BYKdb

Dataset for cluster orphancd of phylum acidobacteria

[Download (right click)] [Alignment] [Repertoires]

236 sequence(s)

>gnl|bykdb|A0A0B6X033 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Pyrinomonas methylaliphatogenes] (length=344 residues).
MGRVFDALRRAAELDSRKREHRARPSDAQARAEEIESLLQRSEIFSSQAREPQLFSASAEHADVATAIGSALPENGWASR
VAGATVDAERSARVASFPALDVSAARADQHLIAITQPQSPECEQFRSLRTHVLHAGEKRQVQAVVITSAGVLEGKTVTAI
NLAWLLAQTDGVRALLIDGDLRRPCALSYLGLDRRPGLSEVLAGEAELDATIVRLEPAGLYLLPGGSERNDVAEMLSGPR
FSSVLAEVRRMFDYIVIDAPPLGIFTDATVLINRADAALIVVRAGYTRYSLLDRLLEPLPRERLLGIVLNGVDETLDEHS
YYYRRYYRRAEEAKKKAVAEGVAV
>gnl|bykdb|A0A136K497 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium OLB17] (length=332 residues).
MSVLQALQRKNIENPTTSKPRVVAFDANGKRNAPPDILGTELTIGSPRSAFDGQPNSSLGTALPDVETGLTAGAKPNADT
LTRSARRPLPDCVSWTVDAERVEPRLVAITSPNSSYCEEYRSLRTHVLHKSQRQHLKSIVVASVNPSEGKSVTAVNLAWM
LAQTDGVCALIIDSDLRMPSLADYLGIETEKGLSDILTGDANFKDTIVKLEPSGLYLLAGGAARPDVAELISGPKFAEIL
AEAREMFDYVIIDAPPLAIFTDATVLINKADGALLVVRANRTKYGALDRILEPLPKDRMLGVILNQSEEVLDESHYNYGY
YNYRRMAEDAAS
>gnl|bykdb|A0A143PNR5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Luteitalea pratensis] (length=316 residues).
MSRIDEALRRARGEQPEHRATDFEADAPWEFAEGTSARARSGRPDARPETPNALIPEESGVPDEVTLPPASSATGAIPEG
GLFVSLDGDERMVGAGLRQAVVEEYRKLASSLHQAQINHRLQVVLVASAVPGEGKSLTAANVALTLTTSYSRKVLLIDAD
LRRPSLHGLFRAPETSGLSEGLDAATASRVSAIQLSPLLALLPAGRPVENPVPLLTSERMGELVRDARQHFDWIVIDTPP
VALLTDANLLTKECDGALLVIHANRTPYALVQKAVQALGKPKIFGVVLNRLEDHITVHSGYGKYGGYYNDYGRGGQ
>gnl|bykdb|A0A143PXU3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Luteitalea pratensis] (length=303 residues).
MSRIDDALRRARGEQPEQAATDADIDMPWQFADSPAAPPRASHPPEQRPTSAPARVPEVARVDVKPLPEQVQRSVDDVPT
ARLVSAADANPVLIEQFRNLAAALNRLQTERTLKSLLVTSPAPGDGKSHVAVNLALTLSESYRRKVLLVDADMRRPTLHH
LFHVSGAHGLLDALRAEAEDVPAVVPVTGTLSLLPAGRPQANPVGDLSSGRMSRLIANAGSTYDWVIVDSPPAAGLADAR
IILETVDGAILVVRAAATRFAELQAATDALGPGRLLGVILNAVDPREIHREDYYGNYYGYGSK
>gnl|bykdb|A0A192WXK4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium Mor1] (length=269 residues).
MSNAVIEPSTESEESMPEDHSEPLAAGGAPRGELVPRSIKETPDVVMLTQRSSVAAERFRRLKTRLVNESKNDERVLSIT
SAAPDEGKSFVSLNLSMAFGAENPSTLLIDADLRRPSIQRWITPTPTIGLTELMTDQVELDHVLFPMQNSQTTILPAGGT
PSDPTALLSSSKFAKLVEELRNRFDWILIDTPPVVLFSDADAVSANCDGVLLVVRAGRTPKPMFKQAIGSLTSAPVVGTV
INDVTFNLPDRQSHYSGYYNWYYYEDRKK
>gnl|bykdb|A0A1E3Y5Q0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium SCN 69-37] (length=306 residues).
MRRAAEARQPISPDAGDAAGGPTVGWPAAPAPVEAFSSEGAERPRPRPVTTVPEILPSRPPASGAPSSPVGERIAADLAN
KIVVDSGMDAGSREQYRRMAATLHALQAESGLRVITVASAMPGEGKTLTAANLALTLSESYQRKVLLIDGDLRKPSQHAV
FGLPVSPGLTEGVVGTDAALSLHRVSPTLTVITAGEPTDDPMVTLAAERMQALITEAREQFDWIVIDTPPVGLLPDAGLI
SGLADGTVVVVRADATQYDFVQRSIAELGRERILGVVLNLATPPTDVRYGANYGRYAERTSPPGRR
>gnl|bykdb|A0A1F2R0X5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15] (length=762 residues).
MSESASGGAHRPSTTSASASHPTGTAGHSPASSYAPQSEVHLLDRLVVLYRYRWLCLTVFVLVSGAMIIQGYTTVRMYRA
QARLQIDDERSTAIPGLQSDQNTFYEDPEPYYQTQYRILRGRDLTRRVVQRLRLDTVPEFNGTAERAPTPISMLRDFERR
LVSLVRRAPAQPQEEPPKLDETTDESALVGAFIGRVGVEPVRGSRLVDVTFLSVEPKFAAEAANALAEEYVEQNLQVKLQ
TAQNMLDWLGKELATQQQKVEESERSLAEYREKENALSLDDKQNIVLARLNQLNDLVTKAKTQRIQREALYNQVKSIAGG
AAPDSIPIIAQNPNVQALKNKLSSLQQDKVRLLERYGDKHPQVIAVNASLQDTQRQLDQETARAVQSVRNEFETSVLEER
TLSQNLEAAKVEASDLNRKGIGYGVMEREAQSNRQVYEALLQREKELRVASNSRANNVRLVDRAEVPGSPVTPGGRRTWL
LSIVVGLVLAVGVAMGLDYMNDTIKTPEDVTKRLRLPFLGLVPSVRGAKQQPLLTSSHAPVDFSESFRSLRTTLLTRYSG
EGTKLMAVTSAQPLEGKTTAACNIAMALAYGGARVLLIDADMRRPGLHRTLRLANERGLSQVLVGQARVRDVIQRTVDPN
LLAITAGRPPSNPSELLSSERMKTLITNLRSGPFDWIVIDTPPVLAVTDAVILAPLVNGVTFVIGAEMTRRRLAERAIET
IMEARPRQVGVVLNKVDFARNKYYYTRYYGHQYKNYYAEKAS
>gnl|bykdb|A0A1F2R977 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15] (length=311 residues).
MALVMSRIDEALKRVTRAPSPSPRRAESAESRATSFGDSSLDHYPAEHHSVPWTGEGREGNVEPPAPVRPEPAGRRVQLG
PFDPSIAGKLVTGSMRPVSQEEYRRLAAVLHQMQAEHKVKTLMVTSALPREGKTLTVTNLALTLSEYFGRRVLLIDGDLR
HPSIHEILGLPNTTGLGDGLRSERVQIPFYELSPTLTVLPAGPLHASSVGGLASNRMKAVIDGAAPRFDWVLVDTPPIGL
LSDAQFLAGLVDGVLLVIGAAKTPYPLVQRAVAALGPDRLIGIVLNRVEEQTITADAYYRHYYPSSGAKDG
>gnl|bykdb|A0A1F2S3Q7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18] (length=239 residues).
MHSMATRDTLLVSLTAPASFAAEQYQGLRLAVERLARARDVRTIAVSSPAAGDGKTVTAINLAGTLARGSDDRVLLVDAD
LRRPSVASLLAIPGGGLGLADALGSGRGAADVVRTVDGCLLDVIPAGSPRAGISEILRSPRLDAFLQELRQRYAYIVLDT
PPLLPVFDAALIAKSVDGVLMVVSANRTPRKLLGEALNLLDASKVLGIVFNRDAHPLFGYYDAYCRQYFPGVSRIAGQA
>gnl|bykdb|A0A1F2T1R8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21] (length=239 residues).
MPTLDRHLVSLTEPASFAAEQYQGLRLTIERVARARDVKIIAITSPAAGDGKTVTAVNLAGALARGSDGRVLLIDADLRR
PSVATLLGIETTGPGLADVLSGNRDAAEVFRRIEPFNLSVLPAGATRAGVTEMLRSPRLEQLLQEARREYAYVVIDTPPL
LPIFDASVLAKLADGVLMIVAANQTPRKLLAEALNLLDPAKVLGIVFNQDDRPLFGYYNSYSRYYREYFTDPTQIASGA
>gnl|bykdb|A0A1F2U8T6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29] (length=738 residues).
MGRAGQARGPLSTHAVHKDVHILDLLAVIYRYRRMAFSVFILTTIALMIQGYSGVRLYQAKAQLLIEDERSTAMPGIATG
QYYEDPVPYYNTQHRILRSRELARRVVRRLQLGTHPEFNGTATPPVTLVTAVRAAAARALRGLTLLSAAVEEEAPTPDET
PAEAALVGNFLSRVVVTPVPDSKLVDVFFTAADPAVTALAATTLAEEYVAQNLELKQQSTQNMLEWLENEVAAQQTKVEQ
SERDLAEYREMENAMSLDDKNNIVVSRLNALNEASIRARTVRIEKESVNNQLKAIRDTRSVDAIPVITQNLQIQALRNQL
GDLQRQKANLTERYGDKHPEMVKVNAQLADGQRQLDVGTAKALESVRNEYERALIEERTLAAHLEEAKRDAQDLSRKSVG
YNVLEREAKSHRTVYESLLQRTNELRVSSNSRANNVRLVERGEVPGSPVTPSGRRTWGLSVVVGLFAAIAVAYGLDYMND
TVKTPEDVTRFLKMTFLGLVPSVRGDKHPLMASWDTPKHFGEAFRNLRTAIIALYPGDGPKTMAVTSAQPLEGKTTTACN
IALALAYGGMRVLLIDADLRRPGLHLSLRLTNERGLSHVLGGRARLRDVIQRTVDLNLFAITAGPTPSEPSELLASERMK
MLLSSLAQGPFDWIIIDTPPVLGVSDAVVLTPLVTGVTFVVGAEMTRRQVAEHAIETILSSRPKLLGVVLNKVDFARNKY
YYSRYYGRQYENHYAEAV
>gnl|bykdb|A0A1F2VH76 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b] (length=745 residues).
MNGPNTPANLQAGTHALTPLSQETHLLDRLSVLFKYRRAAMAVFVLVVAWNMVDSYTTIPQYQAQSRVLIDEDTAGLGTP
ADISQNFTLQDPEVYLQTQLRIIRGRELARRTAKKLELHTVPEFNGQGAKPTALAEAISTVKTYAYWPVRIVLGSTPAPS
PVATAESGDPEAYADALIGHLGVNQIRGSRLVDLLFTAADPAFAAKAANAYAEEYVAQNLELKAANLDKSLEWLTGEVGR
QEGLVKASERALADYRERQDAGGLAEGSGNIVVARLTQLNDEVTRARTNRLTKENVWNQVRSAGQDTETITTILQNPMVL
SLRNRVSEVERDRGRISERYGPRHPEYEKVTTQLADVKLQLEAEIKKAIQTAKSEYEAAVVQERTLTQALNEQKAAATDL
SRKGVDYTLILREAESNREIYNSLLTREKELRVVANSRTNNIRLVDRAQVPGSPSSPNHRQDWIYALAFGLVFALGAAFG
IDYLDDTVKTPEDITRRLKLRFLGLVPAVRGDRHPLLSGPVPHDFGEAFRTLRTALVSQLPGDGPKVMAVTSAQPLEGKT
TTAVNIAMALAVGGSRVLLIDADMRRPSVHKALRMTNDRGLSQLLAGQARMREVVQRTHDPNLLVITAGRTPANPSELLA
ADRMRALISGLENGPFDWVIIDTPPVLAVTDAVIIAPLVAGVTFVVGSEMTRWRLAERAVETLLSGNPRHLCAVLNKVDF
ARNKYYYSRYYGHQYKSYYAEAPAA
>gnl|bykdb|A0A1I6MMC5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella pectinivorans] (length=307 residues).
