BYKdb

Dataset for cluster orphancd of phylum abditibacteriota

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A2S8SWL9 [Bacteria] Bacterial tyrosine kinase [Abditibacteriota][Abditibacterium utsteinense] (length=781 residues).
MKSKQNPDFTPQSFPAAAHQSFPNNDSSSNGFQGKNANGTSEAIDVSRALEGGTNPSALALPPGGAGGFSDYEDGTEQGG
FSRVLRAFLRRWYYALGLASLILAGGVYYAITAPPVFRATTIIEDTSSSHGPQFNSDLPVLNEMLGSSDKASIQTQVANL
SSSWVMQGAQKRLSAPVRHLMDNGSVVDTAVVPQTGTNLISVNVLAHHPKVASELATRICQEYIYQSLQRNREAMKGSLA
YAKNQLDTVQLRLSKAQEQLKDYKQNNGTMNLESESEQIVTRLADAQTRLQAIESESAANAVQRQKLRVLLAQTPESKVV
PTKIIVSPQLDDMRNKLNGLNLELSTLRSTYTDAYPQVGALKRQIADIEKRIATSRKTQVADWMRIENPVSQQISQKLTE
LEGEVEASKSRQISLRREVAQATARLQKLPQKELGMSRLMANVASLAAAQQNLDNQYQLLRISEEAKIADARIMQQAETP
LVPVAPNRKNVVLYALVLGLIAGLGLTVILDTLDNRIRDEDDAKRAINLPILGSVPLIKVTQENLLLSDDKPSILLEHYR
MLRTNISFSGIDSPIKSIVVTSSVPNEGKSTCAANLAAAAALSGEQVILVDCDLRRPTMHKLFGVSNVLGLSNVVMGNAT
LEEAMQETSIPGLRILTAGPSTPNLFKLISSSAMRSTLQKLADSEGFVVFDTPPALGLADARVISVVADATLLVVSCNEA
TRQAIVQTKDLLTQSGTYLIGILLNKVSVLGNNDYYRYYSSYLEREEEHFDKALEEPKSSK
© 1998-2019