTFASQGQRTVIVDCD
A0A317ZP96      -TFRTIHSALKLN-DESKNA--KVIITTSTVPGEGKSFISSNMALTFANHGEKTLLLDGD
A0A2D5WGA5      -AYRVLRTNILFAGRKDESQ--TTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRVLIVDSD
A0A2E7SSH2      -AYRVLRTNILFAGRQSEDQ--TTFSVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSD
A0A349GXM8      -AYRALRTSVLAE-LAKKHE--KILMITSADSREGKTLTALNLSIMVVQMGKRVLLVDMD
B3DZK9          NGFRSIRTLLHYT-IAGRRP--QVITVTSTLESEGKSGTTVNLATVLGQQG-TVLVIDAD
A0A2A2XV69      -AYRIMRTNIEFN-RKNPAS--NSITIVSGGPGEGKSTTLNNLAYTFAKGGYTTLVVDAD
A0A3C1VB86      -VFRTLRATLSML-GRENDR--KTYLFTSSLPGEGKTFTSVNYAVSLAQQGLRTLLVDID
A0A146G2Q9      -AYRILRTNIEFN-RKNPDA--NTITMISGGAGEGKSTTMSNLASIFASGGYSTLIVDAD
A0A2T6D3Y2      -AYRILRTNIEFN-RKNPDA--NTITMISGGAGEGKSTTMSNLASIFASGGYSTLIVDAD
A0A2V2SDV4      -AYRVLRTNLLFS-RKDDKL--NTVAIVSAGAGEGKSTTVFNLAAVFAQGGQRVLIVDSD
A0A2V5PK75      -AYRVLRTNLLFS-RKDDKL--NSVAVVSAGAGEGKSTTVFNLACVFAQSRQRVLIVDSD
A0A1V6DME1      -AYRVLRTNLLFS-RKDDKL--NSIAVVSAGAGEGKTTTVFNLATVFAQGNQRVIIVDSD
A0A3D3DIJ3      -AYRVLRTNLLFS-RKDDKL--NTIAIVSAGAGEGKSTTVFNLAAVFAQSGQRTIIVDSD
A0A2D5VY59      -AYRVLRTNILFS-KKDPKF--NALTVVSGGAGEGKSTTIFNLATIFAQNDSRVLIIDSD
A0A2D8UZZ4      -AYRVLRTNILFS-KKDPKF--NALTVVSGGAGEGKSTTIFNLATIFAQNDSRVLIIDSD
A0A353DV86      -AYRVLRTNILFS-KKDPKF--NALTVVSGGAGEGKSTTIFNLATIFAQNDSRVLIIDSD
A0A2E5EPT8      -PYRVLRTNILFT-NKKPNA--NTITVVSGGAGEGKSTTVLNLATIFAQNGNRVLLVDSD
A0A350EWA4      -AYRVLRTNILFS-RKSEDQ--NTITVVSGGAGEGKSTTLFNLACIFAQNGARVLIVDSD
A0A2N8HD92      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
A0A2N8HIT2      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
A0A354EBD3      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
A0A355VEB2      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
A0A2N8IMT3      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
R6K1U5          -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKSTTLCNLAYICAQGGYATLMIDAD
A0A2N8IWC2      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
A0A2N8I441      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKSTTLCNLAYICAQGGYATLMIDAD
A0A1Q6UTU9      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
A0A2N8I3A6      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
A0A410SCC4      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKSTTLCNLAYICAQGGYATLMIDAD
A0A3R5VEW0      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
A0A411SSG2      -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
B2UKW3          -AYRILRTNIEFN-KKGLEE--ISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDAD
A0A1M6RLZ4      -AYRILRTNIEFN-RKNPDD--NSITVVSGGAGEGKSTTLVNLAYICAQGGYSTLMIDAD
A0A354T7G8      -AYRILRTNIEFN-RKSPDA--NCFSVVSGGAGEGKSTTMVNLAYVCAQGGYNVLLIDAD
A0A2S7U4L6      -AYRILRTNIEFN-RPSQDD--NAITVVSGGAGEGKSTTLVNLAYICAQGGYSTLMIDAD
A0A2E8MEZ0      -AYRILRTNIEFN-RKNPED--NSITVVSGGAGEGKSTTLVNLAYVCSQGGYTTLMVDAD
A0A2E3EC33      -AYRILRTNIEFN-RKTADA--NSMTIVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDAD
A0A2E4GN01      -AYRILRTNIEFN-RKTSDA--NSMTIVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGD
A0A1Z8XU55      -AYRILRTNIEFN-RKNADA--NSITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGD
A0A2E1RQR9      -AYRILRTNIEFN-RKNADA--NSITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGD
A0A2E3ISQ4      -AYRILRTNIEFN-RKNADA--NSITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGD
A0A2D6W6F4      -AYRILRTNIEFN-RKNADA--NAITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGD
A0A2D8Z5A8      -AYRILRTNIEFN-RKNADA--NAITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGD
                     .                      .     **:    .            :.:* *

A0A2A2XVF1      LRRPSLHKAL-LTVDTLPNGLTDYFSG-NSRLASVII--PTEI-------ENLALLPAGR
A0A2V5UHJ2      LRRPRCHALL--RMENL-AGLSDLLAG-QIELQSAIR--PTSA-------ENLSFISAGA
A0A2V5PST3      LRRGSCHSRL--GIGNH-RGLSNLLAG-NVSIEEVVQ--RTSI-------AGLSVLTRGA
A0A2V5PXM3      LRRPMVENTLQNNNQRG-FGLTDYLTG-QKDFKAVVH--ASGS-------ENFFYIPAGS
A0A139SU05      LRRPMLHRRF--DLANT-SGIIAFYEA-DGDLDCDLP--NDSTLGIVKLSENLSLLRSGG
A0A1D8AZK8      MRRPMLHRHF--KLTNE-VGLIAWFEA-GAKIPADPF--TDAALGLAKVDENLYLLRSGG
A0A1Q6UXG8      FRKSSLTRRL--GGSGR-KGLTSILLQQNPDTTGIIRPLGENS-------RGMDILYTGP
A0A2N8I9W1      FRKSSLTRRL--GGSGR-KGLTSILLQQSSDTTGIIRPLRENS-------RGMDILYTGP
A0A3R5SIG7      FRKSSLTRRL--GGSGR-KGLTSILLQQSSDTTGIIRPLRENS-------RGMDILYTGP
A0A2N8IBZ6      FRKSSLTRRL--GGSGR-KGLTSILLQQSSDTTGIIRPLRENS-------RGMDILYTGP
A0A2N8IJW9      FRKSSLTRRL--GGSGR-KGLTSILLQQSSDTTGIIRPLRENS-------RGMDILYTGP
R6J100          FRKSSLTRRL--GGSGR-KGFTSILLQQSSDTTGIIRPLRENS-------RGMDILYTGP
A0A139TV24      LRKTSLSSQL--GGKGR-KGLSTILLNKVSDLSSVIHPLPDHP--------GVDILYGGP
A0A2N8HT11      LRKASLSKQL--DGKGR-KGLSTILLRKVEDPFSVIRTLPEHP--------GVDILYAGP
R7DS70          LRKASLSKQL--DGKGR-KGLSTILLRKVEDPFSVIRTLPEHP--------GVDILYAGP
A0A2N8HNL6      LRKASLSKQL--DGKGR-KGLSTILLRKVEDPFSVIRTLPEHP--------GVDILYAGP
A0A1V5QB01      MRRGELHKFF--GLEGG-RGLSDLLAG-QAKPEAVIQ--RTGL-------PNLDLVATGP
A0A139SPN4      LRRPMLHRRF--DLANT-SGLIPFYES-GASLDTDLS--TDPTLGIVKLNENLSLLRSGG
A0A1V6E7N1      LRRPMMHRHF--KQSNQ-AGIITWFEK-GADLSVEPQ--KNPDLGIISLGENLSLLCSGG
A0A2T6CWI7      LRRPMLHRHF--KQENK-NGLITWFES-GAMLDSNLT--THPSLGIVPVAENLWLLCSGG
A0A2D9MYT1      LRRPSVHKAF--QIQSP-KGLSSYLLGKVDTIDSIVH--QTEV-------ANLDIICCGA
A0A258ANJ7      LRHSQLAQVF--GIPNTRKGVVDLLLE-EVSFAEVCL--SGGI-------AHLAIMPAGK
A0A139TLN4      LRKGTLSSLL--GGEGK-PGTGDLDRVGEGGWRSLLEK-SSVS-------DHLDYLFAGT
A0A1G3ZFT0      LRKGTVHKYF--NLDPS-PGFAELIQG-SVNIEEALK--LTSH-------HNLTILPRGN
A0A1Z8ZMT6      LRKPAVHKIFNEERAAR-PGIVNVLNGTAAANQAITV--YPGL-------DTLSVIYSGP
A0A2E8MCT7      LRKPAVHKIFNEERAAR-PGIVNVLNGTAAANQAITV--YPGL-------DTLSVIYSGP
A0A290QGD9      LRRPNIHKSF--RIANQ-RGVIDLCGG-DTRVEDVVV--KGPH-------PNLDIIPAGG
A0A1D8AS58      LRKPNIHKSF--RLENI-KGVIDVCAG-THTIDQVVI--KGVH-------PNLDVIPAGG
I6AQC1          LRKPNIHKSF--RRENL-KGVIDVCAG-SATIDDVVM--RDVH-------PNLDVIATGG
W0ITH7          LRKPNIHKSF--RRENL-KGVIDVCAG-SATIDDVVM--RDVH-------PNLDVIATGG
A0A290Q2Z2      LRRPTQHQLA--ALPKE-PGLADLLQG-KATLEKVTQ--RGVS-------PGLDFIPCGA
A0A2A2RGK2      LRKPGGSIVF-FGENRK-PGLSEVLMR-TCTMKNAIV--PTHI-------DNLQIMTAGG
A0A2A2XXF7      LRKPGGSIVF-YGENRK-PGLSELLMR-SCAMKNAVM--PSHI-------DGLSILTAGG
A0A2A2R5D6      LRRPTVHTIL--GIENE-AGISEAMRG-LGEAHQYIR--ATSV-------PNMHVITAGD
A0A1J4XH17      LRMPSIGSSL--QLDKK-KGILQYCEE-GATLDDIVN--KNVY-------SNFDVITAGG
A0A3C1VJ32      LRRPTLHKLF--KVANN-LGLTNYLLK-QNTVVEVVQ--TTSV-------PNLDFMASGK
A0A2N9NTX7      LRRPTLHRML--RVSNS-IGLTNYLLK-QNTLEEVIQ--TTNL-------PSMDFLASGK
B9XK55          LRRPTLHKLV--NVSNT-IGLTNYLLK-QNTLEEVIQ--TTRL-------PNLDFMASGK
A0A2E6T482      LRRPSMHRYL--QVSNN-IGLTNYLLG-QVXIDEVIQ--TTQI-------PSLHFIPSGK
A0A3C0DQZ7      LRRPSMHRYL--QVSNN-IGLTNYLLG-QVTIDEVIQ--TTQI-------PSLHFIPSGK
A0A1Z9CBK5      LRRPSMHRYF--KVSNN-IGLTNLLLG-QNTLDEVIQ--TSDS-------PNLHFIPSGK
A0A2D6ZI96      LRRPSMHRYF--KVSNN-IGLTNLLLG-QNTLDEVIQ--TSDS-------PNLHFIPSGK
A0A358KGZ3      LRRPSMHRYF--KVSNT-IGLTNLLLG-QNTLDEVIQ--TSES-------PNLHFIPSGK
A0A2E9ZQX4      LRRPSMHRYF--KVSNT-IGLTNLLLG-QNTLDEVIQ--TSES-------PNLHFIPSGK
A0A3D5JZU0      LRRPSMHRYF--KVSNT-IGLTNLLLG-QNTLDEVIQ--TSES-------TNLHFIPSGK
A0A2E6HCR0      LRRPSMHRYF--KVTNS-IGLTNLLLG-QNTLDEVIQ--TTDI-------PNMHFIPSGK
A0A1Z8WN04      LRRPSMHRYF--KVSNN-IGLTNLLLG-QNTVEEVVQ--ITDI-------PNLHFIPSGK
A0A2D7L1N4      LRRPSMHRYF--KVSNN-IGLTNLLLG-QNTVEEVVQ--ITDI-------PNLHFIPSGK
A0A2E2R937      LRRPSMHRYF--KVSNN-IGLTNLLLG-QNTVEEVVQ--ITDI-------PNLHFIPSGK
A0A2D5MR66      LRRPSMHRYF--KVSNS-IGLTNLLLG-QNTVEEVVQ--ITDI-------PNLHFIPSGK
A0A2E0PDQ1      LRRPSMHRYF--KVSNS-IGLTNLLLG-QNTVEEVVQ--ITDI-------PNLHFIPSGK
A0A2E2ZZP9      LRRPSMHRYF--KVSNS-IGLTNLLLG-QNTVEEVVQ--ITDI-------PNLHFIPSGK
A0A2A2RGF2      LRRPSLHKRL--GLSNS-LGLTNYLLG-QNKLEEVVQ--HSTL-------ANLHFLPSGR
A0A2G4I5Y6      LRRPSLHKRL--GLSNS-LGLTNYLLG-QNTLEEVIQ--HSPL-------ANLHFLPSGR
A0A3M1I883      LRRPSLHKFI--GVSNS-IGLTNYLMK-QNTLEEVIQ--TTSL-------PTLDFLPSGK
A0A1V6JZ45      LRRPSLHKFL--AVSNS-IGLTNYLMK-QNTLEEVIQ--TTKL-------PMMDFLASGK
A0A356NPK0      LRRPSLHKHV--GVSNA-LGLTDYLLA-TKSLEEVVQ--TTKH-------ENLDFLPSGK
A0A2D7B5P5      LRRPSLHKHV--GVSNA-LGLTDYLLA-TKSLEEVVQ--TTKH-------ENLDFLPSGK
A0A3D3XGB5      LRRPSLHKHV--GVSNA-LGLTDYLLA-TKSLEEVVQ--TTKH-------ENLDFLPSGK
A0A2V6F8A1      LRRPSLHKLL--NVSNA-VGLTNYLLR-QNTLEQVIQ--TTSI-------PTLDFLPSGK
A0A2V5TNH4      LRRPSLHKLL--NVSNS-VGLTSYLLR-QNTLEEVIQ--TTSI-------PTLDFLPSGK
A0A2V5X5Q6      LRRPSLHKLL--NVSNS-VGLTNYLLR-QNTLEEVIQ--TTSI-------PTLDFLPSGK
A0A139TS01      LRRSKLHRYY--ELDNE-AGLTSYLLE-DYPLEEVIF--QTPV-------ENLYVMPAGP
A0A2V5URB2      LRRPTCHKAL--KVQGA-TGLADYLAG-QEELDKVIK--LTSI-------PNLWILNGGS
A0A2V2DJ66      LRLPALAKVL--GISAS-KGLVSYIEE-GDSLDDVII--KDYF-------QNLDVLVCER
R7L5A9          LRLPAMAKVL--GITAK-DGLIGHIEE-GKPLEDAII--HDYF-------PNLDVLVCEK
A0A2V6JLK8      LRRPVQHLLF--DLSNE-IGLTNYLTT-DMDLDQAIL--PTNV-------ENLSILPSGI
A0A2W5Z1A5      LRRPVQHMHF--DLDNK-IGLSNYLTS-NMRIEEVIR--PTSV-------ENLSLLPSGV
A0A2V6EA09      LRRPIQHEFF--GVSNT-AGLTSYLTT-EMPLEKVIL--PTAV-------ENLSILPSGV
A0A2V6GQI7      LRRPIQHEFF--GVSNT-AGLTSYLTT-EMPLEKVIL--PTAV-------ENLSILPSGV
A0A2A2XXW5      LRRPSVHKAF--QLQSP-VGLSAYLSGRTDNFSEFVH--TTEV-------PNLDVICCGA
A0A3R5R2M8      LRKRSLSRQL--GGYGR-RGLTSILLNRLQTAALPIRRIEETG-------ISFDFLGAGP
A0A411SUQ6      FRKSSLTRRL--GGSGR-KGLTSILLQQTTDTTGIIRPLGENS-------RGMDILYTGP
A0A2N8HZF2      FRKSSLTRRL--GGSGR-KGFTSILLQQNPDTTGIIRPLGGNS-------RGMDILYTGP
A0A354E720      LRKSSLTRRL--GGSGR-KGLTSILLRQNPDTAGVIRPVGEDT-------RGMDVLYTGP
B2UPB6          FRKSSLTRRL--GGSGR-KGLTSILLQQTTDTTGIIRPLGENS-------RGMDILYTGP