MSKIYEALLRAEIERLTTKDEVSQATTVPLPVRERDYAELSAGPGWPDVDVVASSVLNGLPSDPAKIAVKRWKPLLHQLP
ALGERGASVEQFRTLRSRVQEFRDLGVLKTVLVSSGLPGEGKSFVSANLAISLARRKQNRVLLIDGDMRRSSLHKLLGAP
CEPGLTDYLSGNASMFDVMQRAHASDGMPSALSSLTFIAGGGDADNAADLSSNNRFKELIVKASAFFDWIIVDSSPVNVI
ADGVNLAHACDGVLLVARGGVTKFETAQRALSQLKASNVLGIVLNAVSDPPVSGGYYGYDAPGKQTT
>gnl|bykdb|A0A1Q6Y875 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_2_20CM_57_17] (length=239 residues).
MRQRCAKPAWKLHKDSLVLFNEQSFDQCAEQFRILRARLYRLREKKPFRTLLVTSAQAGEGKSFVSLNLARAIVHQHERH
ALLIDADLRAPKLHVSLGAPSSPGLSDYLRGDADEFSIIQSGTGENLFFIPAGRPVSNPTELLGSTRTKSLFERLNTLFD
WVIVDTSPVLPVSDAAVLAPTCDGVILVVGAGRTSSDLARTACQELRESRLLGVVLNGVEDDALGSPYAYYGRSEHVRG
>gnl|bykdb|A0A1Q7CJC1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_2_20CM_2_57_6] (length=232 residues).
MRFSLFHRTDDDAKIGTERFRTLRSRLYQIAAAKQLRKVLVTSSVPNEGKTFVAANLAQSIVHQPDRRVLLIDADLRAPL
LHVTLGAPTSPGLTDYLRGEANEYDVIQHSSEVNLCFIPCGHPVSNPSELLSGDRMKKLLDLVTPVFDWVILDSPPSLAI
HDASILADLCDGVLFVVRAGETNHETAERAASEFRNKNLLGVVLNRVEQAAGYGDYYYGSLGEEEQPVLHAS
>gnl|bykdb|A0A1Q7FS15 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_56_16] (length=283 residues).
MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNECRQVHVGNGNGARLVLHQGEASRAALEAYR
GLRTRLMRAQAKTGLKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDADLRTCGLTSMLDHPSTPGLAEVLAGEV
TPDEAIVATNQKNLFVLPAGTVLSSPPELFTGTHWQEFIARCSELFKVILIDTPPILPLADFELISAACDGVLMVVRAHH
GQRETLQKTARALDPKKLLGLVFNATDVSRKDYYGYGYGSSKS
>gnl|bykdb|A0A1Q7HEZ8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_65_14] (length=226 residues).
MSLKAPASFAAEQYQGLRITIEQLKRLRDVRLIAVTSPSAGDGKTVTALNLAGVLACGSDARVLLIDADLRRPTVAARLG
IGAADPRGLVDAIADTNVWLDQVTRQVDGFNLSVIPAGVTRVPIHEILRSPRLERLLQEARQRYDFIVLDTPPLLPVFDA
ATISKLVDGLIVVVAANQTPRKLLAEALTLLDPATVLGLVFNRDVQPLFGYYNSSYRGYFGEARTA
>gnl|bykdb|A0A1Q7HTA7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_69_4] (length=207 residues).
MTSATSGEGKTTTAINLAAAMAQDAEARVLLVDADLRAPSVAPLLGLGDSLPGLAELALGSRAGLDDTVRWCPPSRLCVL
PAGRTPANPYEVLKSAGIGEVIQAARRRYDAVVVDTPPLLPVPDNRALAKWVDGFLLVVAAHRTPRHLLEEGLRVLEHAR
VAGIVFNGDDRPSSACYGYYYGYGRGRGGGAARGEHPAWRKAAAPWR
>gnl|bykdb|A0A1Q7JFB1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_65_8] (length=220 residues).
MVTERPEQSTIEQYRKLAATLHHAQTERQLKVVMVSSAVSGDGKTLTSTNLALTLSESYRRRVLLIDADLRRPSVHEVFQ
VKNVTGLTDSLKAENDRRLPLIQASAYLSLLLAGRPDSDPMSGLTSGRMRRLIGEAAATFDWVIIDTPPVVLLPDANLLA
AMVDAAILVIGAGKTPHKLIMRAIDALGRNRILGVVLNRVDPSCLAGGYGYGYYSYGERG
>gnl|bykdb|A0A1Q7JW36 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_65_8] (length=226 residues).
MSLKAPASFAAEQYQGLRITIEQLKRLRDVRLIAVTSPSAGDGKTVTALNLAGVLACGSDARVLLIDADLRRPTVAARLG
IGAADPRGLVDAIADTNVWLDQVTRQVDGFNLSVIPAGVTRVPIHEILRSPRLERLLQEARQRYDFIVLDTPPLLPVFDA
ATISKLVDGLIVVVAANQTPRKLLAEALTLLDPATVLGLVFNRDVQPLFGYYNSSYRGYFGEARTA
>gnl|bykdb|A0A1Q7K833 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_65_8] (length=727 residues).
MYSPDTDVHILDRLAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARLLIEDERSTAVPGMSPENFYQDPDLYYKT
QYRILKGRDLTRRVVRRLNLGSVPEFNGTAEPPSTPSTMLRDFQQRVVHLIKPSALAETQEVPKVDETPDESSMVNAFIG
RVNVEPVTGSKLVDVTFDSMDPKFAQLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQKTEESERALADYRERQ
NALSLDERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSLTASQHLDTIPVIAQNPDVGAAKAKVTAAQTDRARTAE
RYGEKHPNMQKVNADVAEAQRQYDLAVNRAASAIKNEYETAQLEEQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNR
DIFQALMTREKELRVSSNSRQNNVRVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGLDYMNDTIKTPEDVARRL
KLPFLGLVPSVRGDKHPVLASSHVPHDFGESFRALRTSLMSKYPGEGTKILVVTSAQPLEGKTTTAANIAMALAYGGSRV
LLVDADMRRPGLHRPLRLTNERGLSQVLIGQARVRDVIQRTVDPNLLAITAGRTPPNPSELLASERMKTLLTNLSHGPFD
WIIIDTPPVLAVTDAVILAPAVSGVTFVIGAEMTRRRLAERAIETILQTRPKYTAVVLNKVDFARNKYYYSRYYGHQYKN
YYAEATV
>gnl|bykdb|A0A1Q7K9P1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_57_6] (length=283 residues).
MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNECRQVHVGNGNGARLVLHQGEASRAALEAYR
GLRTRLMRAQAKTGLKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDADLRTCGLTSMLDHPSTPGLAEVLAGEV
TPDEAIVATNQKNLFVLPAGTVLSSPPELFTGTHWQEFIARCSELFKVILIDTPPILPLADFELISAACDGVLMVVRAHH
GQRETLQKTARALDPKKLLGLVFNATDVSRKDYYGYGYGSSKS
>gnl|bykdb|A0A1Q7KX94 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_58_4] (length=304 residues).
MSRIHEALKKAAEERSAQLAAGLETGVVEVTGELRRPITQGPGIAQPTAAPRVPTGDNQDVPFHYEELIKRCAQVEWRLD
PVSSVFLNSKPGEGGPERFRTLRSRLYKIASTRKLQKVLITSGVAAEGKTFVASNLAQSIVQQPELRVLLIDADLRSSRL
HVLFGAPSCPGLSDYLRGDADEYAVIQKGTKENLFLIPGGSLVSNPSELLLNERMKHLLNLVAPSFDWIIIDSPPTLPVH
DASILADLVDGVLFVIRAGSTDAAIAERTAAEFQGKNLLGVVLNQVERSDSYGDEYQNYYAERD
>gnl|bykdb|A0A1Q7L5B1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_58_4] (length=305 residues).
MSRIHEALKQAAHGREPALFPGEAKPNHSVVAEAGHGNRHEWLNRRVPTSEERAAAVSDFLGLNDLWQRCRKPGWTLDPT
YSAFSNSKSFTSCAEQFSKLRTRLYEFRDNEPLHTLLVTSSLPAEGKSFVSLNLALAMMRQHNRYVLLVDGDLRAPKLAT
CLGVPGAPGLTEFLQGAADASSIIQTDTEGKLFFISAGSAVSNPTELLSTERLECFLRQMAALFDWVIIDAPPVLPVSDA
IVLAGRCDGVIVVVRAGSTGYDVVSTALQELRGKKILGVVLNRAEEKEATYGAYPYYGGNGMDKK
>gnl|bykdb|A0A1Q7LC46 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_58_4] (length=501 residues).
MKKESLYEFAKAGDLDAVPQVQSNAALTDLLKKQRDSSAEYTDALAQYGPNFPKVQRLKTELKDIEDSIEKEKRKVLEVL
ESDYREARQRETLLSEALDQAKVEANQMSEKLVEYNILKREAEANKALYEGLMTKMKETAISAGLRSSNIRIVDPAMVPT
SPARPAKARNIMLAFLVGLIGGIGLALMREYLDNTVKTPDDIESLARLPSLAVVPQFTGLNGSKGRGVLPGLSSNGHERR
IELVAQHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALPREGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRL
LNLGTGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLPPNPADLLSSHRLADAIAELRTKFKFIVIDSPPIMAAT
DAVILSVLADGVLLIVRSGETPKAAFTRTRDLLNSVKSRILGVVLNAVDSSAPDYYYSYRYYPYSYGYGPQEAGEPAQGD
DASESVTEALSRHHDDDSQAL
>gnl|bykdb|A0A1Q7LG57 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_58_4] (length=339 residues).
MRDSNVLVVDRAKPPLLPYRPSFPMNSAIGLFSGLFLGFGFVILRDRLDRRITAPGDAQAYLDLPELGVIPFDQGGLAGQ
IAGRLHSHRPTRTLTSDTAPDSSANWPELATWKRKPSFLAECARTTLTSILLPSQNGDCPGVVVLTSPSSGDGKTTVACN
LAIAMAEIGRKVLLIDGDLRRPRLHKVFGAPNNWGLSDVLWGDTPLETLPISHLVRETEVAGLSLLPGGSCGITPTNLFY
SPRMARFLKRMRKEFEMVMIDAPPMIHLADARVLGRHADGVILVMRAGQTTTESALYASQRFAEDGTRVLGTVLNSWDPK
NSHRYGYGSYADYEEYVGQ
>gnl|bykdb|A0A1Q7MUR4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_3_65_5] (length=226 residues).
MSLKAPASFAAEQYQGLRITIEQLKRLRDVRLIAVTSPSAGDGKTVTALNLAGVLACGSDARVLLIDADLRRPTVAARLG
IGAADPRGLVDAIADTNVWLDQVTRQVDGFNLSVIPAGVTRVPIHEILRSPRLERLLQEARQRYDFIVLDTPPLLPVFDA
ATISKLVDGLIVVVAANQTPRKLLAEALTLLDPATVLGLVFNRDVQPLFGYYNSSYRGYFGEARTA
>gnl|bykdb|A0A1Q7N989 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_3_56_11] (length=283 residues).
MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNECRQVHVGNGNGARLVLHQGEASRAALEAYR
GLRTRLMRAQAKTGLKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDADLRTCGLTSMLDHPSTPGLAEVLAGEV
TPDEAIVATNQKNLFVLPAGTVLSSPPELFTGTHWQEFIARCSELFKVILIDTPPILPLADFELISAACDGVLMVVRAHH
GQRETLQKTARALDPKKLLGLVFNATDVSRKDYYGYGYGSSKS
>gnl|bykdb|A0A1Q7NGT0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_3_55_6] (length=356 residues).
MGRIYDALKRAESAPRTPKPSVNRPGNPDNIAYFVPKHVHPWERQSFTGMPQGYDSASTAHTEEATGGPALPGGPASRDA
GATLGAVGSARAAEFSSREVLAARVEPHLLAITEPRSAECEQYRSLRTRLLQAGERQRMRAFVITSAGVGEGKTLTALNL
AWLLAQTDGVRALVIDADLRQPCAADYLGIETDCGLSEVLTGETKLLEAIVKLQPSGLHLLPGGAAREDVAELLSGPRFG
HLLDDARKMFDYIIIDAPPLGVFTDANLLINRADAALLVLRAAKTRYSVVDRLLEQLPRERMLGVVLNRAEIEPDETAYY
YQPRHQRMMAAPVEGTEYDQGGANPEMIYLEEEMVS
>gnl|bykdb|A0A1Q7QYI4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_64_6] (length=283 residues).
