BYKdb

Dataset for cluster tadcd of phylum abditibacteriota

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A2S8SNV1 [Bacteria] Bacterial tyrosine kinase [Abditibacteriota][Abditibacterium utsteinense] (length=753 residues).
MNQQPDIPANGAPPLSPGSSRAISAFPEERVSASLPDNSAVYAHDADEESFDWQRLLGIVRRRRKIIGFTLAGVLSLAGI
YLVLSPKIYKASADLLINTEQKSSSQGLGSLPAITDLLGATGTRSQDTEVEILRSAVVQDAATALVPNAMRPAVKKNIRV
DIQPKRSTDIITVNVQSRDPKLAITYSNAICEAYRLQNQQNNSAQYRETADYVGGQLAMVRKKLDQKRDELRKFKEGSGI
VDLPTESQARVARLNELQTAFQGAEADRTAGEAQLKTLRAQAAQMAPAEIAPSTIVVRPVVQQLKQQLTTLETQRAATSQ
EFMPGAIEVKTLDDQITALRRRLQTEASTEVGTYTRNINPVRQAVMQSISSTLAGVWSAQARAEALRANIVRAQQTVQQL
PQREYRLSQLQGDLATYQQTFQSLSDKYQTLLISQKTPIANARVITPADEALKVSPRVASTLVLAVVGGLLLAMVIAVAV
DGLDNKIYTEEDAVQATGLPVLTHVPMLGAQSGQQLLIDKADSSILLESFRMLRTQLSFISSYGHLKTLVLTSSQPGEGK
STVSANLAIALALNGKRVVLVDADLRRPRVHTLFGIEKTKGFTSVVANVCSLEEALHQTETEGLQVLPSGPTPPNPSELL
DSRAAREIIEQLKATADYVIIDAPPALMLADAQIISSVADGVLLVVSCQEAKRGAVERTCELMGQTGVKIVGMVLNKFTD
EQGGYYGYYGYKYGGYSAYLEDKALSKHDNLPS
>gnl|bykdb|A0A2S8SSE1 [Bacteria] Bacterial tyrosine kinase [Abditibacteriota][Abditibacterium utsteinense] (length=795 residues).
MKGFYATTPNPQHWLITEFTLNKSSLPDPQNNQIHNGSSNGSTPHGSAPETSLSIVDGRKELEAASFSNSGSQAYSNSPL
YTSPEAEGFDFHRLMAVMLRRWPAMLGVFLSAMLIGLATAFFSKPIYEAQATVELTAIQRNGAMADIPGLEVFQNAGQSG
SIDTQIETLRGAPLHNRAMQTLKADTQQPLRSFAPVTVTQVGTTNLISVAVQSYNPDAATKLSNAICKQYIVASLEKNRS
NSSGAVKYVQNQLDLVHKRSVEAQTKLKKFKQENRIFSISDEASALGSKLAGLQQAVAAADSERAATQAKLKGLQTLLSR
LPANRVVPSGIQRNPVVAGLQAQLTQLELERSTALREYTPKSYKVVSIDSQIKALKDQLASEAKTMVSGWQPDPSRAPLA
SDAASTQTQMWSMDARNVALKQQVQQAREAMDQLPEQEFRYTQLATDTQVLQDAYQTLSQRLQSLKIGEQAKVADARLVF
AADVPTAPIAPNKKKLILYATVLGLLGAVAMALVLDMLDNRIYSDEEAQRITGLPVLSHVPFARHQEEISLMPAPGKQAS
KTSPLLESFRMLRANIAFSAVDKPIRALVVTSSVPHEGKSNSAFNLAAAAAIDGERVILVDLDLRRPTAHSICGLPNKLG
FSSVATNRCTLEEALQDTSIPGLRVLTAGPVPPNSFKLLNTQNARTIVNQLAEQADFVVIDTPPMLGMADARLIASWVDG
TLLVVSCRDVARREVARAADLLMQGGTEVFGLVLTKITTGNNGSYGYNYYGYRQYGEYLDIAETPNELEEKTLKS
© 1998-2019