A0A3C1HEJ2      LRCPTVEEYLLGRNTES-PGVSDYLSG-KKDFSDIIQ--KSQT-------ENFCFIGAGT
A0A1V6JU76      LRRPSLHKAF--QLHSP-MGLTAYLTEQTNRVDDVIQ--TTEV-------TNLDVACCGQ
A0A1Q6UHJ9      LRLPAMAKVL--GIESR-DGIVGYVED-GRPLEDCVI--KDYY-------PNLDVLPCEK
A0A2V2BXR0      LRLPAMAKVL--GIESR-DGIVGYVED-GRPLEDCVI--KDYY-------PNLDVLPCEK
A0A2D8V0G3      LRRPSMHKAF--QMQSP-IGLSAYLTGQITDPSEITQ--TTEV-------PNLDLICCGA
A0A348S017      LRRPSMHKAF--QMQSP-IGISSYLTDQVSDIAEITQ--KTEV-------PNLDIICCGA
A0A3C1UUV7      LRRPSMHKAF--QMQSP-IGISSYLTDQVSDIAEITQ--KTEV-------PNLDIICCGA
A0A350I3V2      LRRPSMHKAF--QMQSP-IGISSYLTDQVSDIAEITQ--KTEV-------PNLDIICCGA
A0A3D3XF90      LRRPSMHKAF--QMQSP-IGISSYLTDQVSDIAEITQ--KTEV-------PNLDIICCGA
A0A2D7B522      LRRPSMHKAF--QMQSP-IGISSYLTDQVSDIAEITQ--KTEV-------PNLDIICCGA
A0A356NIC2      LRRPSMHKAF--QMQSP-IGISSYLTDQVSDIAEITQ--KTEV-------PNLDIICCGA
R7DZW0          LRKGALSALL--GGAGK-PGLGDLEQAGEGGWRSLVEQ-SPVS-------DHLDYLFAGT
A0A2N8HID1      LRKGALSALL--GGAGK-PGLGDLEQAGEGGWRSLVEQ-SPVS-------DHLDYLFAGT
A0A2N8HS06      LRKGALSALL--GGAGK-PGLGDLEQAGEGGWRSLVEQ-SPVS-------DHLDYLFAGT
A0A3R8IT45      LRKPNIHKSF--RRENL-KGVIDVCAG-SATIDDVVM--RDVA-------PNLDVIATGG
A0A1H1MGC9      LRKPNIHKSF--RLENL-KGVIDVCAG-TQTVDQVLC--RNVH-------PNLDVIPAGG
A0A2A2PYE8      LRKPNIHKSF--RLENL-KGVIDICAG-KATIADVAI--RNVH-------PNLDVIPAGG
A0A2T6CN73      LRKPNIHKSF--RIENI-RGVIDVCSG-KATLDEVIV--RNQQ-------PNLDVLPTGG
A0A2N8HDG3      LRKASLSKQL--DGKGR-KGLSTILLRKVEDPFSVIRT-LPEH-------AGVDILYAGP
A0A2U8DZK4      LRRPTQHRLF--NVAKT-PGLADLLQS-KVTLDQCRS--RNIA-------PGLDFIPSGT
A0A1D8AWD4      VRRPTQHKLA--GLSRD-PGLTDIVLN-KVPWTAAVV--RDKS-------GLIDFIPAGA
A0A2T6DFL8      LRRPTQHRIA--ERPRS-PGLSDLLTA-QKTLDEVIQ--KSIS-------PGLDFIASGA
A0A178IH18      LRRPTQHQLT--GAAKE-PGLADLLQG-KATLDDVTR--RSIA-------PNLDFIPCGS
A0A2T6DT99      LRRPTQHQLA--GLRKE-PGLAEVLQG-KATLQSVTQ--REIQ-------PNFDFIPCGS
A0A1G3ZT33      VRRPAQHRLM--DQTRE-PGLIDLLLN-KATLESVVR--RDVV-------PGLDFIASGT
A0A3E1E2T2      VRRPTQHHLA--DRPRE-PGLSEFLLN-RKTLDEVIQ--KGLA-------PNLDFIPSGH
B1ZMW1          FRRPAQHRLA--ERPRE-PGLSDWLMN-RQPLETIVQ--RELA-------PNLDFIPSGG
A0A3D1TI55      LRRPALHKIL--GMSND-FGLTNVLMR-DVPIEETIK--STSV-------PNLHFLPSGK
A0A2G4G428      LRLPNVGPSL--GLTGT-EGISRWFND-ESTIDESIV--KNVA-------PNLDVLPVGM
A0A3E1ET42      LRRPKLHTFF--DINNS-VGLTNYLTT-ALMLEDVIL--QTPI-------ENLYFMPSGI
A0A2A2YDW8      LRRPRLHTFF--DINNS-VGLSNYLTT-ELMLEDVIL--QTPV-------ENLFFMPSGI
A0A352XLN9      LRRPRLHTFF--DINNS-VGLSNYLTT-ELMLEDVIL--QTPV-------ENLFFMPSGI
A0A3D0YP62      LRRPRLHTFF--DINNS-VGLTNYLTT-DLLLEDVIL--QTPV-------DNLYFMPSGI
A0A3D3DV47      LRRPRLHTFF--DINNS-VGLTNYLTT-DLLLEDVIL--QTPV-------DNLYFMPSGI
A0A2A2QX62      LRRPRLHTFF--EINNS-VGLTNYLTT-ELMLEDVIL--QTPV-------DNLYFMPSGI
A0A3N5WCF1      LRRPRLHTFF--DINNS-VGLTNYLTT-ELMLEDVIL--QTPV-------DNLYFMPSGI
A0A2E5XJ49      LRRPRLHTFF--DINNS-VGLTNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A2E6SBY8      LRRPRLHTFF--DINNS-VGLTNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A2E5QMS4      LRRPTLHTFF--DINNS-VGLTNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A2E7YXQ3      LRRPTLHTFF--DINNS-VGLTNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A2E3H787      LRRPQLHTFF--DINNS-VGLTNYLTT-DLMLEDVIL--QTPV-------DNLYXLPSGI
A0A2E7AGN1      LRRPTVHTFF--DINNS-VGLSNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A2E7AKY7      LRRPTVHTFF--DINNS-VGLSNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A3D4CU34      LRRPTVHTFF--DINNS-VGLSNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A2E8M146      LRRPNVHTFF--DINNS-VGLSNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A355S8S2      LRRPNVHTFF--DINNS-VGLSNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A2D6DVN8      LRRPNVHTFF--DINNS-VGLSNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A3C1W2R2      LRRPNVHTFF--DINNS-VGLSNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A2E3NAY6      LRRPNVHTFF--DINNS-VGLSNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A2E3II01      LRRPNVHTFF--DINNS-VGLSNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A368B8C5      LRRPNVHTFF--DINNS-VGLSNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
A0A3R7RBB5      LRRPNVHTFF--DINNS-VGLSNYLTT-DLMLEDVIL--QTPV-------DNLYFLPSGI
B4DB23          LRRASQHHFF--DVDNS-FGLTDYLLG-RAEIDEIIK--TTKI-------DNLSFIPSGL
A0A139TUL1      LRKASLSAFC--VGKNS-RGLAHLLMNPLASPDSVLQS-GENF-------PGFDMVPAGP
A0A2N8HCB0      LRKASLSAFY--GGKNA-RGLVHLLMNPQVSPDSVLQS-GRKF-------PGFDLVTAGP
A0A2N8HP04      LRKASLSAFY--GGKNA-RGLVHLLMNPQVSPDSVLQS-GKRF-------PGFDLVTAGP
A0A2N8HRJ0      LRKASLSAFY--GGKNA-RGLVHLLMNPQVSPDSVLQS-GKRF-------PGFDLVTAGP
A0A366HAG0      MRRPRQHTFF--NVPHT-FGLSNYLSS-NVPLEEVVV--QTQV-------DHLYFMPSGV
A0A3M1I8A3      MRRPRLHKAF--QLHNP-VGLPAYLHG-KTDQFEELVT-ATEV-------PNLDMISCAG
A0A0R2XQ77      LRLPNVARSL--QLQND-FGLLDHIEK-GVALDEVIL--KEVY-------PNLDVLPSGG
A0A2E9IN28      LRLPNVARSL--QLEND-FGVLDHIDK-GVDLDEVII--KEVY-------PNLDVLPTGG
D5ENH7          LRLPNVAASM--QLENE-RGVLDHVEK-GMPIEDVTI--REVY-------PNLDVIPTGG
A0A351WE84      LRRPVQHSIL--SMSNR-IGLTNVLMK-DSTLEECVK--PTIV-------PNLSFLPSGR
A0A146GCJ0      LRRPRLKDDLLPDAGDI-DGLTDYLSG-GAPLDQVVR--KTDQ-------DNLFLLPAGH
A0A2T6D6H8      LRKPRLKADLLPEEGDI-SGLTNYLSG-TATLTEVVK--KTPY-------ENLFLLPGGH
A0A1V5QDZ6      LRRPVQHRIL--GVSNR-FGLTNVLMR-DVPIEETIK--TTSV-------PNLHFLPSGK
A0A3D4HF88      LRMPNVAKSM--NLSNE-KGLQQCLKD-GSRPEDVVH--KDVY-------PNLDVMGSGG
A0A351MR11      LRLPNVAPSM--GIETD-NGISKYFNN-EITLDEAIL--KDFE-------PNLDILPVGG
A0A1V6J089      LRRPVQHKMV--GLANR-AGLVNVLTG-ELKPEDVIQ--ETGV-------PNLWMLTSGR
A0A3C1BZR1      LRRPVQHKMV--GLANR-TGMVNVLTG-DLKAEDVIQ--ETGV-------PNLWMMTSGR
A0A1H6KPB7      LRRSKLAEYN--DVECE-YGLSNFLTS-DLALQDVIL--QTHV-------DNLYILPAGP
A0A2E9ISN4      LRLGNLTRRL-LGRELR-HGLADWLAD-DSCDANIHIV-KLKH-------EPISILPAGV
B9XAX1          LRRPSVGESF-SHPPGT-PGVTNYLLG-KESLSTLVL--KTPY-------PNLYILTAGP
I0JYY7          LRKPSLHKSL--GLRPR-PGLSEILTG-QVNIEEALQ--LSTI-------PNVWAISGGR
A0A3E1EJT7      LRKPNVERSF--RLQTT-AGVISYCLQ-GSALDDIIV--KNVH-------PYLDIISTGG
A0A317ZP96      LRLPNVARSL--QLENE-KGLLDHVEQ-GKDLDDVIV--KEVY-------PNLDVLPSGG
A0A2D5WGA5      LRRPSMHRYL--KVTNN-TGLTNYLLG-QNTIEEVIQ--TTEL-------PSLHFIPSGK
A0A2E7SSH2      LRRPSMHRYF--KVTNN-IGLTNLLLG-QNTLDEVIQ--TSDS-------PNLHFIPSGK
A0A349GXM8      LRRGRIHRSL--GLDRE-PGVTDVLRH-GKSLREVIQ--PARI-------ENLFVAPSGG
B3DZK9          LRRPSIHKIL--GLRPR-PGLSEILTG-QAQVEEAVQ--PTSL-------PNVWAIVGGR
A0A2A2XV69      LRRPSQHRIF--GIDNK-NGLSDLLTK-QLSLEQVVH--KTKV-------ENLFFMPSGL
A0A3C1VB86      LRRPMIEKFFLGKTSRL-PGVTDYFLG-RKKFDELCQP-HQDV-------PKLSWMAAGS
A0A146G2Q9      LRRPSQHRIF--GVENE-VGLTDFLTT-DVHLEEVVN--QTKI-------DNLFLMTSGR
A0A2T6D3Y2      LRRPSQHRIF--GVENE-VGLTDFLTT-DVHLEEVVN--QTKI-------DNLFLMTSGR
A0A2V2SDV4      LRRPTLHKML--RVSNH-IGLTNYLLK-QNTVEEVIQ--TTSL-------PTLDFMASGK
A0A2V5PK75      LRRPTLHKML--RVPND-LGLTNYLLK-QNSLEDVIR--TTPL-------PTLDFLASGK
A0A1V6DME1      LRRPTLHKRF--GVSNS-IGLTNYLLK-QNKLEEVIQ--TSPL-------ATLDFLPSGK
A0A3D3DIJ3      LRRPTLHKML--RVTNA-IGLTNYLLR-QNTLEEVIQ--TTSL-------PTLDFLSSGK
A0A2D5VY59      LRRPSLHKLV--GVSNA-VGLTDFLLG-QKSVEEVIQ--TTKL-------DNLHFLPSGK
A0A2D8UZZ4      LRRPSLHKLV--GVSNA-VGLTDFLLG-QKSVEEVIQ--TTKL-------DNLHFLPSGK
A0A353DV86      LRRPSLHKLV--GVSNA-VGLTDFLLG-QKSVEEVIQ--TTKL-------DNLHFLPSGK
A0A2E5EPT8      LRRPSLHKRL--DIENS-PGLTDYLLG-QGKLEDVIQ--KTDQ-------ADLDLLPSGK
A0A350EWA4      LRRPSIHKIL--RVSNS-VGLTNYLLG-QQPIEEVVQ--TSSL-------PSLDVMPSGK
A0A2N8HD92      LRRSKLHRYY--ELDNE-VGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A2N8HIT2      LRRSKLHRYY--ELDNE-VGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A354EBD3      LRRSKLHRYY--ELDNE-LGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A355VEB2      LRRSKLHRYY--ELDNE-LGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A2N8IMT3      LRRSKLHRYY--ELDNE-VGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
R6K1U5          LRRSKLHRYY--ELDNE-VGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A2N8IWC2      LRRSKLHRYY--ELDNE-VGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A2N8I441      LRRSKLHRYY--ELDNE-VGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A1Q6UTU9      LRRSRLHRYY--ELDNE-VGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A2N8I3A6      LRRSKLHRYY--ELDNE-VGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A410SCC4      LRRSKLHRYY--ELDNE-VGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A3R5VEW0      LRRSKLHRYY--ELDNE-VGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A411SSG2      LRRSKLHRYY--ELDNE-AGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
B2UKW3          LRRSKLHRYY--ELDNE-VGLTSYLLE-DYPLEEVIF--QTPI-------ENLYVMPAGP
A0A1M6RLZ4      LRRPKLHTFF--DINNT-VGLTNYLTT-DLMLEDVIL--QTPI-------DNLFFMPSGI
A0A354T7G8      LRRPSLHHHF--DVSHA-TGLTNYLTT-DISLEDVVI--RTQV-------ENLFFLPSGL
A0A2S7U4L6      LRRPRLHTFF--DINNS-VGLTNYLTT-TLPLEDVVL--QTSI-------ENLYFMPSGI
A0A2E8MEZ0      LRRPRLHSFF--DINNS-VGLTNYLTT-DLALEDVIL--QTPV-------DNLYFLPSGI
A0A2E3EC33      LRRPQLHTFF--NXNNS-VGLTNYLTT-DLALEDVIL--QTAY-------ENLYFMPSGI
A0A2E4GN01      XRRPQLHTFF--NINNS-VGLTNYLTT-DXALEDVIL--QTAY-------ENLYFMPSGI
A0A1Z8XU55      LRRPQLHTFF--NINNS-VGLTNYLTT-DLQLEDVIL--QTAY-------ENLYFMPSGI
A0A2E1RQR9      LRRPQLHTFF--NINNS-VGLTNYLTT-DLQLEDVIL--QTAY-------ENLYFMPSGI
A0A2E3ISQ4      LRRPQLHTFF--NINNS-VGLTNYLTT-DLKLEDVIL--QTAY-------ENLYFMPSGI
A0A2D6W6F4      LRRPQLHTFF--NINNS-VGLTNYLTT-DLXLEDVIL--QTAY-------ENLYFMPSGI
A0A2D8Z5A8      LRRPQLHTFF--NINNS-VGLTNYLTT-DLKLEDVIL--QTAY-------ENLYFMPSGI
                 *                 *                                .       