MSRLEAALRRAQALNDQSDAPEADPKAERMSRALAALADTPPPVSTASSPTNVRTAGFYAEKLVVTERPEQSTIEQYRKL
AATLHHAQTERQLKVVMVSSAVSGDGKTLTSTNLALTLSESYRRRVLLIDADLRRPSVHEVFQVKNVTGLTDSLKAENDR
RLPLIQASAYLSLLLAGRPDSDPMSGLTSGRMRRLIGEAAATFDWVIIDTPPVVLLPDANLLAAMVDAAILVIGAGKTPH
KLIMRAIDALGRNRILGVVLNRVDPSCLAGGYGYGYYSYGERG
>gnl|bykdb|A0A1Q7RB73 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_60_7] (length=237 residues).
MERCSQSLWNPARNMMLFFDRRNPVVGVEEFRTLRSHLTLIRERQPLQSLLVTSPLPSEGKTVVAANLAQVLVQQREQRV
LLVDSDLRYSRMHLSLGASRSPGLSDYLSGAKDELAILQRGPLENLFFIAGGKAASNPTELIGNGRLRLLLRRLCPAFDW
IIMDSPPVIPVSDAKLLAEYLDGVLIVVQSDATPHDLARKACQEFASKKIVGVVLNRVKPEYSYGSQYYATTPETKK
>gnl|bykdb|A0A1Q7RGF1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_60_7] (length=293 residues).
MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSSFKNSAPGMGASGDLGESRLGQCRKMKIPAVGKLLGQFGSGPALEA
AEESYRALRTRLLRARSAQGLRSVVVTSATPGEGKTLTSLNLSLCCAQLHDLRVLLIDADIRTSGLSRTLGFPPGPGLVD
VLSGKCEPRNAILATDIPNLYTLGSGSHTTQPAELFASSHWQEFISWCSESFKLVLIDSPPVLNLTDVDLIAAACDGVVM
VVRAQHAKREVLQKCAGQIDPKKLLGVVYNAVESGAHDHYSYGGYTAARKEST
>gnl|bykdb|A0A1Q7RML7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_68_5] (length=274 residues).
MSAFSGGDRDHTSDRSERACPAPSAGGLRGLDRHLVSLVAPASFEAEHYRMLRARLESRQEGKALQVIAVTSATIGDGKT
TTAINLAGALAQAREARVLLVDADLRRPSVALQLGLDDPRGAGLADAILDPERSLESVILRRLPLNLGVLTAGRLPPAPY
EALKSPRLGALFEQARRLFDYIVVDTPPLVPVPDCRLLARWVDGLLMVVAAHRTPRKLVEEGLNLVDPAKAIGVVFNGER
RSRSGYYGYYHAYGRPPGRARRSGARSPAHDTLR
>gnl|bykdb|A0A1Q7V300 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_4_56_7] (length=301 residues).
MSRIHEALKKAEQERATSESIPQMVADQVVLEAIASSENVVPARSAISASAAVAATTSDILVARSRRTEWRPNPKTMLFF
SGEEHLYGMEEFRTLRSRLYQAREKHPLSKVLVTSPLPKEGKSFVTANLGQVLVRQQGKRVLLIDADLRNPHLHSTLGAE
SGPGLSEFLKGEMDEFTIIQSGPMENLFLIPAGTRNENPAELVASGRMSTLLHRLEPLFDWIIVDSPPAVAVSDAALLAK
YCDGVIMVVRSNATPFDIAQRARQEFGDNLVGVVLNGIDTLPEYSQYYYTAYGNPNGKDPA
>gnl|bykdb|A0A1Q7Y646 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_3_53_8] (length=347 residues).
MGRVYDALKRASATQGGVTKRSNEQKRRNGNSNAARQNGNGNHAFEDSPLFAPLGAAHNSASTAHTEEGVGSALSDVIAS
RAAGATLDAAGSARAIEFVSRQISTARVEPHLVAITQPRSPYCEQFRSLRTRLLQASERRKMQAFVVTSAGVGEGKTLTA
LNLAWLLAQTDGVRALLIDSDLRQPCATEYLGIDEPTGLSEVLAGTATLEESIIRLEPAGLYLLPGGEPRDDVAELLSGP
KFDKVLAEARRMFDYIIIDAPPMGIFTDANLLINSADGAMLVVRAGKTRYATVERLLEQLPRERMLGVVLNRSEETMEDS
SAYYYRRYYRRDDAVEDKTEKEVDEKA
>gnl|bykdb|A0A1Q7ZIQ5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_68_7] (length=274 residues).
MSAFSGGDRDHTSDRSERACPAPSAGGLRGLDRHLVSLVAPASFEAEHYRMLRARLESRQEGKALQVIAVTSATIGDGKT
TTAINLAGALAQAREARVLLVDADLRRPSVALQLGLDDPRGAGLADAILDPERSLESVILRRLPLNLGVLTAGRLPPAPY
EALKSPRLGALFEQARRLFDYIVVDTPPLVPVPDCRLLARWVDGLLMVVAAHRTPRKLVEEGLNLVDPAKAIGVVFNGER
RSRSGYYGYYHAYGRPPGRARRSGARSPAHDTLR
>gnl|bykdb|A0A1Q8AMY4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_65_9] (length=727 residues).
MYSPDTDVHILDRLAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARLLIEDERSTAVPGMSPENFYQDPDLYYKT
QYRILKGRDLTRRVVRRLNLGSVPEFNGTAEPPSTPSTMLRDFQQRVVHLIKPSALAETQEVPKVDETPDESSMVNAFIG
RVNVEPVTGSKLVDVTFDSMDPKFAQLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQKTEESERALADYRERQ
NALSLDERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSLTASQHLDTIPVIAQNPDVGAAKAKVTAAQTDRARTAE
RYGEKHPNMQKVNADVAEAQRQYDLAVNRAASAIKNEYETAQLEEQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNR
DIFQALMTREKELRVSSNSRQNNVRVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGLDYMNDTIKTPEDVARRL
KLPFLGLVPSVRGDKHPVLASSHVPHDFGESFRALRTSLMSKYPGEGTKILVVTSAQPLEGKTTTAANIAMALAYGGSRV
LLVDADMRRPGLHRPLRLTNERGLSQVLIGQARVRDVIQRTVDPNLLAITAGRTPPNPSELLASERMKTLLTNLSHGPFD
WIIIDTPPVLAVTDAVILAPAVSGVTFVIGAEMTRRRLAERAIETILQTRPKYTAVVLNKVDFARNKYYYSRYYGHQYKN
YYAEATV
>gnl|bykdb|A0A1Q8AX10 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_60_10] (length=305 residues).
MSRIHEALKRAEQERAPIQSANEAKPSDSLLAEGAHRDGGEWSALGMVSPVGPGIESPNSHHLRLDELRRRCATPGWKLN
PDYAVFCKQSLAVCAEQFRTLRSRLYRLRDKQPVRTLLVTSAVPGEGKTFVSLNLALAIARQHERRALLIDGDLRASRLH
VRMGAPSAPGLTEYLRGEADEFSIIQADSKDDLFFIPAGRSVLNPAELLADNRMKVLIDRMAPVFDWVIVDAPPVHPVGD
AGVLAGLCDGVIVVVRAKLTAYDLVQTTLQEFRGKNLLGVVLNGADEEATYGAYSYYAGYGMDRK
>gnl|bykdb|A0A1Q8BDC5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_55_15] (length=496 residues).
MLANPVLSEIRELHQKKQSGILVLTGGAGERVEVFFREGMIDAASSNMDARRLGDYLAKQEYLHARDLDAAHSEAQRHQI
LIGEAVVRKRLLGQAEVIVAVRQQATEVLEHVFKNNFAVDSFRNSLKSYYAPARIAYPQVLLEVCRSKNEPFECKEGTRI
VLSNGTDLSVFPWYPEELSLLSEIKVPSTVQELAKTTGMKETNIRKVLGVFQTLGIIETFADAEAPIPGALTRRDALVRT
SEFPLEELVPVVSNATLAEKLQIARSEMSFTSEQFKNLKVQLRDAASKASLKVLTVSSPDPRDGKSLISSALAFSFSMDP
GRRVIIVDCDLRNPSLDGYLGVTPEPGLLQYLASTNMSPYCYVRRIESLYFLTVGGVATNSIEILSLRKMKELIESLRKD
FDTIILDAPPFAPIADARIVTGLSDGLIMVLRRGKTSYADTDRAFQAIDRNKLLGVVFNDVQRLFKTYSHYGQYYYGPPA
DAKKVKGPKSKNYLQS
>gnl|bykdb|A0A2G6HNT3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=294 residues).
MEKFSKIMEKAGVETSYKLHNKEKESFRPKKRVQPKPVASVAREKKRPRPVHHPELKESIEEDWEKRLYNANYSVDSLTE
IFKTLRARILLSKEKNTSAGTIMVTSAMPGEGKSFVAANLSLAFASGLDQYVLLVDGDLRRPSIQTLFGRKENFGLVDYL
QQQGSLPELIVRSRKPKLSLLLAGDTPPNPSELLSSVLMKDLIKELSSRYTDRTIIFDAPPVLLTAEARILAHHVDGVVM
VVRQGVVGKAKVEETINAIGPERILGIVFNDHHGAYFSKSSKYGYGYGYGSKYE
>gnl|bykdb|A0A2G6HQA4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=319 residues).
MDKFSKIMEKAGVDTSYNLHSKKRKNSLPGKKRRSVTSFNPPPVHDREPEKREDSLPGKKRRPEPSFSTRRNSSPVHQRK
PEKTIEEDWEERFYSANHSVDSLTEIFKTLRARILLTKKRNTSAGTIMVTSAMPGEGKSFVAANLSLAFASGLDQYVLLV
DGDLRRPSIKKLFGRDEDFGLVNYLEHQTALPKLIVRSRKPKLSLLLAGKPPSNPSELLGSILMKDLIAELSSRYTDRTI
IFDAPPVLLTAEARTLAHHVDGVVMVVRQGIVGKAKIEETINAIGPERILGIVFNDHHGAYFSKSSKYGYGYGYNYRYE
>gnl|bykdb|A0A2U3LF12 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Candidatus Sulfopaludibacter sp. SbA4] (length=248 residues).
MRPETPKLKDDGITPEERRHFQEHRLTVLSDPQSIASQQYGILTLKIQRWREQTGGRVLVVTSAAGGEGKSLTALNLSMA
LASSVEGRVLLVDCDLRRPQVHERLGLKDPSGFSDLLALTDREVSPFVSKAGNLHVMPGGTQLSDPVELLSSRRTREILA
RLRQEYQLIVLDSPPIVPIADSHFLAGLADGVILVIRARQTRRELLQRAVESLGATNIVGVVLNDVEYGDTRYAYAYRYY
QRHYVGRR
>gnl|bykdb|A0A2V2R8T6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=263 residues).
AGAARAGGFVSFEISPARVEPHLVAIRQPQSAYAEQFRSLRTRILQAGERLQMRAFVITSAGIGEGKTLTALNLAWLLAQ
AEGVRALIIDSDLRHPCAADYLGIDAPVGLAEVLGGQARFEDAIVRLDPAGLYLLPGGGVRNDVAELLGGPTYARLLTDA
RRMFDYVIIDAPPLGVFTDASVLISRADGALLVVSAGKTRYSVVDKLLDQLPRDRVLGVVLNRTDEALEPSTYYQYRYYN
QRSLPPGDPNELVNQQQEVVTVN
>gnl|bykdb|A0A2V2RJF9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=265 residues).
DSDSDNGSSRQKHLAKQENPPASPTEAIDLLTHYNPTSVASEAFKTVRTSLLLSFPETPPHTILITSSRPGEGKTFVACN
LAISLAQLDKRVVLIDGDMRNPRVHRVWGIRNDTGLSRFLTSDVKAGEVIRPSKVKGLSLITSGSKTPRPAELLSSHRLT
QLLEQLKAEFDHVIVDSPPLMPVTDAVILAAKSNCVVMVVHGGVTPRDVVQMAKQKLVKSDATMAGVVLNYIDLTDPYYY
YSYYSRYYAYRYGEQPKALPPKFIQ
>gnl|bykdb|A0A2V7TQY5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=297 residues).
MRARRGRGPPGARRRHRRIEAPGRRQLPAGRRAGGRWVVTAPRIDQHLISLLQPRSFEAEQYRVLRHVIEEGKDGGLNVI
AVSSATVGDGKTTTSINLAGTLAQNTTARVLLIDVDLRRGSVAAGLRLRAPEANGLVDAILTPGLDLSAVVRELPEFRLS
VVPSGRCPAAPYEMLKSPRLGQLIGQARDRYEYVVIDTPPLVPVPDARVVEKWVDGFVIVVRAHRTPQRLLEDALNMVSP
EKLIGLVFNGDQRPTSRHYGYYSSYYHEPTNGQGTLWTRIADTAKRPFRSRVSGTAV
>gnl|bykdb|A0A2V7TTM7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=302 residues).
MYRVGNPLLKSRSLVPASEDDDVTREAPAGRPRPSVGPSPENSKIAAAALRVDERLVSLRSPNSFEADQYRVLRHFLEAA
GAGNSAQVLAVSSAAAGEGKTTTAINLAATLAQSPDMRVLLMDTDLRRPSVASNLALGSSAGTGLAGAVLDPRVELATVV
RPTPFGFSILPAGTSPSNAYQILESPRIGQLLQEARRSYDRVVLDTPPLLLVPDCRLLSQWVDAFVIVVAARRTPRKLLA
ETLGSVDAGKLAGIVFNGDDRPLGGYYKGYYMGYDGDRAGAGSKGRWSSWWRRRRSGRKPWR
>gnl|bykdb|A0A2V7TU87 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MSRHRMATLDERLVSLVAPHSYEAEQYRGLRHLVEQAHRTSALSVLAVSSATVGDGKTTTAINLAGALAQAADARVLLMD
VDLRRPAIAERLGLEEGRHGLVDAILSHDLKLADVARPCGPLNLAVVTAGVFSDIPYELLRSSRLGDLLDQARRDYDYVV
LDTPPLVPIPDARVISKWVDSFLLVVRANTTPRSLLEESLNLMEPQKVLGLVFNNDERPRTTYNDYYAGSGRHDKGGAPT
WWRPFAKIRSVFDPDAAGRRRPERRREIR
>gnl|bykdb|A0A2V7U4P9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=275 residues).
MSIKPPEEMLSSAVPAGEKGGPVSETPRRGPGGGSAVRSTPADHLVSLVAPTSFEAEQYRILRHAIERRHTDGVATTTAV
TSPSGGEGKTTTAINLAGALAQAADQRVLLVDADLRRPGVAAQLRIASTAPGLAEAVADGARPLDELCQQVAGFNLWVLP
AGHAVMAPYEILRSPRVAELLAEAHSLYDYVIIDTPPVIPCPDYRLLEPFIDGVMLVVAADKTAREMMDTALDLLDKPKT
LGVIFNGETPQADRSSYYYSAARPEPSRWSWFKRK
>gnl|bykdb|A0A2V7U8G5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=285 residues).
MPMARSRGPRPVSLDFELHRLSTPPTSGEVVPALEVEDHLACLLSPQSFEADQYRVLRQFLTEARGARPLRILAVTSPAA
GDGKTTTSINLAATLAQTPGSRVLLVDTDLRRPFVATNLGLSPDRPGLAEAAIDEGLQLSDVVQSTPYNLAVLPAGAPPA
NPYQALESPRIGQLLEQARDAYEYVVLDTPPVLLVPDCKLMSQWIDGFLLVVAAHRTPRKLLGEALSALDESKMLGIVFN
GDDRPMGGYYGKYYGGYYHDRSRRETGGGRSSRQRDQKPRRSSWR
>gnl|bykdb|A0A2V7UMX0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=339 residues).
MLRSTVGEWRCGLLSQVKGFRLPEAKPGAQPGKSARTKAGLPDQEVHGPQALGSREPAGRERSTDPAVPQARVAEIPWKK
IDGRLVSLTAPTSPEAHQYRVLGHQLERLRREGGLRLVAVTSPFAGDGKTTTSINVAATLAQAPGSRTLLVDCDLRLPAV
AKYLRVEGVDAPGLSEAVQARLGLDAVMQRCPPRVDLWLLTAGRPPEDPYDVIRSPHFADLLEEARRRFDFVVIDTPPIL
PVPDGREIARWVDGFLVVVAAHRTPRPLLAEALGVLEPDKVVGLVLNGDDSFSSEYYRYYRGYGTAARQSSDLTPGEAAD
GASRAPDSPPSSHPSTIQE
>gnl|bykdb|A0A2V7UNP9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MRTNSRPVSMSQYLELERRSPGDARGEPLIADSAESRPGRDSREAAPVPEVEEHLASLLSPYSFEADQYRLLRQSVEQLA
AKERKVIAITSPAAGDGKTTTAINLAATLAQSSRSRVLLVDTDLRRPFVAANLGLDMDAPGLADAVRDEQIDLAAVVQAT
PYTLAVVPAGAAPADAYRVLESARVGQLLDTARGSYDCVILDMPPVLLVPDCRLMSQWIDGFLLVVAAHRTPRKLLGEAL
SAMDEAKVLGIVFNGDDRPLSGYYGGDYRSYYHHPSAPRRGGWWRSWRGQAKTKRGQKARPQPWR
>gnl|bykdb|A0A2V7VK33 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MLSISPTRDPEAPPSAPTRGRGSNEPPRTAPLLEERLVSLGQPWSLEADQYRMLRCEIEYLRRSRSLSIIAVTSPDVGDG
KTTTSVNLAGTLSQDPGTRVLLVDADLRRPSAAPLLGFGDRGDGPGLAGAILDSHRSLASVVRARPPFNLSVLPAGRFHD
LPFELLRSPRLADLLAEARQQYDYVVVDTPPLLLLPDCRAVAQQVDGFLLVGAVAAALDALEEEKTIGIVFNNENRPPSS
YYKRYYGAPPGPRATRNRVTAGRGWRFWR
>gnl|bykdb|A0A2V7VLD7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=296 residues).
MRTNSRPVSMSQYLELERRSPGDARGEPLIADSAESRPGRDSREAAPVPEVEEHLASLLSPYSFEADQYRLLRQSVEQLA
AKERKVIAITSPAAGDGKTTTAINLAATLAQSSRSRVLLVDTDLRRPFVAANLGLDMDAPGLADAVRDEQIDLAAVVQAT
PYNLAVVPAGAAPADAYRVLESARVGQLLDTARGSYDCVILDMPPVLLVPDCRLMSQWIDGFLLVVAAHRTPRKLLGEAL
SAMDEAKVLGIVFNGDDRPLSGYYGGDYRSYYHWWRSWRGQAKTKRGQKARPQPWR
>gnl|bykdb|A0A2V7X0V9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=307 residues).
MSRIHEALKKAEEERAASQGGAQLEPTPVGAESPVMPDMASHRVPDPVAVAAMMPAFGSPFSVDTMLARCPQMEWKPDLG
TMLFMNGDDSKRGTEEFRTLRSRLYHMREKMTLKKLLVTSALPKEGKSFTSSNLAQVLVRQHGRRVLLIDADLRGPRLHL
MLGTTAGPGLSEYLQGKNDEFSIMQRGPLENLFFIPSGTGIEDPAELVGNGKLKTFLQRVEPLFDWIIVDSPPAIPVSDA
SVLAKACDGVLMVVRSNATPCDVARKAREEFPDQSLIGVVLNGTSDDAASYARYYYEAYEKRQPTTV
>gnl|bykdb|A0A2V7XGA3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MTTPTTLGDPASLSAVRTSEPSPRAQAETARTARAAILTEVDDHLVAVHSPQSFEADQYRILRHFLDQDSGGAKRQVLAV
TSPTAGDGKTTTAVNLAVTLAQSPGARVVLIDADLRRPFVATSLGLDDRRGPGLAATALDPKLELEQLVRPTPFNVDVVP
AGPSTPSAYRLFDSARVGQLLDQARRRYDHVLVDTPPVLLVPDCRLMSQWVDGFIVVVAAHRTPRKLLVDGLGALEEGKV
LGVVFNADDRPLSGYFGRYEGYYGYHQPH
>gnl|bykdb|A0A2V7YAG6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=304 residues).
MAWLPPWRQAGPDMSMPTTLDPAPMGAARAPEDSRRSNGGTGTTVGGAVSRDLDEHLVSLLNPQSFEADQYRILRHFVDQ
AKGAVPRQVLAVTSPTAGDGKTTTAVNLAATLSQLPGARVLLMDTDLRRPFVAAGLGLEDGSAPGLATMALDPDLELDQM
VRRTPYNFDIVPAGPAAPNAYRVFDSPRVGELLEQARRTYDYVVLDTPPVLLVPDCRLMSQWVDGFLIVVAAHRTPRKLL
AESLGAIHQDKVLGIVFNADDRPLSGYFTRYQGYYGYGQPANGGRSWWRFPWRRAAQGRFRPWR
>gnl|bykdb|A0A2V7YV88 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=304 residues).
DYLDQSIKSDEELTERLGLMTLAHIGFAPAGKGKRAELVALDGQSPASEAYKALRTNLLFSTIDHELKTIVLTSAAPGEG
KSRTASNLAIALAHAGQRTLLIDADFRRPSLHRIFGRIRNVGLSNLTVQDADEREAITAVEEVPNLWLMTSGPIPPNPSE
LLGSGRMKELIAQMLSHFTHVIFDTPPINAVTDAVILAASADGTIVVVEQGRTTFPTLRHAKQMLDRVGGHTLGVVMNKV
RASGGSSYSYAYGYGNYGSKSNQGTTTVRSADPSAFQPRITHRERLARIALRLFWRLRSDLDRS
>gnl|bykdb|A0A2V7YWD4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=253 residues).
MDVVRTKSMTATLVTDSEAATDREDLDPRLVSFLKPESFEADQYRMLRYAMERACPSDGSRVIAITSPISGDGKTLTAVN
LAGTIARGGQSRVLMVDADLRRPSLAKVLGHSNVHRGWGLVDAILDRRLSLEQIAWPLQPFNLSVVTSRRPQADTYELLA
SGRFGELLRDARQRYDCVVVDTPPVLPAPDSRLLAEWIDGYVIVVAADKTPRKLLEETFALLGPAKILGLVFNRESYKGS
RYGRYYYAYSSRS
>gnl|bykdb|A0A2V7ZTY7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MSRLEAALWRAETLNDEPAAPPTVSGGQGSRDCATGGQRPPDRTSAGQRPPDSAKAKRVEQALAAITAPAPDAAPARVTP
DGVVAERLVTTDGLDFSTVEQYRKLAATLHHAQVERDLKVVMVSSAVSGDGKTLTSTNLALTLSESYHRRVLLIDADLRR
PSVHRVFQLKNAGGLSECLTAEIERRLPLVQATPYLSLMLAGRPDSDPMSGLTSNRMRRLVGEAAATFDWVIIDTPPIVL
MPDANLLAAMADAAILVIGAGKTPYKLITRAVDTLGRAKIIGVVLNRVDRRHVAGGYTYGYYGER
>gnl|bykdb|A0A2V7ZVL9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MSRLEAALWRAETLNDEPAAPPTVSGGQGSRDCATGGKRPPDRTSAGQRPPDSAKAKRVEQALAAIMAPAPDAAPARVTP
DGVVAERLVTTDRLDFSTVEQYRKLAATLHHAQVERDLKVVMVSSAVSGDGKTLTSTNLALTLSESYHRRVLLIDADLRR
PSVHRVFQLKNAGGLSECLTAETERRLPLVQATPYLSLMLAGRPDSDPMSGLTSNRMRRLVGEAAATFDWVIIDTPPVVL
MPDANLLAAMADAAILVIGAGKTPYKLITRAVDTLGRGKIIGVVLNRVDRRNVAGGYTYGYYGER
>gnl|bykdb|A0A2V8B278 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=754 residues).
MAEPKAPHPLRPATTADHPAAAAPTSTYTPDTDVHILDRLAVLYRYRRVAIAVFILTTVAMMIQGYSSTQMYRAQARLLI
EDERATAVPGITTAENTYYEDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTAEKPSTPATLLHDLKQKIVGLVR
PAPAPENTESPKVDETADESALVSAFLSRVDVAPVSGSKLVDVTFDSMDRRFAATAANTLVDEFVDQNLQVKLQSTENMI
DWLDKELDKQQQKVQDSERGLAEYRERQNALSLDDKQNIVLARLNKLNDDVMMARSRRIQKETLFNQIKSVSTQAPDTIP
AIAQNASVAAAKSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQYDFEVARARASIKNDYESALIEEQTMARGLE
NAKADMQDLSKKSVDYNVMQRDSQTNRQIYDALLTRERELRVASNSRANNVRVVDRAEVPKAPLAPTGRRTWLLSLAVGL
TLAIAVAYGLDYMNDTIKTPEEVTRRLRLPFLGLVPSVRGDKHPLLASSHVPHDFGESFRALRTALVSKYPSAGTKIVVV
TSAQPLEGKTTTAANIAMALAYGGSRVLLVDADMRRPGLHRPLRLTNERGLSQVLIGQARVRDVIQRTVDPNLLAITAGR
TPPNPSELLSSERMKTLLTNLAHGPFDWIIVDTPPVLAVTDAVILAPLVSGVTFVVGAEMTRRRLAERAIETVMQTHPKY
AAVVLNKVDFARNKYYYHRYYGHQYKNYYAEAAI
>gnl|bykdb|A0A2V8BDI4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=552 residues).