A0A2A2XVF1      RA-PNPAELLSSADIPKLFA-QLLKRYDRIVIDSAPVNAVSDTLILAPH-ADKTILVIHA
A0A2V5UHJ2      LP-PNPAELLGSKKMHDLLE-QLREQFEFIFVDSSPLMAVSDAVFLSTM-VDGTLLVIN-
A0A2V5PST3      CP-PNPTELLRMRKMKEILT-GLGGSFDFILIDSSPAIAVSDPVILSNV-ADGVILVFHA
A0A2V5PXM3      HA-PNPAELLARTGIDGLID-EALLHFERVIIDSAPVHAVSDTLLILDR-VQTLCLVVRS
A0A139SU05      RS-RRPTELLESPFFGDLLQ-KLGHYYDLIIIDSPPLGAVTDGLLIAER-VDEVAYVCRF
A0A1D8AZK8      RS-KSPTELLENPVFGQFIE-AMKQHFDLIVVDSPPMGAVTDSLLISER-TDEIIYVCRF
A0A1Q6UXG8      MV-PNPVTLLSHPLLGHILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRS
A0A2N8I9W1      MV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRS
A0A3R5SIG7      MV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRS
A0A2N8IBZ6      MV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRS
A0A2N8IJW9      MV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRS
R6J100          MV-PNPVTLLSHPLLGQILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRS
A0A139TV24      HV-PNPVSLLSRPEIEQLIQ-SFKRSYDAVIIDAPPYGILADTAIFAKL-ADISLYVIRS
A0A2N8HT11      QV-PNPVTLLSLPEMEELIR-LFKERYDAVIIDSPPYGILADTAILASH-ADISLYVIRS
R7DS70          QV-PNPVTLLSLPEMEELIR-LFKERYDAVIIDSPPYGILADTAILASH-ADISLYVIRS
A0A2N8HNL6      QV-PNPVTLLSLPEMEELIR-LFKERYDAVIIDSPPYGILADTAILASH-ADISLYVIRS
A0A1V5QB01      FP-PNPAELVLRPEFKAFMD-HARRQYDRILFDCPPVMAVSEAAILTSL-AEGVVMVVWA
A0A139SPN4      RS-RRPTELLESDLFGDLLK-KLGRYYDLIVIDSPPLGAVTDGLLIAER-VDEVAYVCRF
A0A1V6E7N1      RS-KTPSSLLETPAFTQLLE-RLKQQYELVVVDSPPLGAVTDSLLLAER-TDEIVYVCRF
A0A2T6CWI7      RS-KSPTELLENPVFGQLLE-RLKKEFDLVIVDSPPLGAVTDSVLIAER-VDEIVYVCRF
A0A2D9MYT1      VP-NNPSELAGSQRMIDFVE-EVRXKYEKIVFDCPPVSAVSDPLIIAAN-TDGTVFVNKF
A0A258ANJ7      RV-ANPAELLSTCGVERLKEMAFSAGFDRIVIDTAPLIPVNDTLELGTL-ADSTFLVVRC
A0A139TLN4      LP-DHPSRLLLHDRVRELMK-ELKEHYDFIFMDCVPYASLADARIAARL-ADATLYVMRA
A0A1G3ZFT0      YP-VDPAELLSSERCKELIS-LFSKQFDIILIDTAPVLLVTDAVLISAT-SATNYLVLGS
A0A1Z8ZMT6      KS-PNPGELLEPGRLRALIG-MFAANFDHIVIDSAPLLPVPDTRILAPL-VDNLALVIRA
A0A2E8MCT7      KS-PNPGELLEPGRLRDLVE-MFSSNFDHIVIDSAPLLPVPDTRILAPL-VDNLALVIRA
A0A290QGD9      RA-KNPTHVLNSAGFEHMIA-DLRTRYDRVFIDTPPIAAVSDALIILPL-VDGSIFTVFF
A0A1D8AS58      RA-KNPTQILNSRNFEHLLA-DLRKRYDRVFIDTPPLAAVSDALIILPL-VDGSIFTIFF
I6AQC1          RA-KNPTQILNSKNFEIMIA-ELRKRYDRIFIDTPPLAAVSDALIILPL-VSGSIFTIFF
W0ITH7          RA-KNPTQILNSKNFEIMIA-ELRKRYDRIFIDTPPLAAVSDALIILPL-VSGSIFTIFF
A0A290Q2Z2      VG-GFTLSLLYIDRLKALLA-ELRGRYDRVIFDAPPIIGVSDASVLASV-ADDVLLLVQH
A0A2A2RGK2      RA-PNPSELLTYENIDRVLK-EALSKYDRVVVDSAPLLAVSDTLLIAPH-IDLCTLVVRA
A0A2A2XXF7      RA-PNPSELLTYENLERVMS-EALSKYDRIVVDSAPLLAVSDTLLVAPH-VDLCTLVVRA
A0A2A2R5D6      MP-ASEMGAFSGLKLREILN-DLKLRYDIVLLDAPPVLGISDGAVLAHE-VDFTLLVIQH
A0A1J4XH17      KA-TNPTQIFLSPRFQQLLE-EAKSRYSKIIIDTPPLGVVSDIMNILPY-TDGLIFVVKF
A0A3C1VJ32      LP-SSSMGILGSAQMKELIA-ELKQRYDFIFFDSPPILGVSDASILASE-VDLVMQVIQY
A0A2N9NTX7      LP-SSSLGILSSSQMRDLIN-ELKQRYDFVFFDSPPIMGVSDASILASE-VDMTLQVIQY
B9XK55          LP-SSSLGILSSAQMKDLIT-ELKQRYDYVFFDSPPIMGVSDASILASE-VDMTLQVIQY
A0A2E6T482      LP-SSSMGILSSSKMREFVS-EMKSRYDYVFLDAPPIMGVSDASVLASM-VDMCVLVVQY
A0A3C0DQZ7      LP-SSSMGILSSSKMREFVS-EMKSRYDYVFLDAPPIMGVSDASVLASM-VDMCVLVVQY
A0A1Z9CBK5      LP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A2D6ZI96      LP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A358KGZ3      LP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A2E9ZQX4      LP-SSSMGVLNSAKMKEFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A3D5JZU0      LP-SSSMGVLNSAKMKQFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A2E6HCR0      LP-SSSMGVLSSSKMKDFVA-DMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A1Z8WN04      LP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A2D7L1N4      LP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A2E2R937      LP-SSSMGVLSSAKMKDFVA-DMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A2D5MR66      LP-SSSMGVLSSSKMKGFVA-DMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A2E0PDQ1      LP-SSSMGVLSSSKMKDFVA-DMKGRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A2E2ZZP9      LP-SSSMGVLSSSKMKDFVA-DMKGRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A2A2RGF2      LP-SSALGILNSPQMKDFIK-EAKQRYDFVFFDAPPIMGVSDATVLASG-ADLAILVIQY
A0A2G4I5Y6      LP-SSALGILNSPQMKDFIK-EAKRRYDFVFFDAPPIMGVSDATVLASG-ADLAILVIQY
A0A3M1I883      LP-SSALGIINSPRMKELVD-EVRNRYDFVFFDSPPIMGVSDASILCSM-VDIALLVVQY
A0A1V6JZ45      LP-SSSLGILNSTRMKEFIK-DVQRRYDFVFFDSPPIMGVSDASILASE-VDLSVLVVQY
A0A356NPK0      LP-SSSMGILNSSKMKSFIA-EARKRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQY
A0A2D7B5P5      LP-SSSMGILNSSKMKSFIA-EARKRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQY
A0A3D3XGB5      LP-SSSMGILNSSKMKSFIA-EARKRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQY
A0A2V6F8A1      LP-SSSLGILNSVQMKDFIK-EAKKRYDFVFFDSPPIMGVSDASILASE-VDLALLVIQY
A0A2V5TNH4      LP-SSSLGILNSAQMKDFIK-EAKRRYDFVFFDSPPIMGVSDASILASE-VDLSLLVIQY
A0A2V5X5Q6      LP-SSSLGILNSTQMKDFIK-EAKRRYDFVFFDSPPIMGVSDASILASE-VDLSVLVIQY
A0A139TS01      VP-FDPSGALNSRKFSELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A2V5URB2      VP-PSPTELIGSKKMQDTLA-LLKESYDFIFIDSPPIMPVSDAVVLSTL-TDGMIFVVRG
A0A2V2DJ66      RA-KNPSQMLNSEEFVSMIE-SFREKYDKVFIDSPPIGAVSDAISLLPE-VDGVLYVIKF
R7L5A9          RA-KNPTQTLNSEEFAAMIE-KFRDTYDRIFIDSPPIGAVSDAITLLPT-VDGVIYVVKF
A0A2V6JLK8      LP-SDAVGILNSQRMSDTIA-QLKMRYDIVFFDSPPILGVSDASVIASE-VDQTVIVVQH
A0A2W5Z1A5      IP-SDAVGILNSQKMSDLIA-ELKTRYDIIFFDSPPMLGVSDASVLASE-VDQTIIVVQH
A0A2V6EA09      LP-ADAVGILNSQRMSDTIA-ELKSRYDLIFFDSPPMLGVSDASVLASE-VDETIIVVQH
A0A2V6GQI7      LP-ADAVGILNSQRMSDTIA-ELKSRYDLIFFDSPPMLGVSDASVLASE-VDETIIVVQH
A0A2A2XXW5      VP-PNPSELIGSNRMVRFLE-EASRRYDRVILDCPPVSAVSDPLIVGAM-ADGMVFVTKF
A0A3R5R2M8      AV-PNPVSLLSQPILGQMLE-HLKKQYDTVIIDAPPYGILADTAILASW-SDISLYLTRS
A0A411SUQ6      MV-PNPVTLLSHPLLGHILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRS
A0A2N8HZF2      MV-PNPVILLSHPLLGHILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYTVRS
A0A354E720      TV-PNPVTLLSHPLLGQILS-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYTVRS
B2UPB6          MV-PNPVTLLSHPLLGHILG-ILKKQYDAVIIDAPPYGILADTAILASL-SDITLYAVRS
A0A3C1HEJ2      KS-PNPSELLAQPGFKQLLT-EALSHFDQVVIDSAPVHPVSDTLLLAHR-AKTVCVVVRA
A0A1V6JU76      IR-SQPSELLGSQRMVQFMQ-ELSKRYDRVILDCPPVSAVSDPLILSAM-ADAVVFVTKF
A0A1Q6UHJ9      RS-QNPTQALSSEEFISMIA-KFREQYDKVFIDSPPVGAVSDAIALLPY-VDGVIYIVKF
A0A2V2BXR0      RS-QNPTQALSSEEFISMIA-KFREQYDKVFIDSPPVGAVSDAIALLPY-VDGVIYIVKF
A0A2D8V0G3      VP-NNPSELVGSKRMGELLD-SLRDRYDRIFVDCPPVSAVSDPLMVGAR-TDGMVFVSKF
A0A348S017      VP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKF
A0A3C1UUV7      VP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKF
A0A350I3V2      VP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKF
A0A3D3XF90      VP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKF
A0A2D7B522      VP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKF
A0A356NIC2      VP-NNPSELVGSTRMGELLE-AVRGKYDRIFVDCPPVSAVSDPLMIASR-SDGIVFVSKF
R7DZW0          VP-DHPSRLLLHDRIRKLME-EVKEQYDFIFMDCVPYSSLADARIVARL-ADVTLYVMRA
A0A2N8HID1      VP-DHPSRLLLHDRIRKLME-EVKEQYDFIFMDCVPYSSLADARIVARL-ADVTLYVMRA
A0A2N8HS06      VP-DHPSRLLLHDRIRKLME-EVKEQYDFIFMDCVPYSSLADARIVARL-ADVTLYVMRA
A0A3R8IT45      RA-KSPTQILNSKNFEIMIA-ELRKRYDRIFIDTPPLAAVSDALIILPL-ANGAIFTIFF
A0A1H1MGC9      RA-KNPTQILNSKNFELMLS-ELRKRYDRIFIDTPPLAAVSDALIILPL-LDGSLFTIFF
A0A2A2PYE8      RA-KNPTQILNSKGFELMIS-DLRKQYDRVFIDTPPLAAVSDALIILPL-VDGSIFTIFF
A0A2T6CN73      RA-KNPTHILNSKAFETMIA-DLRKRYDRVFIDTPPLAAVSDALIILPL-VDGSIFTIFF
A0A2N8HDG3      HV-PNPVTLLSLPELGTLIQ-MFKERYDAVIIDSPPYGILADTAILAGH-ADISLYVVRS
A0A2U8DZK4      IS-GFTLSLFYADRLKEILA-DLRTQYDRIVFDAPPIIGVSDSAVITSL-IDHVLLLIQY
A0A1D8AWD4      AANNVTLGLLYATKLKALVE-EFRGRYDKVLFDSPPIIGVSDASVLASL-ADGIVLLIQH
A0A2T6DFL8      AG-NFTLSLIYANRLRELMT-TLRGRYDRIVFDSPPIIGVSDTSVLMTV-VDGVVLLIQH
A0A178IH18      VG-GFTLSLLYADRLKALLA-GLGKSYDRIMFDAPPIIGVSDASVITSL-VDDVLLLVQY
A0A2T6DT99      VG-SFSLTLLYVDRLKALIQ-ELRGQYDRIVFDAPPIIGVSDASVLASV-MDDVLLLVQH
A0A1G3ZT33      PG-GFTLSLLYANRLRELIA-QCKGRYGRIVFDSPPVIGVSDASVLSSV-VDGVVLLIQH
A0A3E1E2T2      AP-GFTLGLLHLNRLKDLIA-TLSGRYDKIVFDSPPIIGVSDASVLASA-VDGTVLLIQH
B1ZMW1          VP-GFTLGLLQVNRLKELIA-TLRGRYDKILFDSPPIIGVSDASVLASV-MDGAVLLIQH
A0A3D1TI55      LP-RTSVGILNSQRMRELIK-TLKSRYDYIFFDSPPIVGVSDASVLASE-VDLALLVVQY
A0A2G4G428      SC-RNPTQVISSAKFIEMLT-DMRSRYDRIFIDSPPIGAVSDALNLIPN-VDGVIYVVRY
A0A3E1ET42      LP-ADAAGILNSRRMSELIA-DVKNRFDLVLIDSPPILGVSDASVLASE-VDLTIIVIQH
A0A2A2YDW8      LP-ADAAGILNSRRMSELIA-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTIIVVQH
A0A352XLN9      LP-ADAAGILNSRRMSELIA-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTIIVVQH
A0A3D0YP62      LP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTIVVVQH
A0A3D3DV47      LP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTIVVVQH
A0A2A2QX62      LP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A3N5WCF1      LP-ADAAGILNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMLVVQH
A0A2E5XJ49      LP-ADAAGILNSRRMSELIE-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A2E6SBY8      LP-ADAAGILNSRRMSELIE-DVKQRFDLILVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A2E5QMS4      LP-ADAAGILNSRRMSELVQ-DVKQRFDLILVDSPPILGVSDASVLASE-VDLTIVVVQH
A0A2E7YXQ3      LP-ADAAGILNSRRMSELVQ-DVKQRFDLILVDSPPILGVSDASVLASE-VDLTIVVVQH
A0A2E3H787      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A2E7AGN1      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A2E7AKY7      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A3D4CU34      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-ADLTMIVVQH
A0A2E8M146      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A355S8S2      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A2D6DVN8      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A3C1W2R2      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A2E3NAY6      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A2E3II01      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A368B8C5      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
A0A3R7RBB5      LP-ADAAGLLNSRRMSELIQ-DVKQRFDLVLVDSPPILGVSDASVLASE-VDLTMIVVQH
B4DB23          LP-GDSVGILNSQRMTDLIA-KVKSQYDLVFFDSPPILGVSDGSVLASE-VDVTIMVVQH