MDLPRMSGRSDATSSWRSAATSIWGRKPRPRHRRCARRRPRPSWRSPRERQWRSTRRPDRAIVARSRGRCSAASTARDGS
CFSEDTSMSRLEDALRRAELANRQAKMKTEAEAAVKTPAVAAWSEPESAAALPAVAAWSEPETVTAPFAVAGWSEPESAA
APPVVAAWSEPETVTAPLAVAAWSEPESAAAPPVVAGWSEPETVTAPFAVAGWSEPESATAPPAVAAWSEAVTAPFAVVA
SSEKETVTAPFVVAAPSGPENVQPPLPPLPTWDFDGSVAAAELVEAPDEPKVVTPSDWKTYRFGAVASRKTIVDPDVESS
LVEQYRRLAASLHHAQLQRNVRTVMITSAVAAEGKTLTATNLALTLSHSYKRRVLLIDADLRRPTVHEAFRIANDTGLVD
VLRKTETRRLPLCRASETLWILTAGMPTSDPMSALASEEMKLLLGEAIEHFDWVIVDSPPVALLSDANLVAAMVDATILV
IGAATTPYPLVRRAVESVGASRIIGTVLNRIERGQMVGGYGFYDYYGYGTRDDGARKAGKADAAREAAMDAA
>gnl|bykdb|A0A2V8BM40 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=749 residues).
MPDHRQRTSSGTGSNPPAPAPLAYAADNDVHILDRLAVIYRYRYIATAVFVLATSAIMIQSYTSLELFRAQARLLIEDER
STAVPGVSADNSYYEDPDLYYKTQYRILKGRDLTRRVVRKLNMAAIPEFNGTAEPPVTPLTIAHDLEKRIVAFVRPAASE
ATDTRKIDEAPSESGLVNAFIGQVTVEPVPGSKLVDVLFDSRDPKFAQAAANALVDEYVEQNLQVKLQSTQNMIEWLDKE
LEKQQQKVGESERGLADYRERQNAMSLDEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRSIGAGEPVDTIQVIATS
PEVSAAKGKVFAIQSEKARIAERYGDKHPTMQKAMADLTEAQRQYDTAVTRAAQAIKNDYETAVLEEQTFSRGLDSAKSA
AQDLSRKSVDYNVMERDAKTNREIYSTLLTRERELRVSSNSRQNNVRVIDHAEAPGGAMSPSGRRTWLLALGIGLALGIG
LAYGLDYMNDTIKTPEDIARRLRLPFLGLVPSVRGDAHPVLASSNVPHNFGESFRALRTSLTSKYPTDGTKIIAVTSAQP
LEGKTTTAANMALALAYGGSRVLLIDADMRRPGLHRPLRLTNERGLCQVLMGQARVRDVIQRTVDPNLLAITAGSTPPNP
SELLASERMKTLLTNLSHGPFDWILIDTPPVLAVTDAVVLAPMMSGVTFVIGAEMTRRRLAERAVETVMQARPKYAAVVL
NKVDFARNKYYYSRYYGHQYKNYYAEAVS
>gnl|bykdb|A0A2V8BV42 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=753 residues).
MADLPPNARADSSPGVFAPPPAGAPYAPDGDIHLLDRFAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQLLIED
ERSTAVPGLNSSENTYYEDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTAVPPPTPVSMINDFQTRLMGLLRKP
AAPAPQEAPKVDETPDESALVSSFIGRVTVEPIRTSRLVDVTFMSADPNFAALAVNTLVDEYTEQNLAIKLESSQNMLNW
LAKELDKQQQKVRESEQALAEYRDKQNAMSLDDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSMSGTTAPDAIPV
IAQNTQVQALKTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQVDVETSRALQSVKNDFETAVLEERVLAQNLDA
AKGDAQDLSRKSVGYNVMERESKSNRLVYESLLQREKELRVSSNSRQNNVRIVDKAEVPQSPMTAGGRRTWMMSSLVGLV
LAIGVAFGLDYMNDTIKTPEDVTRRLKLPFLGLVPSVRGDKHPLLTSAHVPHDFGEAFRALRTSLISKYPATGTKTLLVT
SAQPLEGKTTTAANIAMALAYGGSRVLLIDGDMRRPGLHRPLRLTNDRGLSQVLIGQARVRDVIQRTVDPNLLAITAGKM
PPNPSELLASERMRTLLTNLAHGPFDWIIIDTPPVLAVTDAVILAPMVSGVTFVVGAEMTRRRLAERALETIMSSRPRYA
AIILNRVDFARNKYYYSRYYGHQYKNYYAEATG
>gnl|bykdb|A0A2V8CEF9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=754 residues).
MAELKAPHSLRPATTADHPAAAAPTSTYTPDTDVHILDRLAVLYRYRRVAIAVFILTTVAMMIQGYSSIQMYRAQARLLI
EDERATAVPGITTAENTYYEDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTAQKPSTPATLLHDLKQKIVGLVR
PAPAPENTESPKVDETADESALVSAFLSRVDVAPVSGSKLVDVTFDSMDPRFAATAANTLVDEFVEQNLQVKLQSTENMI
DWLDKELDKQQHKVQDSERALAEYRERQNALSLDDKQNLVLARLNKLNDDVMMARSRRIQKETLFNQIKSASTQAPDTIP
AIAQNASVAAAKSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQYDFEVARARASIKNDYESALIEEQTMARGLE
NAKADMQDLSKKSVDYNVMQRDSQTNRQIYDALLTRERELRVASNSRANNVRVVDRAEVPKAPLAPTGRRTWLLSLAVGL
TLAIAVAYGLDYMNDTIKTPEEVTRRLRLPFLGLVPSVRGDKHPLLASSHVPHDFGESFRALRTALISKYPSAGTKIVVV
TSAQPLEGKTTTAANIAMALAYGGSRVLLVDADMRRPGLHRPLRLTNERGLSQVLIGQARVRDVIQRTVDPNLLAITAGR
TPPNPSELLSSERMKTLLTNLAHGPFDWIIVDTPPVLAVTDAVILAPLVSGVTFVVGAEMTRRRLAERAIETVMQTHPKY
AAVVLNKVDFARNKYYYHRYYGHQYKNYYAEAAV
>gnl|bykdb|A0A2V8CN98 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=477 residues).
MSEFLTRRVQEDQLRRDQDALAQLLAQGPDSLGFSERLAAIGAVQGSADLTRALSELTTKRADRRALLYRYTDDHPAVRR
VTTDIDELEHQTIPGLIRGLLAELGTQRRGLASQLETGGRELQGIPQRAIEDARLRRDVSIAENLFTSVQQRYSEARLAE
ASSIADVRVLDAAVAPETPVKNTAVRLLIMGLFAGLGFGVVGAVVIDRFDPRVRYPAQVTTDMGLRILGALPHVKKRAGA
SDDESGALVIETMRGVRLSLIHAYGTAGPLVVTITSPGPGDGKSFVSANLALACAQAGQRTLLIDGDTRRGALHRVLGAV
RRPGLTDFLAGHVSFEGLIQTLKFGSLQFIGGGSRIRESPELLGSPRMVELLVRLRAMYPVIIVDSPPLGAGVDPYTLGT
MTGAMMLVLRTGATNLDLARTKVAMLENLPIRVVGAVLNDVRLGQMYGEYYGYMAGYGTTTEDGGTRIARRRLQGAL
>gnl|bykdb|A0A2V8CRT6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=685 residues).
LELFRAQARLLIEDERSTAVPGVSADNSYYEDPDLYYKTQYRILKGRDLTRRVVRKLNVAAIPEFNGTAEPPVTPLTIAH
DLEKRIVAFVRPAASEATDTRKIDEAPSESGLVDAFIGQVTVEPVPGSKLVDVLFDSRDPKFAQAAANALVDEYVEQNLQ
VKLQSTQNMIEWLDKELEKQQQKVGESERGLADYRERQNAMSLDEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRS
IGAGEPVDTIQVIATSPEVAAAKGKVFAIQSEKARIAERYGDKHPTMQKAIADLTEAQRQYDTAVTRAAQAIKNDYETAV
LEEQTFSRGLDSAKSAAQDLSRKSVDYNVMERDAKTNREIYSTLLTRERELRVSSNSRQNNVRVIDHAEAPGGAMSPSGR
RTWLLALGIGLALGIGLAYGLDYMNDTIKTPEDIARRLRLPFLGLVPSVRGDAHPVLASSNVPHNFGESFRALRTSLTSK
YPTDGTKIIAVTSAQPLEGKTTTAANMALALAYGGSRVLLIDADMRRPGLHRPLRLTNERGLCQVLMGQARVRDVIQRTV
DPNLLAITAGSTPPNPSELLASERMKTLLTNLSHGPFDWILIDTPPVLAVTDAVVLAPMMSGVTFVIGAEMTRRRLAERA
VETVMQARPKYAAVVLNKVDFARNKYYYSRYYGHQYKNYYAEATS
>gnl|bykdb|A0A2V8CU57 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=524 residues).
MSRLEDALRRAELANRQAKMKTEAEAAVKTPAVAAWSEPEAVTAPFAAAGSEPESAAAPPVVAAWSEPETVTAPLAAAAW
SEPETVTAPFAVAGWSEPESAAAPPVVAAWSEPETVTAPFAVAGWSEPESAAAPPVVAAWSEPETVTAPLAVAAWSEPES
AAAPPVVAGWSEPETVTAPFAVAGWSEPESATAPPAVAAWSEAVTAPFAVVASSEPETVTAPFVVVAPSGPENVQPPLPP
LPTWDFDGSVAAAELVEAPDEPKVVTPSDWKTYRFGAVASRKTIVDPDVESSLVEQYRRLAASLHHAQLQRNVRTVMITS
AVAAEGKTLTATNLALTLSHSYKRRVLLIDADLRRPTVHEAFRIANDTGLVDVLRKTETRRLPLCRASETLWILTAGMPT
SDPMSALASEEMKLLLGEAIEHFDWVIVDSPPVALLSDANLVAAMVDATILVIGAATTPYPLVRRAVESVGASRIIGTVL
NRIERGQMVGGYGFYDYYGYGTRDDGARKAGKADAAREAAMDAA
>gnl|bykdb|A0A2V8D468 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=293 residues).
IPFSPNKTLTLELTFVVGLMFAVGLALFVEYLDDRIKTPDEIWMHLGLKTLGLVPRVTPELVGTHSLINNGAPPNLAEAF
RALRTSVMFSSAGGRAPTILVTSTGPGEGKTMTSCNLAVSIAQTRQRVLLIDADMRRPRVHEVFDVEQEPGLSNLMVGTA
QSREAMHPSGVKDLWILPAGHIPPNSAELLTSQQFKDLLSALGGHFDWIVLDSPPVSAVTDAVQLSHDVSGVLFVVGAGK
TGRRIAQWALDQLGLAQATMFGAILNGINVDRHPYYYSGYYRKEYTNQYTRTL
>gnl|bykdb|A0A2V8D8B1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=470 residues).
MPCPLKSARTSSCRSWPISTGPGQSDRTALDTVPAILANQFVQQQKSELAELQRQQAQLSDKLGDKHPDMVKNRHAIQTA
EAKIQGEIAKVVESMKHDYQTALTQEQSLMHALDQQKADALALNRKGIGYGALQRDAASNRQIFEALMQRTKETGISGAL
KTSNIRVVDNAETPRVPASPNKLANMMLAFIGGSVLAVALVFFFEYADNRIKSPNEIKAHLGLPFLGMIPSLTDQVEGTP
LLDNGVNAGFAEAFRMVRTNLVFSTVDNGTQSICITSSGPGEGKTLVGSNLAVALGQTGQRVLLIDADMRRPRVHEVFEM
AQEPGLSNLLVGDTKTAEAVKQTRSKGLWVLPAGRIPPNPAELLGSTRFKDFVTTVGQHFDWVVIDSPPVMAVADAAVIA
NIASGVVFVVGAEMTSRTVARTAVEQLANARGRVIGAVLNRVDLDNNAYYYSQYYRRQYGEYYTSTSASA
>gnl|bykdb|A0A2V8D8G9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=307 residues).
MSRIDQALRIREVASGAAAPETGTNQSRGSSSLNQYPNEEPDRHPLEEPASPDSFESAQPFRPASTSRRTATRRAKLPNS
ADIQARLVTGALSTVSLEQYRRLAAVLHEDQVQRQLKTVMITSALPQEGKTLTLVNLALTLSESYARRVLVIDADLRWPG
LHTVLDIPNDRGLSEALRDGRHELPFVEVSSRLSVLTAGKPGPTPLAGLTSSRMGEVIEECAARFDWVLIDTSPVGVLPD
AQVLARLVGAVILVIGAGSTPAAAVERAVAELGGPDSIIGTVLNRVEEGRIPDADYYGQYGSSRDGR
>gnl|bykdb|A0A2V8DMJ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=323 residues).
MADGARRGNRCRRCRVDRRGQSSPGAWKRTDRSADGARTSMMRAQGRMLTDVESLIEAPHGLGLSQRPALCDVTADRARI
SEKLVSLVARDSCAADQYRALRQTVERLRRERGFQVIGVTSPCPGDGKTVTTLNLAGALAQSPDSRVLVVDADLRRPSVA
EYLALPRTSFPGLAEAILDPAYDLAAVVRCLDTFNLSVLPAGTPQVTPYELLNSPRLEGLLRDARRTYDCVLIDTPPAVA
LPDCRLIERFVDAFLVVVAAHKTPRTLVAEALNVLDPAKIAGVVFNADDRSRPSEYGYGYYGYPERVTWWQRLFGTVRSA
RVR
>gnl|bykdb|A0A2V8DZN4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=311 residues).
MRSPAAALTGASAPAAPGLSVAHRVELISFRQKTSLLAESFRTTLTSILFSQRNGAYPRVLVLTSASPKEGKTTVVSNLA
ITVAEIRRRVLVIDADMRRPRLHKVFSVDNDHGLSNLLMEPEPLDAAALEGGCVPTQVPNLFLLPSGTSRTHASSLVHTE
RLAEIVVLAREHFDMVIIDTPPMVNIADARVLARHSDALILVVRSGQTTRDAARWAQARFAEDGTAVLGTILNFWNPKTP
GYAYYKHYYAGYYHYYGDGSGKGGGNSVGPQDGEEPVAVERAAGASRWVADVDVHPDEGSRRRPRYARSEA
>gnl|bykdb|A0A2V8EGM3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=237 residues).
MARSMNHPRPDSTSSGRRCSPASEQFRRLAATLLQNQRGENIRSVMITSAVPADGKTLTALNLSLILSESYKRRVLLIDG
DLRRPTISAATNLAKAEGLSEIIAAADERRVPLVQLTETLTLLPGGRPNPDPLSGISSLRMQQLLREAVERFDWVILDTP
PVGVAADAGLLCPMVDGTLLVVRAGKTPYKAIEHALEAIGRDRLLGVVLNGVQEHDRAEAYESGYYYSSQASDNVTS
>gnl|bykdb|A0A2V8EPD9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=437 residues).
MTRLADALLRANRQNQLAASAAATALATPESEPAQDAAAPSVAPVGPVARAASPAPVVVAPAAPVVLAPVVVPIAPVAPV
AAAPAPAAPVALAAAAPVPAAAAAPVARVAPAVHVAVPPAAKPTAPAAPAAVPKPPIAPARPVAASASNAPAASAAPRPA
GAKRAPAWSREASIEKPIVHAAPTGSSLIAVPASADQLTLWRSDPETAGKLVGTDGFLPSAMEQYRKLAAILHHAQMERG
LKVIMTSSAMPGEGKSLTSVNLALTLSDSYRKRVLLIDVDLRRPTVQRIFGLPPVGGLTEALTADEDRQIVLTRVSDSLF
VLPAGRPESDPMSGLTSDRMKRVLAQAASHFDWVLVDSPPVGLLPDASLLATLVDGVLLVIRSGKAPFPLVKRAVEIITH
QRILGVVMNAIDFKHDRNAGGYYEYYGAGYYGAPSTK
>gnl|bykdb|A0A2V8ESQ4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=307 residues).
MSRIDQALRMREVASGAAAPETGTNQSRGSSSLNQYPNEEPDRHPLEEPASPDSFESAQPFRPASTSRRTATRRAKLPNS
ADIQARLVTGALSTVSLEQYRRLAAVLHEDQVQRQLKTVMITSALPQEGKTLTLVNLALTLSESYARRVLVIDADLRWPG
LHTVLDIPNDRGLSEALRDGRHELPFVEVSSRLSVLTAGKPGPTPLAGLTSSRMGEVIEECAARFDWVLIDTSPVGVLPD
AQVLARLVGAVILVIGAGSTPAAAVERAVAELGGPDSIIGTVLNRVEEGRIPDADYYGQYGSSRDGR
>gnl|bykdb|A0A2V8F8T3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=656 residues).
MDLPRMSGRSDATSSWRSAATSIWGRKPRPRHRRCARRRPRPSWRSPRERQWRSTRRPDRAIVARSRGRCSAASTARDGS
CFSEDTSMSRLEDALRRAELANRQAKMKTEAEAAVKTPAVAAWSEPEAVTAPFAAAWSEPESAAPLPAVAAWSEPETVTA
PLAAAAWSEPESAAVLPAVAAWSEPETVTAPLAAAAWSEPESTAVLPAVAAWSEPETVTAPFAVAGWSEPESAAAPPVVA
AWSEPETVTAPFAVAGWSEPESAAAPPVVAAWSEPETVTAPLAVAAWSEPESAAAPPVVAGWSEPETVTAPFAVAGWSEP
ESATAPPAVAAWSEAVTAPFAVVASSEPETVTAPFVVAAPSGPENVQPPLPPLPTWDFDGSVAAAELVEAPDEPKVVTPS
DWKTYRFGAVASRKTIVDPDVESSLVEQYRRLAASLHHAQLQRNVRTVMITSAVAAEGKTLTATNLALTLSHSYKRRVLL
IDADLRRPTVHEAFRIANDTGLVDVLRKTETRRLPLCRASETLWILTAGMPTSDPMSALASEEMKLLLGEAIEHFDWVIV
DSPPVALLSDANLVAAMVDTTILVIGAATTPYPLVRRAVESVGASRIIGTVLNRIERGQMVGGYGFYDYYGYGTRDDGAR
KAGKADAAREAAMDAA
>gnl|bykdb|A0A2V8F916 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=753 residues).
MADLPPNARADSAPGVFAPPPAGAPYAPDGDIHLLDRFAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQLLIED
ERSTAVPGLNSSENTYYEDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTAVPPPTPVSMINDFQTRLMGLLRKP
AAPAPQEAPKVDETPDESALVSSFIGRVTVEPIRTSRLVDVTFMSADPNFAALAVNTLVDEYTEQNLAIKLESSQNMLNW
LAKELDKQQQKVRESEQALAEYRDKQNAMSLDDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSMSGTTAPDAIPV
IAQNTQVQALKTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQVDVETSRALQSVKNDFETAVLEERVLAQNLDA
AKGDAQDLSRKSVGYNVMERESKSNRLVYESLLQREKELRVSSNSRQNNVRIVDKAEVPQSPMTAGGRRTWMMSSLVGLV
LAIGVAFGLDYMNDTIKTPEDVTRRLKLPFLGLVPSVRGDKHPLLTSAHVPHDFGEAFRALRTSLISKYPATGTKTLLVT
SAQPLEGKTTTAANIAMALAYGGSRVLLIDGDMRRPGLHRPLRLTNDRGLSQVLIGQARVRDVIQRTVDPNLLAITAGKM
PPNPSELLASERMRTLLTNLAHGPFDWIIIDTPPVLAVTDAVILAPMVSGVTFVVGAEMTRRRLAERALETIMSSRPRYA
AIILNRVDFARNKYYYSRYYGHQYKNYYAEATG
>gnl|bykdb|A0A2V8FGH1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MGRIDEALRRSTAKKDTQVKAVEVPPDDMFVSPWNFAGPPEPVAQGPVRDGALDEPSSTGLHVIWPSLLARFKNEWRDRL
AIGIDVEPGLAEQFRRLAATLLQNQRGENIRSVMITSAVPADGKTLTALNLSLILSESYKRRVLLIDGDLRRPTISAATN
LAKAEGLSEIIAAADERRVPLVQLTETLTLLPGGRPNPDPLSGISSLRMQQLLREAVERFDWVILDTPPVGVAADAGLLC
PMVDGTLLVVRAGKTPYKAIEHALEAIGRDRLLGVVLNGVQEHDRAEAYESGYYYSSQASDNVTS
>gnl|bykdb|A0A2V8FSM8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=825 residues).
MSQELQSLARHSYPTSTQPLSTIDLPPTAVSIEPPGPGLKRDYSGPVEYWQIVRRHKGAVLLATVAGALLGFAMTLSEPR
IYQAKTTLEYQGINEEFLDMKKVNPVVDTSYLDSDISTQVKILESRALISRVREKMATRPQPERLQPPDRLGMWRTALRL
NAPTADGLWKQALGSAADGVRVRSSGTNRIIDMSCDSTNGQIAADFCNTLAQEYIDQSLEARWKTTEYTGQWLTKQLDDL
KIKLEKQEEGLQAYANATGLIMTSEKNNVQEAQLGDLEKELSVARADRIAKQSKYEMSSSSPPAALPEILDDPSQRTSQT
TLYDLRAKLALLRVTYTTSYAEVRKVMAQIAAIESSLEGTRENVATRIRKEYEGALRREKLLETAYAEKVHQLASKAEET
AHYNLLKRDVDGTRKMYESLTQRLKEASMASALRANNVRVVDPAEEPEAPYKPDVVRRITFGLIFGAMFGVAFSVLRERA
DRTLQDPGDVSYYLGVPELGVVPVGEPIDLPRSGVRSPAAALTGASAPAAPGLSVAHRVELISFRQKTSLLAESFRTTLT
SILFSQRNGAYPRVLVLTSASPKEGKTTVVSNLAITVAEIRRRVLVIDADMRRPRLHKVFSVDNDHGLSNLLMEPEPLDA
AALEGGCVPTQVPNLFLLPSGTSRTHASSLVHTERLAEIVVLAREHFDMVIIDTPPMVNIADARVLARHSDALILVVRSG
QTTRDAARWAQARFAEDGTAVLGTILNFWNPKTPGYAYYKHYYAGYYHYYGDGSGKGGGNSVGPQDGEEPVAAERAAGAS
RWVADVDVHPDEGSRRRPRYARSEA
>gnl|bykdb|A0A2V8G9Y9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=306 residues).
MTRLAEALRRAEDHSGAEAPTSDSRVLSQPAGEPLTRVPDTLSVQRADQDWVAELEIQKHRTLGVFHGFGANAVDKLIVT
PTVPHAAVEQYRKLAASLHHAQLERQIKVVMITSAAPGEGKTLTSTNLALTLSQSYRRNVLLIDGDLRRPSVHSVFDVPN
VLGLSDGLKSEVEHKLSLIQISEHLTVLPAGRPDSDPMSGLTSDRMRRLVAEAAARFDWVLIDTPPVGFLSDANLLAAMA
DVTLFVVRAGRSPFRLIQRALDAVGRNRIIGVVLNAVKESDDVVGFGYYGYYGHYGPQRKRGARRA
>gnl|bykdb|A0A2V8GAF9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=384 residues).
MFALDCAGCRGGAGDGSARYVIPRHRGPAGLPPRPDDAVQHSAAYDRGAHATSVASNRVDGGVGHDRLGLDCRWRSPCRH
RKRANRPVGGWPARVTREDVSTQLDQTATSSESARRADAAARLREFVRANGERFQIAEQLVSLIAPGSFAADQYRALRHN
LERLRRESGLQVLAVTSPGPGDGKSVTALNVAGALAQSPHAQILIVDADLRRPTVAEYLGLGSQRSPGLVEAILDPQYTL
QRVVRRLEGFNLSVLPAGTPQSTPYELLNSRRLEGLLSEARRLYDFVLIDTPPLVPFPDCRLLGRWADGFVLIVGANKTP
RKLLAQALNLLDPAKLIGVVLNGEDRPLSSHYGYYYDTHARDRHAGWWRRVWNARHSQGPQHLR
>gnl|bykdb|A0A2V8GEZ2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=262 residues).