A0A139TUL1      VP-PNPAALLTQGRFEDLIR-YWRTRYDRIIVDGCPYEAVADASLMARH-ADLVLYLIRC
A0A2N8HCB0      VP-PNPVALLTQDRFEELLR-YWRARYDRIILDGCPYEAVVDASLMARH-ADLVLYVIRC
A0A2N8HP04      VP-PNPVALLTQGRLEELLR-YWRARYDRIILDGCPYEAVADASLMARH-ADLVLYVIRC
A0A2N8HRJ0      VP-PNPVALLTQGRLEELLR-YWRARYDRIILDGCPYEAVADASLMARH-ADLVLYVIRC
A0A366HAG0      MP-ADSAGLLNSQKFVDLLT-DVKSRFDLVLIDSPPIIGVSDASVLAAE-ADMTIIVVQH
A0A3M1I8A3      GS-SQSTELVASRRMVQFLD-EARKRYDRVILDTPPVSAVSDPLVVASL-SDGCVFVAKF
A0A0R2XQ77      KS-KNPTQVLNSARFEAMIA-DLRDRYDRIVIDSPPLAAVSDVLNLLPL-ADGVLYVIKF
A0A2E9IN28      KS-KNPTQVLNSARFEAMFA-DLRDRYDRIVVDSPPLAAVSDALNLLPL-VDGILYVIKF
D5ENH7          KS-KNPTQVLVSAPFEAMLA-DLRDRYDRIVIDSPPLAAVSDALNLLPL-VDGVVYVIKF
A0A351WE84      LP-RSMMGIIDSQRMRELVK-DLKSRYDYVFFDSPPIIGITDASILASE-VDGVLLVVQY
A0A146GCJ0      RA-PNPSELLGGSEFREMLA-KLLLTYDRVVVDSAPVNAVSDALLIASC-VDTACLVVRA
A0A2T6D6H8      RA-PNPAELLNEDDFQKMLD-ELLKSYDRIVVDTAPVNAVSDVLLIANC-IQTTCLVVHA
A0A1V5QDZ6      LP-RTSLGLLDSQRMRELVK-NLKARYDYVFFDSPPIMGVTDASILASE-VDGVLLVVQY
A0A3D4HF88      HS-QKSTQILNDKRFIALLE-DLRGSYDRVFIDSPPVAAVSDALNVLPH-VDGVLYVINY
A0A351MR11      IC-KNPTQVINSPRFDELIR-ELRTRYDRIFIDSPPLGAVSDALHLVPK-VDGVIYVVRF
A0A1V6J089      LR-RGTIGIMNNTRLRNLLD-HLKEQYDYILLDSPPILGVTDAAILASE-VDGVLLVVQY
A0A3C1BZR1      LR-RGSLGIMNNARLRALMD-SLKEKYDFVLLDSPPILGVTDAAILASE-ADGVLLVVQY
A0A1H6KPB7      TP-SDASGVLNSYRMRELLD-EVRRRFDIVLIDSPPVLGVSDASLIVSK-ADATIMVVQP
A0A2E9ISN4      FD-DSLPEKVNAARLRGLVH-SLQQDYDVIIIDTAPVSIFSESLAFCQA-TGGVLVMMD-
B9XAX1          KV-ANPAEELGGDAIKQLLL-EASNQFDRIVIDTPPINAVSDTFILLPL-AQIICLVVRA
I0JYY7          AA-IHPTDLLGSESMHSLIQ-LVRQYFCYILIDTPPMHGMPDAAIIGSV-TDGLIYVIQA
A0A3E1EJT7      RA-KNPIQLFNSKEFETLVV-ELSKRYDRVLFDTPPLGAVSDALNILPL-MDGAIYTIHF
A0A317ZP96      KS-KNPTQILNSASFESMLA-ELRDRYDRIIIDTPPLAAVSDALNLLPL-VDGILYVIKF
A0A2D5WGA5      LP-SSSMGILSSAKMKEFVT-EMKSRYDYVFLDAPPIMGVSDASVLASM-VDMCVLVVQY
A0A2E7SSH2      LP-SSSMGVLNSSKMKEFVA-EMKSRYDYVFFDAPPIMGVSDASVLASA-VDLCVLVVQY
A0A349GXM8      DI-DDSAELLQTVDVRGFFV-DVQDDYDYIFVDTSPVLRVTDTVILASQGIGQVLYVARV
B3DZK9          AA-LHPADLLGAESFSQLCR-SLREYFTYILIDTPPMRGMPDAPIVSMQ-SEGVLYVIED
A0A2A2XV69      LP-RDAVGILNSQRMMEVIQ-ETKSRFDIVFFDSPPILGVSDASVLSSE-LDLTIIVVQH
A0A3C1VB86      SV-PNPSELLMSADFQKLLS-EGLAHYDRIVIDTAPILPVSDTLLLAGK-VQTVVLVVQA
A0A146G2Q9      LP-ADAVGILNSQRMVDLIE-EVKHRFDIVFFDSPPILGVSDASVLSSA-VDLTIIVVQH
A0A2T6D3Y2      LP-ADAVGILNSQRMVDLIE-EVKHRFDIVFFDSPPILGVSDASVLSSA-VDLTIIVVQH
A0A2V2SDV4      LP-SSSLGILNSPQMKELIG-QLKQHYDFVFFDSPPVMGVSDASIIASE-VDMTLQVIQY
A0A2V5PK75      LP-SSSLGILSSAQMKELIN-ELKQRYDFVFFDSPPIMGVSDASILASE-VDMTLQVIQY
A0A1V6DME1      LP-SSSLGILNSAQMKDLIA-QLKQRYDFVFFDSPPIMGVSDASILASE-MDMTVQVIQY
A0A3D3DIJ3      LP-SSSLGILSSTQMKDLIG-ELKQRYDFVFFDSPPIMGVSDASILASE-VDMTIQVIQY
A0A2D5VY59      LP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQY
A0A2D8UZZ4      LP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQY
A0A353DV86      LP-SSSMGILNSQQMKDFIQ-DVKTRYDYVFFDSPPIMGVSDASILASE-VDMAILVIQY
A0A2E5EPT8      LP-SSAMGILNSQQMRDFVK-EVQSRYDFILLDSPPLMGVSDATVLTSM-VDLTLLVIQY
A0A350EWA4      LP-SSSMGILSSVRMKQLVK-ELKSRYDFVFFDSPPIMGVSDASVLASE-VDLTLQVIQY
A0A2N8HD92      TP-FDPSGTLNSRKFSELLQ-EVKQRFDMVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A2N8HIT2      TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A354EBD3      TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A355VEB2      TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A2N8IMT3      TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
R6K1U5          TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A2N8IWC2      TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A2N8I441      TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A1Q6UTU9      TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A2N8I3A6      TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A410SCC4      TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A3R5VEW0      TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A411SSG2      TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
B2UKW3          TP-FDPSGALNSRKFNELLQ-EVKQRFDIVLVDSPPILGVSDSAVIVSE-VDMTLMVVQP
A0A1M6RLZ4      LP-ADAAGILNSRRMSDLVQ-DVKQRFDLVLIDSPPILGVSDASVLASE-VDLTMIVVQH
A0A354T7G8      LP-ADSAGLLNSQRMVDLIA-DVKSRFDLVLIDSPPILGVSDASVLANE-ADMTMIVVQH
A0A2S7U4L6      LP-ADASGILNSRRMSELIQ-EVKSRFDLVLVDSPPILGVSDASVISSE-VDLTMIVVQH
A0A2E8MEZ0      LP-ADAAGILNSRRMSELLQ-DVKQRFDLVLVDSPPILGVSDAAVLASE-VDLTMVVVQH
A0A2E3EC33      LP-SDAAGILNSRRMSELIA-DVKSRFDLVLVDSPPILGVSDASVLASE-VDLTIIVIQH
A0A2E4GN01      LP-SDAAGILNSRRMSELXA-DVKSRFDLVLVDSPPILGVSDASVLASE-VDLTIIVIQH
A0A1Z8XU55      LP-ADAAGILNSRRMSELIA-DVKSRFDLVFIDSPPILGVSDASVLSSE-VDLTIIVIQH
A0A2E1RQR9      LP-ADAAGILNSRRMSELIA-DVKSRFDLVFIDSPPILGVSDASVLSSE-VDLTIIVIQH
A0A2E3ISQ4      LP-ADAAGILNSKRMSELIA-DVKSRFDLVFIDSPPILGVSDASVISSE-VDLTIIVIQH
A0A2D6W6F4      LP-ADAAGILNSRRMSELIA-XVKSRFDLVFIDSPPILGVSXASVISSE-VXLTIIVIQH
A0A2D8Z5A8      LP-ADAAGILNSRRMSELIA-DVKSRFDLVFIDSPPILGVSDASVISSE-VDLTIIVIQH
                                          :  :..*  *   .                    

A0A2A2XVF1      GKTPRKAIQRSVHLLRKAQA-KVAGFVLNRLPTGRAA---------GYYYYYYGDKY---
A0A2V5UHJ2      RRTPKPLLRKARARLTTPHS-KILGMLLNRINIHNNE---------------YGGYYQQY
A0A2V5PST3      QKTTAASARKTKERFDAIRA-PILGVILNGINLEDPD----------YA--YYRHYYGSD
A0A2V5PXM3      RKTPRNSVLRAVQMLNEAGA-PLAGVILNLIPRSGGG--------YGYY--YYDSYYA--
A0A139SU05      NRAHRKHIQLYMRALRNAKT-EVLGVVLNGLTPRRVE--------------YYSN-----
A0A1D8AZK8      NRAYRKHIRLYIKQLRESKN-ELLGIVLNGLSPRRIE--------------YYSN-----
A0A1Q6UXG8      GKIDKRYLFQIQQLADQGKL-PNMAYIINGVNFKSAS----------YS--YYGYGYGYQ
A0A2N8I9W1      GKIDKRYLLQIQQLADQGKL-PNMAYIINGVNFKSSS----------YS--YYGYGYGYQ
A0A3R5SIG7      GKIDKRYLLQIQQLADQGKL-PNMAYIINGVNFKSSS----------YS--YYGYGYGYQ
A0A2N8IBZ6      GKIDKRYLLQIQQLADQGKL-PNMAYIINGVNFKSSS----------YS--YYGYGYGYQ
A0A2N8IJW9      GKIDKRYLLQIQQLADQGKL-PNMAYIINGVNFKSSS----------YS--YYGYGYGYQ
R6J100          GKIDKRYLLQIQQLADQGKL-PNMAYIINGVNFKSSS----------YS--YYGYGYGYQ
A0A139TV24      NKIDKRYIATIQQLANEGKL-PNMGFVINAVDFKAAG----------HH--YYGYGYHYN
A0A2N8HT11      NRIDKRHIATVQQLAESGQL-PNMGFVINAVDFKSSS----------YS--YYGYGYHYG
R7DS70          NRIDKRHIATVQQLAESGQL-PNMGFVINAVDFKSSS----------YS--YYGYGYHYG
A0A2N8HNL6      NRIDKRHIATVQQLAESGQL-PNMGFVINAVDFKSSS----------YS--YYGYGYHYG
A0A1V5QB01      GHTSRKLVQLAAKLIQERGA-RILGCVLNNLDFSRVG----------YY--YYSTYYGY-
A0A139SPN4      NRAHRKHIQLYMRALRNAKT-EILGVILNGLAPRRVE--------------YYSN-----
A0A1V6E7N1      NKALRKHIQLYTKLLLSGKN-EVLGIVLNGLSPRRIK--------------YYSN-----
A0A2T6CWI7      NRAYRKHIRLYMRTLRQGKN-EVLGIVLNGLSPRRIE--------------YYSN-----
A0A2D9MYT1      NKIRREHARKTVQRVQDAGI-NIVGVCINDLDFEGKDSYYY-----SYY--YYQNRY---
A0A258ANJ7      NRTPADIILEAIRKLHQTGI-PITGLVLNRLTQRTRS---------FDQ--YYHRSY---
A0A139TLN4      GCVKKRDLSSLQKTWKSGEL-KRMGIVLCDVENRSRP---------SRK-----------
A0A1G3ZFT0      NVHQASHLEMAIKRLSSAGV-TVHGSIFNFHNATSKKS--------SYQ--YYSSHY---
A0A1Z8ZMT6      DHTPVKSIQGALEMLKDDGV-SSSGVILNDFTENRLQGG-------KYG-------YGYG
A0A2E8MCT7      EHTPVKSIQRAFDMLEDDGV-FSSGVILNDFTENRLQGG-------KYG-------YGYG
A0A290QGD9      NKVRRRAAQYAARRLIDSHV-PNFGAVLNGLNMNVSG---------YYYGQYTDKSY---
A0A1D8AS58      NRVRRKAAQFSARKLLEANV-PCFGAVLNGLNLAVSG---------YYYAQYYDKSY---
I6AQC1          NKVRRKAAQHAARKLLESNV-PVYGAVLNGLNLAVAG---------YYYAQYYDKSY---
W0ITH7          NKVRRKAAQHAARKLLESNV-PVYGAVLNGLNLAVAG---------YYYAQYYDKSY---
A0A290Q2Z2      RRNPHSMVVRAQQIIEGLHK-QIVGVVLNRVPVNSSD---------DYG--YYTRN----
A0A2A2RGK2      FTTPKKMVMRAIKSLEETKT-TPAGLILNFLPSGRGG----------YYAYYYSGKY---
A0A2A2XXF7      FGTPRKMVARAIKSLEETKT-HPAGLILNFLPSGRGG----------YYAYYYSGKY---
A0A2A2R5D6      RRYPRDISMRAKRAVEEVKG-NLLGVVLNAVAVKSDE---------AYY--YYSSYG---
A0A1J4XH17      NSVKRKTAKAHLSRLLESNV-PVFGAVINQISLDIVN---------YYYSNYYDKTY---
A0A3C1VJ32      RRYPQPMTIRAKQMIEKVGG-NFVGMVLNNINMSQDE---------GYY--YYSGYY---
A0A2N9NTX7      RRYPQPMNIRAKQLIEKVGG-NLIGIVLNNINMSQDE---------SYY--YYSGYY---
B9XK55          RRYPQPMNIRAKQLIEKVGG-NLIGIVLNNINMSQDE---------SYY--YYSGYY---
A0A2E6T482      RKYPQLMTQRAKEMVTKVGG-DLVGVVLNNINISQDS---------YYY--YYSGYY---
A0A3C0DQZ7      RKYPQLMTQRAKEMVTKVGG-DLVGVVLNNINISQDS---------YYY--YYSGYY---
A0A1Z9CBK5      RKYPQXMTQRAKDMVVKVGG-NLVGVVLNNINISQDS---------YYY--YYSGYY---
A0A2D6ZI96      RKYPQXMTQRAKDMVVKVGG-NLVGVVLNNINISQDS---------YYY--YYSGYY---
A0A358KGZ3      RKYPQLMTQRAKDMVIKVGG-DLVGVVLNNINISQDS---------YYY--YYSGYY---
A0A2E9ZQX4      RKYPQLMTQRAKDMVIKVGG-XXVGVVLNNINISQDS---------YYY--YYSGYY---
A0A3D5JZU0      RKYPQLMTQRAKDMVIKVGG-DLVGVVLNNINISQDS---------YYY--YYSGYY---
A0A2E6HCR0      RKYPQLMTQRAKDMVIKVGG-DLAGVVLNNINISQDS---------YYY--YYSGYY---
A0A1Z8WN04      RKYPQLMTQRAKEMVTKVGG-NLIGVVLNNINISQDS---------YYY--YYSGYY---
A0A2D7L1N4      RKYPQLMTQRAKEMVTKVGG-NLIGVVLNNINISQDS---------YYY--YYSGYY---
A0A2E2R937      RKYPQLMTQRAKEMVTKVGG-NLIGVVLNNINISQDS---------YYY--YYSGYY---
A0A2D5MR66      RKYPQLMTQRAKEMVTKVGG-NLVGVVLNNINISQDS---------YYY--YYSGYY---
A0A2E0PDQ1      RKYPQLMTQRAKDMVTKVGG-NLVGVVLNNINISQDS---------YYY--YYSGYY---
A0A2E2ZZP9      RKYPQLMTQRAKDMVTKVGG-NLVGVVLNNINISQDS---------YYY--YYSGYY---
A0A2A2RGF2      RKYPQSLAIRSRQMVEKVGG-RLIGVVLNNINLASDA---------SYY--YYSG-----
A0A2G4I5Y6      RKYPQSLAIRSRQMVEKVGG-RLIGVVLNNINLASDA---------SYY--YYSG-----
A0A3M1I883      RKYPQAMTLRAKQMVQKVGN-NLLGIVLNNINISQDS---------YYY--YYSGYY---
A0A1V6JZ45      RKYPQAMTLRAKQMVEKVGG-TMLGVVLNNINISQDS---------YYY--YYSGYY---
A0A356NPK0      RKYPQAMTVRAKQMVEKVGG-NLLGVVLNNINISQDS---------YYY--YYSGYY---
A0A2D7B5P5      RKYPQAMTVRAKQMVEKVGG-NLLGVVLNNINISQDS---------YYY--YYSGYY---
A0A3D3XGB5      RKYPQAMTVRAKQMVEKVGG-NLLGVVLNNINISQDS---------YYY--YYSGYY---
A0A2V6F8A1      RKYPQAMTLRAKQMVEKVGG-TMLGVVLNNINISQDS---------YYY--YYSGYY---
A0A2V5TNH4      RKYPQAMTIRAKQMVEKVGG-ALLGVVLNNINISQDS---------YYY--YYSGYY---
A0A2V5X5Q6      RKYPQAMTIRAKQMVEKVGG-AMLGVVLNNINISQDS---------YYY--YYSGYY---
A0A139TS01      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A2V5URB2      QNTPKHIVREAISQLGNNRS-KILGVVLNRVDVRSAE------YRDYYR--YYNPEF---
A0A2V2DJ66      NTAKRKVVRRCVRRMMESNV-PILGAVMNMVNTGAVSGY-------SIN--YYDKNY---
R7L5A9          NTVKRKTIRAYIRRMMESNV-PILGAVMNMVNPSSASVY-------SMN--YYDKSY---