MHDFASSVEQPFRIAPVDRGNGVRATIDRLPGKVVLSPDTPSAVVEQYRRLAATLHHAQRDRQAKVLMISSAMPGEGKTL
TATNLALTLTESFRRRVLVIDADLRRPSMHHTFGLPNNTGLNDALLGRDNMPTAFEMSSRLTVLPAGCPNPDPIGVLTSP
AMRQLVKFARDGYDWVLIDTPPVGLLTDAHLVAQMVDAVVMVVSAGAVPYRVVQRSADALGRDRIIGVVLNRAAAAPFER
AYGYGGYGGYYGAHSHEDQEQA
>gnl|bykdb|A0A2V8GGF6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=320 residues).
MGTVRARGHHDRHWSDVHRRRVALHRERQRAHRPADGAWTGVMASEGRALTDPGEIPAAPPMERDAVLFSRAFRHGSGRE
AIDEEIVSLVDPASFAADQYRSLRHSIERLRTDASSRVLAITSPGPGDGKTLTTLNLAGALAQCRDLRVLVIDADLRRPA
VSEYLGLEARRSPGLADLLRDPDYEIDQVTHRLERFNLSVVPAGSPQPAAYELLNSTRLESSIETARRRYDYVLIDTPPL
VPLPDCRLLAKCVDGFLLIVAAHRTPRKSLARALDMLDPSKLIGIVFNGDDASGSHQNSYYAYYTPQGRDRQRRRWWRRG
>gnl|bykdb|A0A2V8GVG4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=239 residues).
MAKKAQLDQHLVTLTSPGSFAAEQYQGLRLTIERLRRGRTLQVIAVTSPAAGEGKTLTAINLAGALARGADDARVLLIDA
DLRRPAVAKQLAIDELSQGLTEVVENAQTSLGAVTQKLKPFNLSIVTAGTRKGAVHQVLRSPRLDAVLAEARGRYDFVVL
DTPPLLPVFDSALLANAVDGVLMVVAANQTPRKLLGEALNMLDPGKVLGIVFNRDAKPMFGYYDAYYKDYFPEQAVTRA
>gnl|bykdb|A0A2V8H566 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=280 residues).
MSPEDRSTALEAVVRDGRIAAVTSPFVRVEPPPGSARFRHAGAGAAGRLREKLVVARNINQGVLEQYRKLAASLHYAQSQ
HGTRVLMMTSTLASEGKTLTATNLALTLSESYRRRVLLIDADLRRPTIHDMFDLPNVSGLNDVLYARDAALRCELFTMTA
QLCVLTAGRPNPDPIGGLTSERMRQLVAAGTAEFDWVVIDTPPVGLLTDARLMSSMVDAVIFVISAGRTPYRLVHRAVEA
VGRDRIFGVVLNKVAVQDLWRDYGSYSYSYYGYGSPRTKD
>gnl|bykdb|A0A2V8HKU7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=320 residues).
MGTVRARGRHDRHWSDVHRRRVALHRERQRAHRPADGAWTGVMTSEGRALTDPGEIPAAPPMERDAVLFSRAFRHGSGRE
AIDEEIVSLVDPASFAADQYRSLRHSIERLRTDASSRVLAITSPGPGDGKTLTTLNLAGALAQCRDLRVLVIDADLRRPA
VSEYLGLEARRSPGLADLLRDPDYEIDQVTHRLERFNLSVVPAGSPQPAAYELLNSARLESSIEEARRRYDYVLIDTPPL
VPLPDCRLLAKCVDGFLLIVAAHRTPRKSLARALDMLDPSKLIGIVFNGDDASGSHQNSYYAYYTPQGRDRQRRRWWRRG
>gnl|bykdb|A0A2V8I604 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=296 residues).
MSRIQDILNKAERDGAVRRTRPLGSETSAAAALAAPAPMARPIVEPPAPPPPIEPPAAPGWSAAAAVAPPVVQIDRRLAA
ALAPQSLAAEQYRSVRTRIRQAENGRPLRAILVTSPGKGDGKSLTAANLALTMAQEFQQRVLLVDSDLRRPTVHRLFGLQ
QSPGLVDILMGGSTLEESLVSIAEHHLTILPSGPVPTRPAELLGSSAMRRLLDTVRTQFDRVLLDMPPVAPLADVSIVAS
MIDGVLMIVRAGATTKPAIERALSGLDASKVLGIVLNEAGSDGAGYAYDGYGYIGG
>gnl|bykdb|A0A2V8J066 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=298 residues).
MSRIQDILNKAEREGSARRTRSIGTDAPVGTPPSPVAAPPPTPVHRPIVEPTPIAERREARARLAEQASPHREVNLDRHL
VAALAPQSLAAEQYRSLRTRISRMENGRAVRVLIVTSPAKGDGKSLTAANLALAMAEEFSQRVLLIDADLRRPSVHHLFD
LPEAPGLTDVLMGGATLDDALVTLADHHLTVLPSGVPPSHPAELLGSAAMRRTIDTLRTRFDRLILDMPPVAPLADVNIA
AAVADGILLIVRAGMTQKPAIERALGGLDTTKVLGLVLNEVGAEATYQDYAGYKYVAG
>gnl|bykdb|A0A2V8JLJ1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=485 residues).
MEGLVRQFKAAAEAAKAAAAATATAEAAKAASIQVQAAKEPKPEEKPRPFLPEFNLSLDTVPAEVQLQIDQLDRDVSKLK
QGREPLQARIAAYQNRLNPPAPVAEELARLTRNYDEARQHYNVLAEKRSNSKMAATADSSDNNEMFKVIDAAFLPRQAIG
PNRRLIAALGGAAGLVLGLAIAFLREFTDSSLHTEDELAAAIKLPILASIPTVDEKRTRKRKSASVLRLQEHKGGSGPSP
LRHVDNKITDAILNPSCSAREHYRFLHSQLLAMQRKKHLKTILISSSGAGEGKTFSACCIAGMLAQEPGKQVLLIDADLR
RSTATTVLGTPSREGKNLGAILRGRSKVEESLERCEDLNLYFLSSGPMSSNPGELLSSAHIELVLRECAESFDWVIVDTP
PILGAADVNLMAPFCDAILLVVQSGKTPLKVIKDSIKRVGREQICGVILNRVKVARYGSYYDAYYRQPLNESSQRNSNLQ
LREGI
>gnl|bykdb|A0A2V8JXG1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=422 residues).
MAAIRDQIAASRGLLEDKLKADYERVVRDENALKAALAEAKAGAAQENQRAIQYSLLKQDVDTAKSLYTEFLQKTNQAYL
EVAQQQSNIRVISPARMPKGPVSPNRQRTILIGLLLSLSGGIGLAWLLERFDDSIRSVDDVNRYTQLPALAVIPAIGANN
SLLNGRRRKDNAGELLALDSGDKPTAKMQRARLMEFDGRSPASEAYRALRTALLLSAAGNPPKTILVTSVRMEEGKTTTA
TNTAIALAQLGASVLLIDCDMRKPSVHDVFGTSRTLGLSTYLARNVEIDELIQDLPGENLRMISSGPIPPNPAELLSSDR
MKRLLAQLSERYDHIVLDSPPLGSVTDAVILSTMVNGVILVVHGGRNSRQAVQRACHELSAVGARVFGIVLNNVDLRREG
HDDYYYYSYQYSYSADGKRTKT
>gnl|bykdb|A0A2V8KZ20 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=791 residues).
MKNFENLTISDYIDIARRRIWYVVTTTTLVAAGTVLFALRLPAIYKSETTIAISSRFLPENYMPTIDRQTITDRMDFARQ
QLQSRTFLEGIVEEFHLAGPDGVEKAAEVIRNKIEITVLTANTFKLGFPAADPFSAQAVTKRLTERIIQLNDSFRKEKVQ
VADQFLEEQLEQAGNELSEAERKLLQLRNGAFPGVTTDVVTPDVVRDLQAQLAKLDAQVESANDQRKVLQRRLEEHRQLK
IALNASSPPPPPAAHTESTTAAAIETPPPSPLETELANRQAQLAAASVRYTPRHPEVVRLTQEVRELEGLVRQFKAAAEA
AKAAAAATATAEAAKAASIQVQAAKEPKPEEKPRPFLSEFNLSLDTVPAEVQLQIDQLDRDVSKLKQGREPLQARIAAYQ
NRLNPPAPVAEELARLTRNYDEARQHYNVLAEKRSNSKMAATADSSDNNEMFKVIDAAFLPRQAIGPNRRLIAALGGAAG
LVLGFGIAFLREFTDSSLHTEDELAAAIKLPILASIPTVDEKRTRKRKSASVLRLQEHKGGSGHSPLRHVDNKITDAILN
PSCSAREHYRFLHSQLLAMQRKKHLKTILISSSGAGEGKTFSACCIAGMLAQEPGKQVLLIDADLRRSTATTVLGTPSRE
GKNLGAILRGRSKVEESLERCEDLNLYFLSSGPMSSNPGELLSSAHIELVLRECAESFDWVIVDTPPILGAADVNLMAPF
CDAILLVVQSGKTPLKVIKDSIKRVGREQICGVILNRVKVARYGSYYDAYYRQPLNESSQRNSNLQLREGI
>gnl|bykdb|A0A2V8KZG2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=185 residues).
GKTTTASNIAISLAQLGGSVLLIDCDLRKPSIHTAFGISPMPGLSTYLAQNGKIDDLIHHASENLYLMPAGPTPPNPAEL
LSSGKMKRLIEIMAERYDHVVIDTPPLGSVTDPVILSTMVDGVVLVVHAGRNKRNAVQRACRELSAVGARIFGVVLNNVN
MKREGYADYQYYYYGYSSKEEVSEN
>gnl|bykdb|A0A2V8LBV1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=384 residues).
MKREVETSRQLYEAMMQKVKEYSIASAITANNVRVVDPATPPGAPYKPDIYMYTMLGLATGVFLSILLIVRQARVDRTIQ
SPGEAPTYLKVRELGVILSAEADSTLGRPGRSKHIPSLQSLIQLGKPAGNGSFSKAVRKYAGENRAPKRVELMTWEKRSS
LFAECFRTTAASLLFSEPNGAPPHVLVITSTSPRDGKSTIASNLAVALAETKRRILLIDADLRRPHLHTVFEMDNRWGLT
DILQADIEIQEYPLEMLVQQTVVPNVYITGSGSGRESSVHLLHSKRLPDLLRRVRKEFDVVLIDAPPVSQIADARVLARL
SDGVIFVVRSAETTRDMAMAACRQFSEDRSRVLGTILNMWDPREHNQGHYSHYYDGYYTYYAKK
>gnl|bykdb|A0A2V8LCU0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=369 residues).
MGRIYDALKRAESNQRDFTSTNKSSVSRNGNPDNVSYFVQKNGHEHPWEKAPFTGMPSAFSSASTAHTAEATGGPALPGG
PAFRDAGATLGAVGSARAAEFSSREISAARVEPHLVAVTSPHSPECEQFRALRTRLLQAGERQGKRAFVITSAGMGEGKT
LTALNLAWLLAQTDGVSALVIDADLRQPCAAEYLGIETEVGLSEVLTGETKLTEAIVKLKPSGLHLLPGGAAREDVAELL
SGPRFGRLLEEARRLFDYIIIDAPPLGVFTDANLLMNRADAALLVVRASATRYSVVDRLLEQLPRERILGVVLNRAEAKP
EDTAYYYQPRHVRSVAVPDAPSKVKASEERYESTPGEPEMIYIEEEGVS
>gnl|bykdb|A0A2V8MBH9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=531 residues).
EEKLVSYAKNNQILSLDASQNTVVERLAGLNKQLLEAENDRKMAEAEYNAAKAPGAATALAEGAKDINESESKLADLKQK
RAQLLVDATEEAPEVKEVDQQIAELQKHLHESRARNTNTLLTNLETKYRQSLAREESLRKSFNQQKGETVTQNEAAINYR
ILQQEIETNKGLLDNLLQRSKENDVVLAGRPNNISIVDYAITPDFPVGPARMRSVMLAFVLALALGVGLALFLEYLDDSI
HSTDDVEKFLRLPALAVIPSMSGGVARRRRLLSSATALQKRNGNTSGTPELLLNVNGRSALAESYRQLRTSVLLSTAGRA
PKTLLITSSLPGEGKTTTAVNTAITLAQTGASVVIIDADMRRPRLRSIFDLPEREGLSSILSSEIKPEDMLHAIHRDEAT
GLNVLASGPIPPNPAELLGSEQMRKLIAVLSGAFTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVRRSRQL
LTDVGAKIFGVVLNNVSARSHDYYYYYQRYYHQSYYSHDVESDGADERASA
>gnl|bykdb|A0A2V8MKQ7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=241 residues).