A0A2V6JLK8      RRFPRAMLTRVKQAILGVGG-TVLGVVLNNVDLKHDQ---------NYY--YYTN-Y---
A0A2W5Z1A5      RRFPRAMLTRVKQAITGSGG-TVLGVVLNNVDLRHDQ---------NYY--YYTN-Y---
A0A2V6EA09      RRFPRAMLTRVKQAILSVGG-TLLGVVLNDVDLKHDQ---------NYY--YYTH-Y---
A0A2V6GQI7      RRFPRAMLTRVKQAILSVGG-TLLGVVLNDVDLKHDQ---------NYY--YYTH-Y---
A0A2A2XXW5      NKIRREHALRSVQRIQDSGI-HLVGLVLNDIDFEGKDSYYY-----SYH--YYQNQY---
A0A3R5R2M8      GMIDKRYFPQVQKLADTGKL-PNLAFIINGVNFKSAS----------YN--YYGYGYGYG
A0A411SUQ6      GKIDKRYLLQIQQLADQGKL-PNMAYIINGVNFKSAS----------YS--YYGYGYGYQ
A0A2N8HZF2      GKIDKRYLLQIQQLADQGKL-PNMAYIINGVNFKSAS----------YS--Y--YGYGYQ
A0A354E720      GKIDKRYLTQIQQLADQGKL-PNMAYIINGVNFKSAS----------YS--YYGYGYGYQ
B2UPB6          GKIDKRYLLQIQQLADQGKL-PNMAYIINGVNFKSAS----------YS--YYGYGYGYQ
A0A3C1HEJ2      NKTPRKAALTAVQKLQKSRA-NIAGFILNGITLLHRS---------DYY--DYSD-Y---
A0A1V6JU76      NKVRRDHARRTIQRIQDAGI-HICGVVLNDIDFEGRDSYYY-----SYT--YYQNRY---
A0A1Q6UHJ9      NSVSRKAIQKNVRRLMVSNV-PVVGAIMNMVSQGSAAGY-------SLN--YYDKSY---
A0A2V2BXR0      NSVSRKAIQKNVRRLMVSNV-PVVGAIMNMVSQGSAAGY-------SLN--YYDKSY---
A0A2D8V0G3      NKIRREHARKTVQRIQDAGI-YILGTVINDIDFEGKDSYYY-----SYY--YYQNRY---
A0A348S017      NKIRRDHARKTIQRIQDAGI-YILGTVINDIDFEGKDSYYY-----SYY--YYQNRY---
A0A3C1UUV7      NKIRRDHARKTIQRIQDAGI-YILGTVINDIDFEGKDSYYY-----SYY--YYQNRY---
A0A350I3V2      NKIRRDHARKTIQRIQDAGI-YILGTVINDIDFEGKDSYYY-----SYY--YYQNRY---
A0A3D3XF90      NKIRRDHARKTIQRIQDAGI-YILGTVINDIDFEGKDSYYY-----SYY--YYQNRY---
A0A2D7B522      NKIRRDHARKTIQRIQDAGI-YILGTVINDIDFEGKDSYYY-----SYY--YYQNRY---
A0A356NIC2      NKIRRDHARKTIQRIQDAGI-YILGTVINDIDFEGKDSYYY-----SYY--YYQNRY---
R7DZW0          GCVKKRDLAGLQKIWKNGEL-KRMGIVLCDVEPHGRS--------------------SRG
A0A2N8HID1      GCVKKRDLAGLQKIWKNGEL-KRMGIVLCDVEPHGRS--------------------SRG
A0A2N8HS06      GCVKKRDLAGLQKIWKNGEL-KRMGIVLCDVEPHGRS--------------------SRG
A0A3R8IT45      NKVRRKAAQHAARKLLESNV-PVFGAVLNGLNLAVAG-----------Y--YYAQYYDKS
A0A1H1MGC9      NRVRRKAAQFSARKLLEVNV-PCFGAVLNGLNLAVSG-----------Y--YYAQYYDKS
A0A2A2PYE8      NKVRRKAAQFSAKKLLEANV-PNFGAVLNGLNLAVSG-----------Y--YYAQYYDKS
A0A2T6CN73      NKVRRKAAQFAAKRLLDSNV-PNFGAVLNGLNLVVSG-----------Y--YYAQYYDKS
A0A2N8HDG3      NRIDKRHISTVQQLADSGQL-PNLGFIINAVDFKAGS----------YS--YYG------
A0A2U8DZK4      RRNPLSMVLRAQQTILGLDK-EILGVVLNRVPKNAGA---------DYA--YYSK-N---
A0A1D8AWD4      RRNPESMVQRAKQIIDGLKV-PVIGVVLNQVPTGTGE---------DYS--YYTN-N---
A0A2T6DFL8      RRNPQSMVLRAQQIVGGVKA-SILGIVLNQIPGNAGG---------DYG--YYTS-N---
A0A178IH18      RRNPQSMVVRAQQIIAGLHK-EILGIVLNRVPKNAGD---------DYG--YYTN-N---
A0A2T6DT99      RRNPQSMVMRAQQIIEGLGK-TIVGIVLNRVPRNSGE---------DYG--YYTH-N---
A0A1G3ZT33      RRNPQSMVLRAKQIIEGLKT-PLVGVVLNQVPHGSGD---------DYG--YYTG-N---
A0A3E1E2T2      RRNPQSMVVRAQQIVESLKA-PLLGVVLNQVPLNSGD---------DYG--YYTN-N---
B1ZMW1          RRNPQSMVLRAQQIVEAIKT-PLLGVVLTQVPENAGG---------DYG--YYTH-N---
A0A3D1TI55      RKYPKVMSNRAKKMVENVGG-RLVGVVLNNINVMRDD---------YYY--YYHTYY---
A0A2G4G428      NFVSTRNVAECITRLREVGV-PILGAVLNRMSMRMAS--------------VYTDSFDAS
A0A3E1ET42      RKLPRSMLLRVKQAIENVGG-NLLGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2A2YDW8      RKLPRNMLLRVKQAVENVGG-HVLGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A352XLN9      RKLPRNMLLRVKQAVENVGG-HVLGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A3D0YP62      RKLPRNMLVRVKQAVENVGG-HVIGVVLNNVDVRSDN---------QYQ--YYTS-Y---
A0A3D3DV47      RKLPRNMLVRVKQAVENVGG-HVIGVVLNNVDVRSDN---------QYQ--YYTS-Y---
A0A2A2QX62      RKLPRNMLMRVKQAVENVGG-HVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A3N5WCF1      RKLPRNMLLRVKQAVENVGG-HVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2E5XJ49      RKLPRNMLLRVKQAVENVGG-QVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2E6SBY8      RKLPRXMLLRVKQAVENVGG-QVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2E5QMS4      RKLPRNMLMRVKAAVENVGG-QVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2E7YXQ3      RKLPRNMLMRVKAAVENVGG-QVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2E3H787      RKLPRNMLLRVXQAVENVGG-QVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2E7AGN1      RKLPRNMLMRVKQAVENVGG-YVVGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2E7AKY7      RKLPRNMLMRVKQAVENVGG-YVVGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A3D4CU34      RKLPRNMLLRVKQAVENVGG-YVVGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2E8M146      RKLPRNMLVRVKQAVENVGG-HVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A355S8S2      RKLPRNMLVRVKQAVENVGG-HVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2D6DVN8      RKLPRNMLVRVKEAVENVGG-HVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A3C1W2R2      RKLPRNMLVRVKEAVENVGG-HVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2E3NAY6      RKLPRNMXVRVKEAVENVGG-HVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2E3II01      RKLPRNMLVRVKEAVENVGG-HVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A368B8C5      RKLPRNMLVRVKEAVENVGG-HVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A3R7RBB5      RKLPRNMLVRVKEAVENVGG-HVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
B4DB23          RRFPRVMLQRVKQAVLNVGG-RLIGVVLNNVDAKHDD---------GYS--YYYN-Y---
A0A139TUL1      GMIEKQYVPSIQEVAARGEF-RSVALILNAENFKNS----------RFH--YYSE-----
A0A2N8HCB0      GMIEKQYVPAIQGLADKGEF-RAVALILNAENFKNS----------RFH--YYSE-----
A0A2N8HP04      GMIEKQYVPVIQGLADKGEF-RSGAVILNAENFKNS----------RFH--YYDE-----
A0A2N8HRJ0      GMIEKQYVPVIQGLADKGEF-RSGAVILNAENFKNS----------RFH--YYDE-----
A0A366HAG0      RKLPRQMLQRVKQTIEQVGG-KVAGAVLNNVNINSDA---------TYG--YYTS-Y---
A0A3M1I8A3      NKVRREHARKTLRRLLDAGV-HICGVLLNDIDFEGRDSYYY-----SYY--FYQNRY---
A0A0R2XQ77      NTVKRKTAVVNVRRLWESNT-PIFGAILNNISSTLAS-----------Y--YYSSYSDKA
A0A2E9IN28      NTVKRKTAVVNVRRLWESNT-PVFGAILNNITSSLSS-----------Y--YYSNYSDKA
D5ENH7          NTVKRKTAVANVRRLWESNT-PVFGAILNNITTSLSS-----------Y--YYSQYSDKA
A0A351WE84      RKYPRVISSRAKRMVENVGG-KLLGVVLNNINIMRDD---------YYY--YYHASY---
A0A146GCJ0      GKTPKKASLRAVKQLQKSGA-KLAGFIFNRLPVGGRSAGY------YYY--YYGGEYSKN
A0A2T6D6H8      GRTPKKAVLRAVRQLQKTGA-RLGGFVFNRLPVGGQSAGY------YYY--YYGGDYAKN
A0A1V5QDZ6      RKYPKIITSRAKRMIENVGG-NVLGVVLNNINIMRDD---------YYY--YYHSYY---
A0A3D4HF88      NTVKRKTVKASVRRLFESNV-PVFGVIMNQITAAMSS-----------Y--YYTNYYEKS
A0A351MR11      NLVKKRNAMSCIARLREAGV-PIVGAVLNSMATRLAA--------------FYTNSYDAS
A0A1V6J089      RKYPKIISLRAKRMIENAGG-QVLGAVLNNINIMRDD---------YYY--YYHYTT---
A0A3C1BZR1      RKYPKIISLRAKRMIENAGG-RLMGAVLNNINIMRDD---------YYY--YYHYAT---
A0A1H6KPB7      RKLPMKALVREKMVIENAGG-HLMGVVMNNVDISGDT---------QYQ--YYTT-Y---
A0A2E9ISN4      ---SLTSQASVQNCLNELRGIRTLGFCVNGVNE-------------SYL--RSNG-----
B9XAX1          GKTPKHAIMRAVELMARANV-PPTGIVLNFLPQHS-----------GYR--YY-------
I0JYY7          GRIERKDFLQNLQILATVNA-RILGVVLNKTTT-------------SYQ--SYYS-Y---
A0A3E1EJT7      NRVRRKAAQQCTRRLLAVNV-PVFGAVMNGMNTGITG---------DYY--MENN-SKLF
A0A317ZP96      NTVKRKTAVVNVRRLWESNT-PVFGAVLNNITSTLSS-----------Y--YYSQYSDKS
A0A2D5WGA5      RKYPQLMTQRAKEMVTKVGG-DLVGVVLNNINISQDS---------YYY--YYSGYY---
A0A2E7SSH2      RKYPQLMTQRAKDMVIKVGG-NLVGVVLNNINISQDS---------YYY--YYSGYY---
A0A349GXM8      NFTPKPMIRYSLDMLKD--A-NILGLVMNSIEMHKISSLYYAYQYPNYA--YYSNAYAYG
B3DZK9          GRDDRKEVQNNIEAFSRINS-RVLGIILNRADPLSHS---------SY--------Y---
A0A2A2XV69      RRFPKEMIQRVKQAIENVGG-NILGVVLNNVDIRHDQ---------SYG--YYTS-Y---
A0A3C1VB86      CKTSRKAVERSVQLLKNASA-PTGGVVLNLLPKRRLS---------GY--------Y---
A0A146G2Q9      RRFPRAMLQRVKQAVLNVGG-NILGVVLNNVDVRHDQ---------HYQ--YYTS-Y---
A0A2T6D3Y2      RRFPRAMLQRVKQAVHNVGG-NILGVVLNNVDVRHDQ---------HYQ--YYTS-Y---
A0A2V2SDV4      RRYPQPLNIRAKQLIEKVGG-NLVGIVLNNINMSQDE---------NYY--YYSGYY---
A0A2V5PK75      RRYPQPMNVRAKQLIEKVGG-NLVGIVLNNINMSQDE---------SYY--YYSGYY---
A0A1V6DME1      RRYPQPMNIRAKQLIEKVGG-NLIGIVLNNINMSQDE---------SYY--YYSGYY---
A0A3D3DIJ3      RRYPQPMNIRAKQLIEKVGG-NLVGIVLNNINMSQDE---------SYY--YYSGYY---
A0A2D5VY59      RKYPQAMTIRAKQMVEKVGG-NLLGVVLNNINISQDS---------YYY--YYSGYY---
A0A2D8UZZ4      RKYPQAMTIRAKQMVEKVGG-NLLGVVLNNINISQDS---------YYY--YYSGYY---
A0A353DV86      RKYPQAMTIRAKQMVEKVGG-NLLGVVLNNINISQDS---------YYY--YYSGYY---
A0A2E5EPT8      RKYPQSLAVRSRQMIEKVGG-TLLGIVLNNINVSSDA---------SYY--YYSG-----
A0A350EWA4      RRYPQPMTIRAKQMIEKVGG-NLLGVVLNNINMAQDE---------NYY--YYSGYY---
A0A2N8HD92      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A2N8HIT2      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A354EBD3      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A355VEB2      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A2N8IMT3      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
R6K1U5          RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A2N8IWC2      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A2N8I441      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A1Q6UTU9      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A2N8I3A6      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A410SCC4      RKLPLKALLRQKQVIESVGG-NLVGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A3R5VEW0      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A411SSG2      RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
B2UKW3          RKLPLKALLRQKQVIESVGG-NLAGVVMNNVDITSDH---------QYQ--YYTT-Y---
A0A1M6RLZ4      RKLPRKMLVRVKQAVENVGG-TVLGVVLNNVDVKSDS---------QYQ--YYTS-Y---
A0A354T7G8      RKLPRHMLMRVKQSVENAGG-KVVGVVLNNVDLRSDA---------QYQ--YYTS-Y---
A0A2S7U4L6      RKLPRNMLVRVKQAVENVGG-TVLGVVLNNVDLRSDS---------QYQ--YYTS-Y---
A0A2E8MEZ0      RKLPRNMLLRVKQAVENVGG-QVIGVVLNNVDVRSDS---------QYQ--YYTS-Y---
A0A2E3EC33      RKLPRGMLIRVKQAIENVGG-KALGVVLNNVDVRSDN---------QYQ--YYTS-Y---
A0A2E4GN01      RKLPRGMLIRVKQAIENVGG-KALGVVLNNVDVRSDN---------QYQ--YYTS-Y---
A0A1Z8XU55      RKLPRGMLVRVKQAIQNVGG-TALGVVLNNVDVRSDN---------QYQ--YYTS-Y---
A0A2E1RQR9      RKLPRGMLVRVKQAIQNVGG-TALGVVLNNVDVRSDN---------QYQ--YYTS-Y---
A0A2E3ISQ4      RKLPRGMLLRVKQAIQNVGG-TALGVVLNNVDVRSDN---------QYQ--YYTS-Y---
A0A2D6W6F4      RKLPRGMLLRVKQAIQNVGG-TALGVVLNNVDVRSDN---------XYQ--YYTS-Y---
A0A2D8Z5A8      RKLPRGMLLRVKQAIQNVGG-TALGVVLNNVDVRSDN---------QYQ--YYTS-Y---
                                        .  .                                

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      YEYYSQDPPAITDNAPALSENGHGRLSRRSRLNGSFPVTLKPVASEKSSNGVSTGALDVV
A0A2V5PST3      YGTVA-------------------------------------------------------
A0A2V5PXM3      YGYYG-------------------------------------------------------
A0A139SU05      YRYYR-------------------------------------------------------
A0A1D8AZK8      YRYYR-------------------------------------------------------
A0A1Q6UXG8      YGYGT-------------------------------------------------------
A0A2N8I9W1      YGYGS-------------------------------------------------------
A0A3R5SIG7      YGYGS-------------------------------------------------------
A0A2N8IBZ6      YGYGS-------------------------------------------------------
A0A2N8IJW9      YGYGS-------------------------------------------------------
R6J100          YGYGS-------------------------------------------------------
A0A139TV24      YGYNT-------------------------------------------------------
A0A2N8HT11      NTSKN-------------------------------------------------------
R7DS70          NTSKN-------------------------------------------------------
A0A2N8HNL6      NTSKN-------------------------------------------------------
A0A1V5QB01      YDYDH-------------------------------------------------------
A0A139SPN4      YRYYR-------------------------------------------------------
A0A1V6E7N1      YRYYR-------------------------------------------------------
A0A2T6CWI7      YRYYR-------------------------------------------------------
A0A2D9MYT1      YASHY-------------------------------------------------------
A0A258ANJ7      YKGSE-------------------------------------------------------
A0A139TLN4      YAMYR-------------------------------------------------------
A0A1G3ZFT0      --YYE-------------------------------------------------------
A0A1Z8ZMT6      YGQYG-------------------------------------------------------
A0A2E8MCT7      YGHYG-------------------------------------------------------
A0A290QGD9      KDYYV-------------------------------------------------------
A0A1D8AS58      KDYYV-------------------------------------------------------
I6AQC1          KDYYV-------------------------------------------------------
W0ITH7          KDYYV-------------------------------------------------------
A0A290Q2Z2      YAYYS-------------------------------------------------------
A0A2A2RGK2      YGSYG-------------------------------------------------------
A0A2A2XXF7      YGSYG-------------------------------------------------------
A0A2A2R5D6      NYYYN-------------------------------------------------------
A0A1J4XH17      YDYYN-------------------------------------------------------
A0A3C1VJ32      HDYYY-------------------------------------------------------
A0A2N9NTX7      HDYYS-------------------------------------------------------
B9XK55          HDYYS-------------------------------------------------------
A0A2E6T482      YDYYY-------------------------------------------------------
A0A3C0DQZ7      YDYYY-------------------------------------------------------
A0A1Z9CBK5      YDYYY-------------------------------------------------------
A0A2D6ZI96      YDYYY-------------------------------------------------------
A0A358KGZ3      YDYYY-------------------------------------------------------
A0A2E9ZQX4      XDYYX-------------------------------------------------------
A0A3D5JZU0      YDYYY-------------------------------------------------------
A0A2E6HCR0      YDYYY-------------------------------------------------------
A0A1Z8WN04      YDNYY-------------------------------------------------------
A0A2D7L1N4      YDNYY-------------------------------------------------------
A0A2E2R937      YDNYY-------------------------------------------------------
A0A2D5MR66      YDNYY-------------------------------------------------------
A0A2E0PDQ1      YDNYY-------------------------------------------------------
A0A2E2ZZP9      YDNYY-------------------------------------------------------
A0A2A2RGF2      YNYHS-------------------------------------------------------
A0A2G4I5Y6      YNYRS-------------------------------------------------------
A0A3M1I883      YDYYY-------------------------------------------------------
A0A1V6JZ45      YDYYS-------------------------------------------------------
A0A356NPK0      YDYYS-------------------------------------------------------
A0A2D7B5P5      YDYYS-------------------------------------------------------
A0A3D3XGB5      YDYYS-------------------------------------------------------
A0A2V6F8A1      YDYYS-------------------------------------------------------
A0A2V5TNH4      YDYYA-------------------------------------------------------
A0A2V5X5Q6      YDYYA-------------------------------------------------------
A0A139TS01      YSYYS-------------------------------------------------------
A0A2V5URB2      --YYP-------------------------------------------------------
A0A2V2DJ66      QNYYM-------------------------------------------------------
R7L5A9          QNYYT-------------------------------------------------------
A0A2V6JLK8      YGYYQ-------------------------------------------------------
A0A2W5Z1A5      YGYYQ-------------------------------------------------------
A0A2V6EA09      YAYYQ-------------------------------------------------------
A0A2V6GQI7      YAYYQ-------------------------------------------------------
A0A2A2XXW5      YSSHY-------------------------------------------------------
A0A3R5R2M8      YGTGS-------------------------------------------------------
A0A411SUQ6      YGYGT-------------------------------------------------------
A0A2N8HZF2      YGYGT-------------------------------------------------------
A0A354E720      YGYGA-------------------------------------------------------
B2UPB6          YGYGT-------------------------------------------------------
A0A3C1HEJ2      YARYR-------------------------------------------------------
A0A1V6JU76      YSSYH-------------------------------------------------------
A0A1Q6UHJ9      QNYYT-------------------------------------------------------
A0A2V2BXR0      QNYYT-------------------------------------------------------
A0A2D8V0G3      YASYY-------------------------------------------------------
A0A348S017      YASYY-------------------------------------------------------
A0A3C1UUV7      YASYY-------------------------------------------------------
A0A350I3V2      YASYY-------------------------------------------------------
A0A3D3XF90      YASYY-------------------------------------------------------
A0A2D7B522      YASYY-------------------------------------------------------
A0A356NIC2      YASYY-------------------------------------------------------
R7DZW0          YAVYR-------------------------------------------------------
A0A2N8HID1      YAVYR-------------------------------------------------------
A0A2N8HS06      YAVYR-------------------------------------------------------
A0A3R8IT45      YKDYY-------------------------------------------------------
A0A1H1MGC9      YKDYY-------------------------------------------------------
A0A2A2PYE8      YKDYY-------------------------------------------------------
A0A2T6CN73      YKDYY-------------------------------------------------------
A0A2N8HDG3      YGYHY-------------------------------------------------------
A0A2U8DZK4      YAYYG-------------------------------------------------------
A0A1D8AWD4      YSYYS-------------------------------------------------------
A0A2T6DFL8      YAYYH-------------------------------------------------------
A0A178IH18      YAYYS-------------------------------------------------------
A0A2T6DT99      YAYYS-------------------------------------------------------
A0A1G3ZT33      YDYYS-------------------------------------------------------
A0A3E1E2T2      YSYYS-------------------------------------------------------
B1ZMW1          YSYYS-------------------------------------------------------
A0A3D1TI55      SHYYG-------------------------------------------------------
A0A2G4G428      YEKYY-------------------------------------------------------
A0A3E1ET42      YTYYS-------------------------------------------------------
A0A2A2YDW8      YTYYA-------------------------------------------------------
A0A352XLN9      YTYYA-------------------------------------------------------
A0A3D0YP62      YTYYA-------------------------------------------------------
A0A3D3DV47      YTYYA-------------------------------------------------------
A0A2A2QX62      YTYYA-------------------------------------------------------
A0A3N5WCF1      YTYYA-------------------------------------------------------
A0A2E5XJ49      YTYYA-------------------------------------------------------
A0A2E6SBY8      YTYYA-------------------------------------------------------
A0A2E5QMS4      YTYYA-------------------------------------------------------
A0A2E7YXQ3      YTYYA-------------------------------------------------------
A0A2E3H787      YTYYA-------------------------------------------------------
A0A2E7AGN1      YTYYA-------------------------------------------------------
A0A2E7AKY7      YTYYA-------------------------------------------------------
A0A3D4CU34      YTYYA-------------------------------------------------------
A0A2E8M146      YTYYA-------------------------------------------------------
A0A355S8S2      YTYYA-------------------------------------------------------
A0A2D6DVN8      YTYYA-------------------------------------------------------
A0A3C1W2R2      YTYYA-------------------------------------------------------
A0A2E3NAY6      YTYYA-------------------------------------------------------
A0A2E3II01      YTYYA-------------------------------------------------------
A0A368B8C5      YTYYA-------------------------------------------------------
A0A3R7RBB5      YTYYA-------------------------------------------------------
B4DB23          NEYYG-------------------------------------------------------
A0A139TUL1      YSGSE-------------------------------------------------------
A0A2N8HCB0      Y--SE-------------------------------------------------------
A0A2N8HP04      Y--SE-------------------------------------------------------
A0A2N8HRJ0      Y--SE-------------------------------------------------------
A0A366HAG0      YGYYS-------------------------------------------------------
A0A3M1I8A3      YSSYR-------------------------------------------------------
A0A0R2XQ77      YQDYY-------------------------------------------------------
A0A2E9IN28      YQDYY-------------------------------------------------------
D5ENH7          YQDYY-------------------------------------------------------
A0A351WE84      TQYNP-------------------------------------------------------
A0A146GCJ0      SVYGE-------------------------------------------------------
A0A2T6D6H8      GVYGA-------------------------------------------------------
A0A1V5QDZ6      SQYYQ-------------------------------------------------------
A0A3D4HF88      YDKYY-------------------------------------------------------
A0A351MR11      YSKYY-------------------------------------------------------
A0A1V6J089      RKYYG-------------------------------------------------------
A0A3C1BZR1      KKYYG-------------------------------------------------------
A0A1H6KPB7      YSYYS-------------------------------------------------------
A0A2E9ISN4      YDAYG-------------------------------------------------------
B9XAX1          YHYTP-------------------------------------------------------
I0JYY7          YAYKE-------------------------------------------------------
A0A3E1EJT7      KEYYN-------------------------------------------------------
A0A317ZP96      YQDYY-------------------------------------------------------
A0A2D5WGA5      YDYYY-------------------------------------------------------
A0A2E7SSH2      YDYYY-------------------------------------------------------
A0A349GXM8      YDYYY-------------------------------------------------------
B3DZK9          YAYKY-------------------------------------------------------
A0A2A2XV69      YNYYS-------------------------------------------------------
A0A3C1VB86      YSYHH-------------------------------------------------------
A0A146G2Q9      YNYYY-------------------------------------------------------
A0A2T6D3Y2      YNYYY-------------------------------------------------------
A0A2V2SDV4      HE----------------------------------------------------------
A0A2V5PK75      HDYYS-------------------------------------------------------
A0A1V6DME1      HDYYY-------------------------------------------------------
A0A3D3DIJ3      HDYYY-------------------------------------------------------
A0A2D5VY59      YDYYS-------------------------------------------------------
A0A2D8UZZ4      YDYYS-------------------------------------------------------
A0A353DV86      YDYYS-------------------------------------------------------
A0A2E5EPT8      YHYHD-------------------------------------------------------
A0A350EWA4      YDYYS-------------------------------------------------------
A0A2N8HD92      YSYYS-------------------------------------------------------
A0A2N8HIT2      YSYYS-------------------------------------------------------
A0A354EBD3      YSYYS-------------------------------------------------------
A0A355VEB2      YSYYS-------------------------------------------------------
A0A2N8IMT3      YSYYS-------------------------------------------------------
R6K1U5          YSYYS-------------------------------------------------------
A0A2N8IWC2      YSYYS-------------------------------------------------------
A0A2N8I441      YSYYS-------------------------------------------------------
A0A1Q6UTU9      YSYYS-------------------------------------------------------
A0A2N8I3A6      YSYYS-------------------------------------------------------
A0A410SCC4      YSYYS-------------------------------------------------------
A0A3R5VEW0      YSYYS-------------------------------------------------------
A0A411SSG2      YSYYS-------------------------------------------------------
B2UKW3          YSYYS-------------------------------------------------------
A0A1M6RLZ4      YTYYA-------------------------------------------------------
A0A354T7G8      YTYYA-------------------------------------------------------
A0A2S7U4L6      YTYYA-------------------------------------------------------
A0A2E8MEZ0      YTYYA-------------------------------------------------------
A0A2E3EC33      YTYYS-------------------------------------------------------
A0A2E4GN01      YTYYS-------------------------------------------------------
A0A1Z8XU55      YTYYA-------------------------------------------------------
A0A2E1RQR9      YTYYA-------------------------------------------------------
A0A2E3ISQ4      YTYYA-------------------------------------------------------
A0A2D6W6F4      YTYYA-------------------------------------------------------
A0A2D8Z5A8      YTYYA-------------------------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      RAKLGEAMGPMASLVLRDSIRALGESSESFPEAKLEVLVQHVSQEILDDYQRQRFEEETL
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1Q6UXG8      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A3R5SIG7      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2T6CWI7      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A1Q6UTU9      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      ------------------------------------------------------------
A0A2V5UHJ2      KEIKKTTEQHGAAQPDGPVKADSAISKKKPNGTAVDNPSLTSEPAAIQEPRDGADGATAS
A0A2V5PST3      ------------------------------------------------------------
A0A2V5PXM3      ------------------------------------------------------------
A0A139SU05      ------------------------------------------------------------
A0A1D8AZK8      ------------------------------------------------------------
A0A1Q6UXG8      ------------------------------------------------------------
A0A2N8I9W1      ------------------------------------------------------------
A0A3R5SIG7      ------------------------------------------------------------
A0A2N8IBZ6      ------------------------------------------------------------
A0A2N8IJW9      ------------------------------------------------------------
R6J100          ------------------------------------------------------------
A0A139TV24      ------------------------------------------------------------
A0A2N8HT11      ------------------------------------------------------------
R7DS70          ------------------------------------------------------------
A0A2N8HNL6      ------------------------------------------------------------
A0A1V5QB01      ------------------------------------------------------------
A0A139SPN4      ------------------------------------------------------------
A0A1V6E7N1      ------------------------------------------------------------
A0A2T6CWI7      ------------------------------------------------------------
A0A2D9MYT1      ------------------------------------------------------------
A0A258ANJ7      ------------------------------------------------------------
A0A139TLN4      ------------------------------------------------------------
A0A1G3ZFT0      ------------------------------------------------------------
A0A1Z8ZMT6      ------------------------------------------------------------
A0A2E8MCT7      ------------------------------------------------------------
A0A290QGD9      ------------------------------------------------------------
A0A1D8AS58      ------------------------------------------------------------
I6AQC1          ------------------------------------------------------------
W0ITH7          ------------------------------------------------------------
A0A290Q2Z2      ------------------------------------------------------------
A0A2A2RGK2      ------------------------------------------------------------
A0A2A2XXF7      ------------------------------------------------------------
A0A2A2R5D6      ------------------------------------------------------------
A0A1J4XH17      ------------------------------------------------------------
A0A3C1VJ32      ------------------------------------------------------------
A0A2N9NTX7      ------------------------------------------------------------
B9XK55          ------------------------------------------------------------
A0A2E6T482      ------------------------------------------------------------
A0A3C0DQZ7      ------------------------------------------------------------
A0A1Z9CBK5      ------------------------------------------------------------
A0A2D6ZI96      ------------------------------------------------------------
A0A358KGZ3      ------------------------------------------------------------
A0A2E9ZQX4      ------------------------------------------------------------
A0A3D5JZU0      ------------------------------------------------------------
A0A2E6HCR0      ------------------------------------------------------------
A0A1Z8WN04      ------------------------------------------------------------
A0A2D7L1N4      ------------------------------------------------------------
A0A2E2R937      ------------------------------------------------------------
A0A2D5MR66      ------------------------------------------------------------
A0A2E0PDQ1      ------------------------------------------------------------
A0A2E2ZZP9      ------------------------------------------------------------
A0A2A2RGF2      ------------------------------------------------------------
A0A2G4I5Y6      ------------------------------------------------------------
A0A3M1I883      ------------------------------------------------------------
A0A1V6JZ45      ------------------------------------------------------------
A0A356NPK0      ------------------------------------------------------------
A0A2D7B5P5      ------------------------------------------------------------
A0A3D3XGB5      ------------------------------------------------------------
A0A2V6F8A1      ------------------------------------------------------------
A0A2V5TNH4      ------------------------------------------------------------
A0A2V5X5Q6      ------------------------------------------------------------
A0A139TS01      ------------------------------------------------------------
A0A2V5URB2      ------------------------------------------------------------
A0A2V2DJ66      ------------------------------------------------------------
R7L5A9          ------------------------------------------------------------
A0A2V6JLK8      ------------------------------------------------------------
A0A2W5Z1A5      ------------------------------------------------------------
A0A2V6EA09      ------------------------------------------------------------
A0A2V6GQI7      ------------------------------------------------------------
A0A2A2XXW5      ------------------------------------------------------------
A0A3R5R2M8      ------------------------------------------------------------
A0A411SUQ6      ------------------------------------------------------------
A0A2N8HZF2      ------------------------------------------------------------
A0A354E720      ------------------------------------------------------------
B2UPB6          ------------------------------------------------------------
A0A3C1HEJ2      ------------------------------------------------------------
A0A1V6JU76      ------------------------------------------------------------
A0A1Q6UHJ9      ------------------------------------------------------------
A0A2V2BXR0      ------------------------------------------------------------
A0A2D8V0G3      ------------------------------------------------------------
A0A348S017      ------------------------------------------------------------
A0A3C1UUV7      ------------------------------------------------------------
A0A350I3V2      ------------------------------------------------------------
A0A3D3XF90      ------------------------------------------------------------
A0A2D7B522      ------------------------------------------------------------
A0A356NIC2      ------------------------------------------------------------
R7DZW0          ------------------------------------------------------------
A0A2N8HID1      ------------------------------------------------------------
A0A2N8HS06      ------------------------------------------------------------
A0A3R8IT45      ------------------------------------------------------------
A0A1H1MGC9      ------------------------------------------------------------
A0A2A2PYE8      ------------------------------------------------------------
A0A2T6CN73      ------------------------------------------------------------
A0A2N8HDG3      ------------------------------------------------------------
A0A2U8DZK4      ------------------------------------------------------------
A0A1D8AWD4      ------------------------------------------------------------
A0A2T6DFL8      ------------------------------------------------------------
A0A178IH18      ------------------------------------------------------------
A0A2T6DT99      ------------------------------------------------------------
A0A1G3ZT33      ------------------------------------------------------------
A0A3E1E2T2      ------------------------------------------------------------
B1ZMW1          ------------------------------------------------------------
A0A3D1TI55      ------------------------------------------------------------
A0A2G4G428      ------------------------------------------------------------
A0A3E1ET42      ------------------------------------------------------------
A0A2A2YDW8      ------------------------------------------------------------
A0A352XLN9      ------------------------------------------------------------
A0A3D0YP62      ------------------------------------------------------------
A0A3D3DV47      ------------------------------------------------------------
A0A2A2QX62      ------------------------------------------------------------
A0A3N5WCF1      ------------------------------------------------------------
A0A2E5XJ49      ------------------------------------------------------------
A0A2E6SBY8      ------------------------------------------------------------
A0A2E5QMS4      ------------------------------------------------------------
A0A2E7YXQ3      ------------------------------------------------------------
A0A2E3H787      ------------------------------------------------------------
A0A2E7AGN1      ------------------------------------------------------------
A0A2E7AKY7      ------------------------------------------------------------
A0A3D4CU34      ------------------------------------------------------------
A0A2E8M146      ------------------------------------------------------------
A0A355S8S2      ------------------------------------------------------------
A0A2D6DVN8      ------------------------------------------------------------
A0A3C1W2R2      ------------------------------------------------------------
A0A2E3NAY6      ------------------------------------------------------------
A0A2E3II01      ------------------------------------------------------------
A0A368B8C5      ------------------------------------------------------------
A0A3R7RBB5      ------------------------------------------------------------
B4DB23          ------------------------------------------------------------
A0A139TUL1      ------------------------------------------------------------
A0A2N8HCB0      ------------------------------------------------------------
A0A2N8HP04      ------------------------------------------------------------
A0A2N8HRJ0      ------------------------------------------------------------
A0A366HAG0      ------------------------------------------------------------
A0A3M1I8A3      ------------------------------------------------------------
A0A0R2XQ77      ------------------------------------------------------------
A0A2E9IN28      ------------------------------------------------------------
D5ENH7          ------------------------------------------------------------
A0A351WE84      ------------------------------------------------------------
A0A146GCJ0      ------------------------------------------------------------
A0A2T6D6H8      ------------------------------------------------------------
A0A1V5QDZ6      ------------------------------------------------------------
A0A3D4HF88      ------------------------------------------------------------
A0A351MR11      ------------------------------------------------------------
A0A1V6J089      ------------------------------------------------------------
A0A3C1BZR1      ------------------------------------------------------------
A0A1H6KPB7      ------------------------------------------------------------
A0A2E9ISN4      ------------------------------------------------------------
B9XAX1          ------------------------------------------------------------
I0JYY7          ------------------------------------------------------------
A0A3E1EJT7      ------------------------------------------------------------
A0A317ZP96      ------------------------------------------------------------
A0A2D5WGA5      ------------------------------------------------------------
A0A2E7SSH2      ------------------------------------------------------------
A0A349GXM8      ------------------------------------------------------------
B3DZK9          ------------------------------------------------------------
A0A2A2XV69      ------------------------------------------------------------
A0A3C1VB86      ------------------------------------------------------------
A0A146G2Q9      ------------------------------------------------------------
A0A2T6D3Y2      ------------------------------------------------------------
A0A2V2SDV4      ------------------------------------------------------------
A0A2V5PK75      ------------------------------------------------------------
A0A1V6DME1      ------------------------------------------------------------
A0A3D3DIJ3      ------------------------------------------------------------
A0A2D5VY59      ------------------------------------------------------------
A0A2D8UZZ4      ------------------------------------------------------------
A0A353DV86      ------------------------------------------------------------
A0A2E5EPT8      ------------------------------------------------------------
A0A350EWA4      ------------------------------------------------------------
A0A2N8HD92      ------------------------------------------------------------
A0A2N8HIT2      ------------------------------------------------------------
A0A354EBD3      ------------------------------------------------------------
A0A355VEB2      ------------------------------------------------------------
A0A2N8IMT3      ------------------------------------------------------------
R6K1U5          ------------------------------------------------------------
A0A2N8IWC2      ------------------------------------------------------------
A0A2N8I441      ------------------------------------------------------------
A0A1Q6UTU9      ------------------------------------------------------------
A0A2N8I3A6      ------------------------------------------------------------
A0A410SCC4      ------------------------------------------------------------
A0A3R5VEW0      ------------------------------------------------------------
A0A411SSG2      ------------------------------------------------------------
B2UKW3          ------------------------------------------------------------
A0A1M6RLZ4      ------------------------------------------------------------
A0A354T7G8      ------------------------------------------------------------
A0A2S7U4L6      ------------------------------------------------------------
A0A2E8MEZ0      ------------------------------------------------------------
A0A2E3EC33      ------------------------------------------------------------
A0A2E4GN01      ------------------------------------------------------------
A0A1Z8XU55      ------------------------------------------------------------
A0A2E1RQR9      ------------------------------------------------------------
A0A2E3ISQ4      ------------------------------------------------------------
A0A2D6W6F4      ------------------------------------------------------------
A0A2D8Z5A8      ------------------------------------------------------------
                                                                            

A0A2A2XVF1      -----EKDSVYGTKT---------------------------------------------
A0A2V5UHJ2      GAASISEKTSEALPHRPSKNPAAIPKPATKKTMNKESREELSPEFLKLVIVRLTQAMGPI
A0A2V5PST3      -----AAENGNGGEHTDVEVLMNDGPFEKDPWPKIAASEIVPQNFFDHIVSKLRDAVGPM
A0A2V5PXM3      -----KYGHGQKEKARAAAA----------------------------------------
A0A139SU05      -----SYGKYTERVDRPERETKRPKKVVEEAEVSEIA-----------------------
A0A1D8AZK8      -----SYKKYYGSQS---------------------------------------------
A0A1Q6UXG8      -----KEPQQTSRKQNK-------------------------------------------
A0A2N8I9W1      -----GEPRQTTRKQD--------------------------------------------
A0A3R5SIG7      -----GEPRQTTRKQD--------------------------------------------
A0A2N8IBZ6      -----GEPRQTTRKQD--------------------------------------------
A0A2N8IJW9      -----GEPRQTTRKQD--------------------------------------------
R6J100          -----GEPRQTTRKQD--------------------------------------------
A0A139TV24      -----TNS----------------------------------------------------
A0A2N8HT11      -----NPS----------------------------------------------------
R7DS70          -----NPS----------------------------------------------------
A0A2N8HNL6      -----NPS----------------------------------------------------
A0A1V5QB01      -----IRESKEDAKT---------------------------------------------
A0A139SPN4      -----SYGKYTNVEPARGELDREPARAPEAAPAAEPAVAA--------------------
A0A1V6E7N1      -----SYKKYYGTHG---------------------------------------------
A0A2T6CWI7      -----SYKKYYGAQT---------------------------------------------
A0A2D9MYT1      -----KSDKPXEEEAXQLPLQPGVKXAGKEEXSA--------------------------
A0A258ANJ7      -----TDETAPLRPASRGLHTPSNFG----------------------------------
A0A139TLN4      -----SFDTSSPCPGK--------------------------------------------
A0A1G3ZFT0      -----DESDHPKKKR------------------------------------RTLV-----
A0A1Z8ZMT6      -----DDA----------------------------------------------------
A0A2E8MCT7      -----DDT----------------------------------------------------
A0A290QGD9      -----VMSKKDDTQSPLK------------------------------------------
A0A1D8AS58      -----TMAKQDGEPDAR-------------------------------------------
I6AQC1          -----MTESEEGEDTAEADDKVPEMPTSRS------------------------------
W0ITH7          -----MTESEEGEDTAEADDKVPEMPTSRS------------------------------
A0A290Q2Z2      -----ARENRSSERRDKRSRTEQAERAKSDERITFTERERDERRKS--------------
A0A2A2RGK2      -----AKGVYGE------------------------------------------------
A0A2A2XXF7      -----AKGVYGE------------------------------------------------
A0A2A2R5D6      -----RNGEKKPRSGAATPQRATLAKNDEQSHGSEDF-----------------------
A0A1J4XH17      -----NGELPEKKSNLDKATKLATRVKSALSKKKNKEKTLV-------------------
A0A3C1VJ32      -----SRDPSEQEAEAKKADLAAKGPG-DTEV-----------------NIKQKY-----
A0A2N9NTX7      -----RNEDQEKGSGPD------EGPGDKTKL-----------------DIKPKY-----
B9XK55          -----KNEDESE-TATD------AGEG-KART-----------------DIKPKY-----
A0A2E6T482      -----KSREKEEENADKSEDG--AKEG-KLLAKADLGAG----------EDKPKY-----
A0A3C0DQZ7      -----KSREKEEENADKSEDG--AKEG-KLLAKADLGAG----------EDKPKY-----
A0A1Z9CBK5      -----KSREGEEDAGEEKKAD---KDQ-KLVAQANPGGS----------DVKPKY-----
A0A2D6ZI96      -----KSREGEEDAGEEKKAD---KDQ-KLVAQANPGGS----------DVKPKY-----
A0A358KGZ3      -----KSRETEDEPVEDKKDG---KEE-KLIAQADAAGE----------DVNPKY-----
A0A2E9ZQX4      -----KSRETEEEPVEDKKDG---KEE-KLIAQADAXGX----------DVXPKX-----
A0A3D5JZU0      -----KSRETEEEPVEDKKDG---KEE-KLIAQADAVGE----------DVKPKY-----
A0A2E6HCR0      -----KSRENEEESEDVKESE---NGK-SLVSEAASDRE----------DVKPKY-----
A0A1Z8WN04      -----KSREDEEGSDGTGSDNKEIKDK-SITTE-VDSSS----------DVKPKY-----
A0A2D7L1N4      -----KSREDEEGSDGTGSDNKEIKDK-SITTE-VDSSS----------DVKPKY-----
A0A2E2R937      -----KSREDEEGSDGTGSDNKEIKDK-SITTE-VGGSS----------DVKPKY-----
A0A2D5MR66      -----KSRENEEESLPEKGSD---QEK-SITNESADRDG----------SVKPKY-----
A0A2E0PDQ1      -----KTRENEEESIAVKESD---KDK-LINTEATENNE----------SVEPKY-----
A0A2E2ZZP9      -----KSRENEEEPIAEKESD---KDK-LINTEDAENNE----------SVEPKY-----
A0A2A2RGF2      -----NNNADEPGTNGKPPGKADRHKP-AAPTADAP-------------TIKPKY-----
A0A2G4I5Y6      -----NNNDDESSTNGKPPGKVDRHKP-VAPVADAT-------------SIKPKY-----
A0A3M1I883      -----GSSSEYGRRRRKSSRKRRKSRE-KDSSAEAPATAATETEEAETPELKEKF-----
A0A1V6JZ45      -----KGEYGESKSSEDDESRKAAPKK-PAEA-----------------ELKTKY-----
A0A356NPK0      -----KQDGDNTSSKKKSDGKSGKTSA-RGDL-----------------ELKNKF-----
A0A2D7B5P5      -----KQDGDNTSSKKKSDGKSGKTSA-RGDL-----------------ELKNKF-----
A0A3D3XGB5      -----KQDGDNTSSKKKSDGKSGKTSA-RGDL-----------------ELKNKF-----
A0A2V6F8A1      -----KREEEP-S--KNNGEKKKPAGE-RAQL-----------------DLKQKY-----
A0A2V5TNH4      -----KREEEPPA--KNNGEKKTPAGE-RAQL-----------------DLKQKY-----
A0A2V5X5Q6      -----KREEEPAA--KNNGEKKKPAGE-RAQL-----------------DLKQKY-----
A0A139TS01      -----AESGASGGNA----DASSLKKAERSGKAKELAATQSNDN-------EDLY-----
A0A2V5URB2      -----SARLT--------------------------------------------------
A0A2V2DJ66      -----TPPEIENQQE----GRRQPPEVSHSDGEEKNS-----------------------
R7L5A9          -----APMESDEDEQ----PPEDVPPEMPSESKQ--------------------------
A0A2V6JLK8      -----PRDKETHRRG--------------RQKSRVAANGSADNGH----IDTDEY-----
A0A2W5Z1A5      -----PQDRQS-RRS--------------RSR-AGVGAESNGASD----NGRDEY-----
A0A2V6EA09      -----PRGKET-RRG--------------RSRKAAATVAHNGASG----SDEDEY-----
A0A2V6GQI7      -----PRGKET-RRG--------------RSRKAAATVAHNGA------SDSDEY-----
A0A2A2XXW5      -----RNKSADEPAD----KKSASEKSKSA------------------------------
A0A3R5R2M8      -----RSRRNEPETA----PEDSDKQ----------------------------------
A0A411SUQ6      -----K----EPQQT----SRKQDK-----------------------------------
A0A2N8HZF2      -----K----KPQQT----SRKQNK-----------------------------------
A0A354E720      -----K----DPQQT----ARKRD------------------------------------
B2UPB6          -----K----EPQQT----SRKQDK-----------------------------------
A0A3C1HEJ2      -----EKDHSPAAPAPKAANSGK-------------------------------------
A0A1V6JU76      -----RERAESRRQAVVESSGSTPAPHA--------------------------------
A0A1Q6UHJ9      -----MPDVEEEDSE----GEEAQEGGESEDPENSENSK---------------------
A0A2V2BXR0      -----MPDVEEEDSE----GEEAQKGGESEDPENSENSK---------------------
A0A2D8V0G3      -----SNEKKLGSKKGEGAKDGELVQGGKAGKDDEPSKA---------------------
A0A348S017      -----SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------------------
A0A3C1UUV7      -----SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------------------
A0A350I3V2      -----SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------------------
A0A3D3XF90      -----SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------------------
A0A2D7B522      -----SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------------------
A0A356NIC2      -----SNEKKLEPNK----KSKSVVQLDKTAKKSESEV----------------------
R7DZW0          -----SLDTSSPCAG----K----------------------------------------
A0A2N8HID1      -----SLDTSSPCAG----K----------------------------------------
A0A2N8HS06      -----SLDTSSPCAG----K----------------------------------------
A0A3R8IT45      -----VMAGAEDAID----NSASNEEEDVVAPGSKS------------------------
A0A1H1MGC9      -----VTMAKQDPGT----VER--------------------------------------
A0A2A2PYE8      -----VVMSKNDTEQ-----EK--------------------------------------
A0A2T6CN73      -----VV-SKGDTEQ-----ER--------------------------------------
A0A2N8HDG3      -----GNTSKNAHS----------------------------------------------
A0A2U8DZK4      -----SKSARTR---------------DKTAGDTINFSEKK-------------------
A0A1D8AWD4      --------HEKPVPG----AAGAAGPNEARGSDRIEMRETREPER----KR---------
A0A2T6DFL8      -----EGSRRTRRSA----RSDK--KPEAGGEDRLDLHE---------------------
A0A178IH18      -----SRDVRRRSRR----HRSGRDRDDEADA-RETFTEPER------------------
A0A2T6DT99      -----SHGRRRSRRS----RRDDADGESDSRGDRIEYVERERRRS----KE---------
A0A1G3ZT33      -----EGHKRRKSAR----TEAA--AVPAGGAERIVLDEPDSRRH----G----------
A0A3E1E2T2      -----EGSGRRRR-------SAAKPKSPGRGGDELKLS----------------------
B1ZMW1          -----DGSHRRHRPG----PSAAHQAAPAVEGDRLVLREPERKDP----A----------
A0A3D1TI55      -----PQEERTPDRP----KELDV---------------------------GEAY-----
A0A2G4G428      -----NAAAGAAAKD----DAGDAVASTENPEDNPKV-----------------------
A0A3E1ET42      -----PTNAEARKPR----QAAPAGGAPQRPAPAKAGAGRGENED---------Y-----
A0A2A2YDW8      -----PAESELPQPQ----PSTSSRPATPSSTASTSNQNDT------------LY-----
A0A352XLN9      -----PAESELPQPQ----PSTSSRPATPSSTASTSNQNDT------------LY-----
A0A3D0YP62      -----PTT------------GDEIARDTATAAPAPSQQAQPARND------EDLY-----
A0A3D3DV47      -----PTT------------GDEIARDTATAAPAPSQQAQPARND------EDLY-----
A0A2A2QX62      -----P-AESQSLPS----QGSSSAPAKPAPPRSTSRGDAADDAK------QDLY-----
A0A3N5WCF1      -----PAEAQVVAPP----PGSSSAPSKPQAAATRGADSE-------------LY-----
A0A2E5XJ49      -----PSADPDPVA------GGSPGGPPGGGSRTVSTS-APQDED------EALY-----
A0A2E6SBY8      -----PTADADPVP------XASPGGASAGRVRSAAASPSSQDDD------GGLY-----
A0A2E5QMS4      -----PSSDVDPISS----PPRKMTVST-GASPTATPSTPEEDDD------GLSY-----
A0A2E7YXQ3      -----PSSDVDPISS----PPRKMTVST-GASPTATPSTPEEDDD------GLSY-----
A0A2E3H787      -----PSADADPVPG----AGFEAAAES-ATAEATGSSKDENDDD------GLTY-----
A0A2E7AGN1      -----PSADADPVPG----GGVTKSAER-ASVKTPGGKNETDDEE------GLTY-----
A0A2E7AKY7      -----PSADADPVPG----GGVTKSAER-ATVKTPGGKNELDDEK------GLTY-----
A0A3D4CU34      -----PSADADPVPG----GGVTKSAER-ASVKTPGGKNETDDEE------GLTY-----
A0A2E8M146      -----PSADSDPVPT----VGATASATSGSALESKVVANDSEEDE------GLNY-----
A0A355S8S2      -----PSADSDPVPT----VGATASATSGSALESKVVANDSEEDE------GLNY-----
A0A2D6DVN8      -----PSADSDPVPS----VGATASGTS-AATESTVATSDEDKDE------GLTY-----
A0A3C1W2R2      -----PSADSDPVPS----VGATASGTS-AATESTVAANDEDKDE------GLTY-----
A0A2E3NAY6      -----PSADSDPVPT----GGTTSSGTT-EAIESTVATNDADDDE------GLTY-----
A0A2E3II01      -----PSADSDPVPT----VGTTASGTS-AAIESAVAATDADKDE------GLTY-----
A0A368B8C5      -----PSADSDPVPT----VGTTASGTS-AAIESAVAANDADKDE------GLTY-----
A0A3R7RBB5      -----PSADSDPVPT----VGTTASGTS-AAIESAVAANDADKDE------GLTY-----
B4DB23          -----PRRGTPKIEA----PAPQLARPRDTH--------------------REDY-----
A0A139TUL1      -----TAG----------------------------------------------------
A0A2N8HCB0      -----TDG----------------------------------------------------
A0A2N8HP04      -----TDG----------------------------------------------------
A0A2N8HRJ0      -----TDG----------------------------------------------------
A0A366HAG0      -----GDGKGDGTMK----AKRKTRQSTPAKGAKVKSPRAKA---------DEVF-----
A0A3M1I8A3      -----SRPDQIGAVR----ST---------------------------------------
A0A0R2XQ77      -----ISQDVELEDE----LAGSVEPEME--PRS--------------------------
A0A2E9IN28      -----IHHEEELEEE----MAGSVEPQSELGPKA--------------------------
D5ENH7          -----IHQEDEFEEE----LAGSVEPDKQ-------------------------------
A0A351WE84      -----DGQEKVPAKT----IAASADGK------------------------DSLF-----
A0A146GCJ0      -----KSV----------------------------------------------------
A0A2T6D6H8      -----KAG----------------------------------------------------
A0A1V5QDZ6      -----SDESKPADEL----ADTSNRK-------------------------KDAL-----
A0A3D4HF88      -----TGGSNPKA-----------------------------------------------
A0A351MR11      -----TDAADQGAEK----PAPKKDPVV--------------------------------
A0A1V6J089      -----VVRHENDDNL----TES--------------------------------------
A0A3C1BZR1      -----SSKHDKEDDA----TEA--------------------------------------
A0A1H6KPB7      -----PTEGVEPSAA----LNPLPVTSRSSKRSEVAKKTESTDQP----G-DDLY-----
A0A2E9ISN4      -----SYGTRHIESA----FLYGMESETPKNKRWKFR-----------------------
B9XAX1          -----RNGYKSIGVY----GNDYPAKIPLNT-----------------------------
I0JYY7          -----KNEIQNKNQT----QSLSPFHSLQFLNDWVQEKIKRPDK----------------
A0A3E1EJT7      -----PGGEPPVTSQ----SS---------------------------------------
A0A317ZP96      -----IQQEEEFEHE----LEGEVEPEELQTKS---------------------------
A0A2D5WGA5      -----KSREKEEESG----DAAKDGKKEPKLLAKADVGGEDE---------KPKY-----
A0A2E7SSH2      -----KSRETEEEST----EDNKNGGND-KLIAQADIGGDDV---------KPKY-----
A0A349GXM8      -----DEKGGNRRSR----RQIRWRKQLEHAGAWIRKTLMPM------------------
B3DZK9          -----RSQASSNSQE----LMRKEEEA---------------------------------
A0A2A2XV69      -----PSKNVPEKSG----QNAQAASPATTKPTPQ----------------SGEY-----
A0A3C1VB86      -----GYGYGNYGEK----AADKTSDDTRGNLASEARP-------------ENLL-----
A0A146G2Q9      -----QKPQQQKADK----KPAKKAPVSAVQQLNGEKDQ------------EDTY-----
A0A2T6D3Y2      -----QKPQQQKADK----KPAKKAPVSAVQQLNGEKDQ------------EDTY-----
A0A2V2SDV4      -------EGTNDEEQ----EAAPGGPASQKS-----------------------------
A0A2V5PK75      -----VNED---QES----AARPDEPAGDKARRA--------------------------
A0A1V6DME1      -----RSSESSDKDE----AAGEKKADDSQAKVEI----------------KKKY-----
A0A3D3DIJ3      -----RSEE---QEP----VVKEGAESGGKDKLDI----------------KQKY-----
A0A2D5VY59      -----KQDDSEGGSS----AQPKTKSSKTASRGDVEL--------------KNKF-----
A0A2D8UZZ4      -----KQDDSEGGSS----AQPKTKSSKTASRGDVEL--------------KNKF-----
A0A353DV86      -----KQDDSEGGSS----AQPKTKSSKTASRGDVEL--------------KNKF-----
A0A2E5EPT8      -----NPSSSGSLNI----DSKPRELKGKVDRQRGQDSSEEPDL-------KSKY-----
A0A350EWA4      -----KQNDDDGDQS----GRKNGHPATKDEPASRLD--------------LKKY-----
A0A2N8HD92      -----ADGGSSGGNV----DASSMKKAERSGKAKELAANQSHDS-------EDLY-----
A0A2N8HIT2      -----ADGGSSGENA----DASSMKKAERSGKAKELAATQSHDS-------EDLY-----
A0A354EBD3      -----TDGSSSGENA----EASSMKKAERSGKAKELAATQSHDS-------EDLY-----
A0A355VEB2      -----TDGSSSGENA----EASSMKKAERSGKAKELAATQSHDS-------EDLY-----
A0A2N8IMT3      -----ADGSSSGENA----DASSMKKVERSGKAKELAATQSHDS-------EDLY-----
R6K1U5          -----ADGSSSGENA----DASSMKKVERSGKAKELAATQSHDS-------EDLY-----
A0A2N8IWC2      -----ADGSSSGENA----DASSMKKVERSGKAKELAATQSHDS-------EDLY-----
A0A2N8I441      -----ADGSSSGENA----DASSMKKVERSGKAKELAATQSHDS-------EDLY-----
A0A1Q6UTU9      -----ADGSSSGENA----DASSMKKVERSGKAKELAATQSHDS-------EDLY-----
A0A2N8I3A6      -----ADGSSSGENA----DASSMKKVERSGKAKELAATQSHDS-------EDLY-----
A0A410SCC4      -----ADGSSSGENA----DASSMKKVERSGKAKELAATQSHDS-------EDLY-----
A0A3R5VEW0      -----ADGASSGENA----DASSMKKVERSGKAKELAATQSHDS-------EDLY-----
A0A411SSG2      -----ADGASSGENA----DASSMKKVERSGKAKELAATQSHDS-------EDLY-----
B2UKW3          -----ADGASSGENA----DASSMKKVERSGKAKELAATQSHDS-------EDLY-----
A0A1M6RLZ4      -----PSEAPQEVRA----AAQPQGAQSNS---------------------ADLY-----
A0A354T7G8      -----PTNSPTGGAG----GKTRRRKVKAETTANALTSPRTVSRP----EGEDVF-----
A0A2S7U4L6      -----PGQ--------------NKSAAAEATAKSSSDSPKT----------NDLY-----
A0A2E8MEZ0      -----PSSLEETGTP----QQMTAAPASSKTEEKKSERSSS----------EDLY-----
A0A2E3EC33      -----PSNIDPNQKI----SSDKPKAPSSKEPKGSSEEISI----------EDKF-----
A0A2E4GN01      -----PSNMDPNQKI----SSDKTKSSSSKESKSSSEEISA----------EDKY-----
A0A1Z8XU55      -----PRNLDPNMNS----NSDDLFKSGDKLASNDKDNLTA----------EDKF-----
A0A2E1RQR9      -----PRNLDPNMNS----NSDDLFKSGDKLASNDKDNLTA----------EDKF-----
A0A2E3ISQ4      -----PRNLDPNMES----DSIGSTKSESKVASNDQNNLSA----------EDKF-----
A0A2D6W6F4      -----PRNLDPDMES----GSIGSPKAGSKLASNDQNNLSA----------EDKF-----
A0A2D8Z5A8      -----PRNLDPDMES----GSIGSPKPGSKLASNDQNNLSA----------EDKF-----
                                                                            

A0A2A2XVF1      -------------------------------------------------------
A0A2V5UHJ2      APLVLREHISALGETLESFPQARLEELVQRLCKEIVTDSFRQQFEEEMAKLTSDV
A0A2V5PST3      AGLIVEDHISLLGEARNRFPKNRLQELFDRICEEILDDKLKNDFQQSMQEELRVL
A0A2V5PXM3      -------------------------------------------------------
A0A139SU05      -------------------------------------------------------
A0A1D8AZK8      -------------------------------------------------------
A0A1Q6UXG8      -------------------------------------------------------
A0A2N8I9W1      -------------------------------------------------------
A0A3R5SIG7      -------------------------------------------------------
A0A2N8IBZ6      -------------------------------------------------------
A0A2N8IJW9      -------------------------------------------------------
R6J100          -------------------------------------------------------
A0A139TV24      -------------------------------------------------------
A0A2N8HT11      -------------------------------------------------------
R7DS70          -------------------------------------------------------
A0A2N8HNL6      -------------------------------------------------------
A0A1V5QB01      -------------------------------------------------------
A0A139SPN4      -------------------------------------------------------
A0A1V6E7N1      -------------------------------------------------------
A0A2T6CWI7      -------------------------------------------------------
A0A2D9MYT1      -------------------------------------------------------
A0A258ANJ7      -------------------------------------------------------
A0A139TLN4      -------------------------------------------------------
A0A1G3ZFT0      -------------------------------------------------------
A0A1Z8ZMT6      -------------------------------------------------------
A0A2E8MCT7      -------------------------------------------------------
A0A290QGD9      -------------------------------------------------------
A0A1D8AS58      -------------------------------------------------------
I6AQC1          -------------------------------------------------------
W0ITH7          -------------------------------------------------------
A0A290Q2Z2      -------------------------------------------------------
A0A2A2RGK2      -------------------------------------------------------
A0A2A2XXF7      -------------------------------------------------------
A0A2A2R5D6      -------------------------------------------------------
A0A1J4XH17      -------------------------------------------------------
A0A3C1VJ32      -------------------------------------------------------
A0A2N9NTX7      -------------------------------------------------------
B9XK55          -------------------------------------------------------
A0A2E6T482      -------------------------------------------------------
A0A3C0DQZ7      -------------------------------------------------------
A0A1Z9CBK5      -------------------------------------------------------
A0A2D6ZI96      -------------------------------------------------------
A0A358KGZ3      -------------------------------------------------------
A0A2E9ZQX4      -------------------------------------------------------
A0A3D5JZU0      -------------------------------------------------------
A0A2E6HCR0      -------------------------------------------------------
A0A1Z8WN04      -------------------------------------------------------
A0A2D7L1N4      -------------------------------------------------------
A0A2E2R937      -------------------------------------------------------
A0A2D5MR66      -------------------------------------------------------
A0A2E0PDQ1      -------------------------------------------------------
A0A2E2ZZP9      -------------------------------------------------------
A0A2A2RGF2      -------------------------------------------------------
A0A2G4I5Y6      -------------------------------------------------------
A0A3M1I883      -------------------------------------------------------
A0A1V6JZ45      -------------------------------------------------------
A0A356NPK0      -------------------------------------------------------
A0A2D7B5P5      -------------------------------------------------------
A0A3D3XGB5      -------------------------------------------------------
A0A2V6F8A1      -------------------------------------------------------
A0A2V5TNH4      -------------------------------------------------------
A0A2V5X5Q6      -------------------------------------------------------
A0A139TS01      -------------------------------------------------------
A0A2V5URB2      -------------------------------------------------------
A0A2V2DJ66      -------------------------------------------------------
R7L5A9          -------------------------------------------------------
A0A2V6JLK8      -------------------------------------------------------
A0A2W5Z1A5      -------------------------------------------------------
A0A2V6EA09      -------------------------------------------------------
A0A2V6GQI7      -------------------------------------------------------
A0A2A2XXW5      -------------------------------------------------------
A0A3R5R2M8      -------------------------------------------------------
A0A411SUQ6      -------------------------------------------------------
A0A2N8HZF2      -------------------------------------------------------
A0A354E720      -------------------------------------------------------
B2UPB6          -------------------------------------------------------
A0A3C1HEJ2      -------------------------------------------------------
A0A1V6JU76      -------------------------------------------------------
A0A1Q6UHJ9      -------------------------------------------------------
A0A2V2BXR0      -------------------------------------------------------
A0A2D8V0G3      -------------------------------------------------------
A0A348S017      -------------------------------------------------------
A0A3C1UUV7      -------------------------------------------------------
A0A350I3V2      -------------------------------------------------------
A0A3D3XF90      -------------------------------------------------------
A0A2D7B522      -------------------------------------------------------
A0A356NIC2      -------------------------------------------------------
R7DZW0          -------------------------------------------------------
A0A2N8HID1      -------------------------------------------------------
A0A2N8HS06      -------------------------------------------------------
A0A3R8IT45      -------------------------------------------------------
A0A1H1MGC9      -------------------------------------------------------
A0A2A2PYE8      -------------------------------------------------------
A0A2T6CN73      -------------------------------------------------------
A0A2N8HDG3      -------------------------------------------------------
A0A2U8DZK4      -------------------------------------------------------
A0A1D8AWD4      -------------------------------------------------------
A0A2T6DFL8      -------------------------------------------------------
A0A178IH18      -------------------------------------------------------
A0A2T6DT99      -------------------------------------------------------
A0A1G3ZT33      -------------------------------------------------------
A0A3E1E2T2      -------------------------------------------------------
B1ZMW1          -------------------------------------------------------
A0A3D1TI55      -------------------------------------------------------
A0A2G4G428      -------------------------------------------------------
A0A3E1ET42      -------------------------------------------------------
A0A2A2YDW8      -------------------------------------------------------
A0A352XLN9      -------------------------------------------------------
A0A3D0YP62      -------------------------------------------------------
A0A3D3DV47      -------------------------------------------------------
A0A2A2QX62      -------------------------------------------------------
A0A3N5WCF1      -------------------------------------------------------
A0A2E5XJ49      -------------------------------------------------------
A0A2E6SBY8      -------------------------------------------------------
A0A2E5QMS4      -------------------------------------------------------
A0A2E7YXQ3      -------------------------------------------------------
A0A2E3H787      -------------------------------------------------------
A0A2E7AGN1      -------------------------------------------------------
A0A2E7AKY7      -------------------------------------------------------
A0A3D4CU34      -------------------------------------------------------
A0A2E8M146      -------------------------------------------------------
A0A355S8S2      -------------------------------------------------------
A0A2D6DVN8      -------------------------------------------------------
A0A3C1W2R2      -------------------------------------------------------
A0A2E3NAY6      -------------------------------------------------------
A0A2E3II01      -------------------------------------------------------
A0A368B8C5      -------------------------------------------------------
A0A3R7RBB5      -------------------------------------------------------
B4DB23          -------------------------------------------------------
A0A139TUL1      -------------------------------------------------------
A0A2N8HCB0      -------------------------------------------------------
A0A2N8HP04      -------------------------------------------------------
A0A2N8HRJ0      -------------------------------------------------------
A0A366HAG0      -------------------------------------------------------
A0A3M1I8A3      -------------------------------------------------------
A0A0R2XQ77      -------------------------------------------------------
A0A2E9IN28      -------------------------------------------------------
D5ENH7          -------------------------------------------------------
A0A351WE84      -------------------------------------------------------
A0A146GCJ0      -------------------------------------------------------
A0A2T6D6H8      -------------------------------------------------------
A0A1V5QDZ6      -------------------------------------------------------
A0A3D4HF88      -------------------------------------------------------
A0A351MR11      -------------------------------------------------------
A0A1V6J089      -------------------------------------------------------
A0A3C1BZR1      -------------------------------------------------------
A0A1H6KPB7      -------------------------------------------------------
A0A2E9ISN4      -------------------------------------------------------
B9XAX1          -------------------------------------------------------
I0JYY7          -------------------------------------------------------
A0A3E1EJT7      -------------------------------------------------------
A0A317ZP96      -------------------------------------------------------
A0A2D5WGA5      -------------------------------------------------------
A0A2E7SSH2      -------------------------------------------------------
A0A349GXM8      -------------------------------------------------------
B3DZK9          -------------------------------------------------------
A0A2A2XV69      -------------------------------------------------------
A0A3C1VB86      -------------------------------------------------------
A0A146G2Q9      -------------------------------------------------------
A0A2T6D3Y2      -------------------------------------------------------
A0A2V2SDV4      -------------------------------------------------------
A0A2V5PK75      -------------------------------------------------------
A0A1V6DME1      -------------------------------------------------------
A0A3D3DIJ3      -------------------------------------------------------
A0A2D5VY59      -------------------------------------------------------
A0A2D8UZZ4      -------------------------------------------------------
A0A353DV86      -------------------------------------------------------
A0A2E5EPT8      -------------------------------------------------------
A0A350EWA4      -------------------------------------------------------
A0A2N8HD92      -------------------------------------------------------
A0A2N8HIT2      -------------------------------------------------------
A0A354EBD3      -------------------------------------------------------
A0A355VEB2      -------------------------------------------------------
A0A2N8IMT3      -------------------------------------------------------
R6K1U5          -------------------------------------------------------
A0A2N8IWC2      -------------------------------------------------------
A0A2N8I441      -------------------------------------------------------
A0A1Q6UTU9      -------------------------------------------------------
A0A2N8I3A6      -------------------------------------------------------
A0A410SCC4      -------------------------------------------------------
A0A3R5VEW0      -------------------------------------------------------
A0A411SSG2      -------------------------------------------------------
B2UKW3          -------------------------------------------------------
A0A1M6RLZ4      -------------------------------------------------------
A0A354T7G8      -------------------------------------------------------
A0A2S7U4L6      -------------------------------------------------------
A0A2E8MEZ0      -------------------------------------------------------
A0A2E3EC33      -------------------------------------------------------
A0A2E4GN01      -------------------------------------------------------
A0A1Z8XU55      -------------------------------------------------------
A0A2E1RQR9      -------------------------------------------------------
A0A2E3ISQ4      -------------------------------------------------------
A0A2D6W6F4      -------------------------------------------------------
A0A2D8Z5A8      -------------------------------------------------------
                                                                       

© 1998-2019