MVGDARSPVAESYRHLRTSLLLSSAGTPPRTILVTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDGDLRRPRLHAHFNIP
NVRGLTNCLSGESRDLDALIQTSEKQPNLKLLPLGPIPPNPAELLGSDEMRRLLASLSEKFTHIVVDSPPAISFTDASIL
STVVDGVILVVHGGRSSRAVVRRTKQQLMDVGANIFGVVLNNVKVESHDYYYQGYYSGYYQAADYQEDTAPNPADSRAAS
S
>gnl|bykdb|A0A2V8MLP9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=355 residues).
MGRIYDALKRAESAQRTPKPSVNRNGNPDNVAYFVPKHVHPWERRPFTGMPAGIDSASTAHTEEATGGPALPGGPASRDA
GATLGAVGSARAAEFSSREVLVARVEPHLLAITEPRSPECEQYRSLRTRLLQAGERQRMRAFVITSAGIGEGKTLTALNL
AWLLAQTDGVKALVIDADLRQPCAADYLGIETDCGLSEVLTGETKLLEAIVRLRPSGLHLLPGGAAREDVAELLSGPRFG
HLLDDARKMFDYIIIDAPPLGVFTDANLLINRADAALLVLRAAKTRYSVVDRLLEQLPRERMLGVVLNRAEIGPDETAYY
YQPRHQRVMAVPLEETEDDHGANPEMIYLEEDMVS
>gnl|bykdb|A0A2V8MUA1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=602 residues).
MQATNEVAQSDNKIREFYQKHFPGLPEDQAAILQTLNDLGRERVTVENSIESITTETKLLEQRRQEQQKFKIAMSSRAPA
GPSRAEGQARQPSRAEQLIAAKRDQLAAERLKHTDDWPDIRALKRDIKQLEEQVATDRAAETSAEKNAEETTEKRELGET
PGPAPADEVAASTLLPQLDFSIDFSDFEIQLRLEKLARDLKQRQEAEEEIVRKINQYRSRVNAPPEVLDELAGLQRQRQV
ANQRYELLSGKKFSSDLAGRVDTDINNQTFKVIDPANLPIRPFGPNRERMIMIGCLASFALGLALVFARELLDSTLSDED
TAASELKLPVLACVPNIPAGRKKRRERTNSKAGMVAVSVGHDSINKFSLDYADIRIKKVVLDPLTVSGEQFRVVRAQLSA
LQKKRNLSRILIASAIPNEGKTFSACCLAGILAQEPRKRVLLIDADVRTGSISHTLGIIDAGRGKGLADVLRGSATLEES
LVECSDLNFSLLPSGTIVQNPTEVLSSPEFERVMKDLAQFFDWIVVDSPPSLAMADADLLLRQCDAALLVVNADKTPLKL
IRDAVERMGRDRICGVLMNRVRNLSSSHYYSRYYRQVSLSSK
>gnl|bykdb|A0A2V8N1U8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=362 residues).
MGRVYDALKRADAQRQFKPSTPSVRRHGNSDNVAYFVPKNGHEHPWETAPTIGAPAAIDSASTAHTAEATGGPALPGGPA
SRDAGATLGAVSSTRAAEFQSQDISAARVEPHLVAITSPRSPECEQFRSLRTRLLQASERERKRAFVVTSAGIGEGKTLT
TLNLAWLLAQTDGVTALVIDADLRQPCAADYLGIETERGLSEVLTGETRLAEAIVRLNPAGLHVLPGGAAREDVAELLSG
PRFGRLLDEARKMFDFVIIDAPPLGVFTDANLLINRADAAILVVRASKTRYSIVDGLLEQIPRERLLGVVLNRAQAATDE
TAYYYQPRHQRAATEFVEDTVAREHEDTDQLEMIYLEEDMVS
>gnl|bykdb|A0A2V8N2J7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=700 residues).
MASTAGNSLSVFSILDALRRRKFILMISKILLTAGFAIFAHLQPDRFRATALIAAAQTTPPEYLRHVAPPPLNIEDHLWT
VREVLYSEPVLKAAARESKRYRSNKGDLSPQQLDEFKQAIGIKVDSEHSFQLTYEAGDRYDAMNVTNKLAELFVQNASAK
REQKTSEAANVINEQVDDLKNRLQRQNDQIQNYKTKAVHALPDHIDNTIKAIDSLKEQIQDRETKIAEEQAKRASIEREL
QDLESKGVLEQPMVHEKTPDEAKLDELRIQLAELQTRYTAQHPVVVAKKREISDLERTIASQPKKGRSEPSPTYLRYSQL
KSELEGIQQRIAAYQRDQENLSAQMDTYSRRLESTPQHEKVIDDMERELKVGEMQFHALLDKQLDTKLAKGFEQSEGGIA
FAVVEPAGLPRAPFSPQRVRLVALGVVAGLGLGLALIFVLEQNDTTFGNVDDFESFSTLPVAGIVPNIQNRNKKRTQPSV
VTVEEPDSIAAEQYRILAMRVQQQCDAAQAKTVIVTSAAGGEGKSLTAINVAMALAAATDGRVLLMDADMRKPRIGEYLK
LSVPTDKGFHNLLVHSDGNPDRYVMQFKQLYVIPGGVSQANPVAALSSAKARAVFEQLKQKFAYIIVDAPPVLPIADSQI
LAGIVDKVLFVIRARQTPRELFQHAIEGFEAANLLGAVLNDVDYQRSRYAYAYEYYKKLA
>gnl|bykdb|A0A2V8NJB5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=491 residues).
MNLVLDEIRQLGENRENGFLTLSRNGHRVVMFYREGMIQAVSSNLTSHRLGDYLVKAGYLTARDIQSVLKSAQRKHALFG
EAAVRERHLEPVELAEVVRRQSLELLQHVLTNDFSIDDFTNSVRSFYTPANITFAGLFLELCRNNAKSFEASGTRTVVLR
SGQDLSELPWYPEELGVLRELTHPTTVAGLVASTGMKETPLRRILGVFDQLGIIELKSENEFLSEHVAIVKRSGFPFDGL
IPVISNAVVSDKLEVLKNSSSFISEQFRNLKVRINESDNPAQVMIVSSPENGDGKSLVSANLALSYSLEVARRVIIVDCD
LRNPSLHRYLGVTEGPGLLQYLSNGRLAPHCYVRRLENLFFLTSGGIAENPIELLSLRRMKDLIEYLKNDFDTIILDAPP
LSPIADARIVTALSDGCIMVIRRGKTSYRSIEGAFRVIDQAKLLGIVFNDVKPMLFHTYYKRGYYDYGRDSQYMYSRGRK
RLEKPKNYLES
>gnl|bykdb|A0A2V8NMG8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=219 residues).
MLSTAGRPPQTLLITSSVPSEGKTTTSINTAISLAQTGANVLIIDADMRRPRLHSIFDVENRNGLSTILSSEMKEAEVLA
LIQQHEESGLHLMTSGPIPPNPAELIGSEQMRRLITTLQSTFTHIIIDSPPIASFTDGVLIASMVDGVVLVIHGGETSRS
LVRRSKQQLQDIGAKIFGVVLNNVDLHRHDYYYYHRYYSSSYYKAEADDTEQVASSAHG
>gnl|bykdb|A0A2V8NRW2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=362 residues).
MGRVYDALKRASTAKDENGAGRKKEDQKRRNGTAAGRKLSAVLPVVNGDEHPWDSSPLFSRAAHESASTAHTEERAGSAL
SGVTASRAAGATLDAAGTARALPEFMSLDISAARVEPHLIAVTQPRSAYCEQFRSLRTRVLQASERKKMQAFVVTSAGVA
EGKTLTALNLAWLLAQTDGVRALIIDSDLRNPCAADYLGIEDAIGLSDVLSGEATLEEAILHLNPSGLYMMPGGEARDDV
AEILSGPKFGQLLAELRRMFDYIIIDAPPLGIFTDATVLINRADAALLVVRSGKTRYAALDRIIEQLPRERLLGVILNRS
DEQLDETSYYYQRRYYRREDKGITKSATQAEMKNAEEVIVAG
>gnl|bykdb|A0A2V8PJQ0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=289 residues).
LDDTVKSLDDVDRYIHLPTLALIPAARSEKRLREGEAPTAGASTALAMVEDVRSHVAESYRHLRTSLLLSSAGQAPKTIL
VTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDCDLRRPRLHSNFNISNVRGLTNFLSGELPLDEVIQPFEKLPNLKLLPS
GPIPPNPAELLGSEQMRRLLTLLGEKFAHIIVDSPPAVSFTDASILSTFVDGVILVIHSGRSSRAVVRRAKQQLLDVGAH
IFGIVLNNVKLDTHGYYYGGYYGRYYYKYGYYYSDYSDDDGKKAQTASG
>gnl|bykdb|A0A2V8PQZ0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=356 residues).
MGRIYDALKRAESAQRTPKPSVNRNGNPDNVAYFVPKHVHPWERRPFTGMPAGIDSASTAHTEEATGGPALPGGPASRDA
GATLGAVGSARAAEFSSREVLVARVEPHLLAITEPRSPECEQYRSLRTRLLQAGERQRMRAFVITSAGIGEGKTLTALNL
AWLLAQTDGVKALVIDADLRQPCAADYLGIQTDCGLSEVLTGETKLLEAIVRLRPSGLHLLPGGAAREDVAELLSGPRFG
HLLDDARKMFDYIIIDAPPLGVFTDANLLINRADAALLVLRAAKTRYSVVDRLLEQLPRERMLGVVLNRAEIGPDETAYY
YQPRHQRVMAVPLEETEDDHGAANPEMIYLEEDMVS
>gnl|bykdb|A0A2V8PQZ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=439 residues).
MKSEKDLRASSTLPAAPNFGQRGTAIPATAMAATATFQPTRTLSARASLNLRSSSTSTRAHSLQPPLRNSDRLSTLRAWG
EETMGRIYDALKRAESAPRTPKPSVNRNGNPDNIAYFVPKHVHPWERQSFTGMPQGYDSASTAHTEEATGGPALPDGPAS
RDAGATLGAVGSARAAEFSSREVLAARVEPHLLAITEPRSAECEQYRSLRTCLLQAGERQRMRAFVITSAGVGEGKTLTA
LNLAWLLAQTDGVRALVIDADLRQPCAADYLGIETDCGLSEVLTGETKLLEAIVKLQPSGLHLLPGGAAREDVAELLSGP
RFGHLLDDARKMFDYIIIDAPPLGVFTDANLLINRADAALLVLRAAKTRYSVVDRLLEQLPRERMLGVVLNRAEIEPDET
AYYYQPRHQRMMAAPVEGTEYDQGAANPEMIYLEEDMVS
>gnl|bykdb|A0A2V8QJ59 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=209 residues).
LVTSSQPSEGKTTTAINTAFILAQTGAEILLIDCDLRRPRLHVHFNISNARGLTNCLSGEASEIDSVIQSYAQLPNLKVL
PSGPMPPNPAELLGSEEMRKLLIALSKKFTHVIVDSPPAISFTDASILSTFVDGVILVVHGGRSSRAVVRRAKQQLLDIG
AHIFGVVLNNVKIEKTHDYYYGGYYGYYKSNYYTAEEDPEADQGSTAST
>gnl|bykdb|A0A2V8QJT6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=496 residues).
MLEAENDRKMAEAEYNAAKAPGAAGALAEAGAKEIEVTDSELAKLRQKRAQLLIEATEEAPEVKEIDQQIDVLQKHLADT
RARGAATLLKNLETKYRQAADREEALRKSFNQQKGETVTQNEAAINYRILQQEIETNKGLLDNLLQRSKENDVVLAGRPN
NISVVDYAIVPDLPVGPARLRTVMFAFLLALAFGAALALFLEYLDDTVHSTDDVERFLRLPALAVIPAMSSASAPRRLLS
SATSLQKRNSSNGANPELLLNINGRSALAEAYRQLRTSVLLSTAGRAPKTLLVTSSLPGEGKTTTAVNTAISLAQTGASV
VIIDGDMRRPRLRSIFDLPEREGLSSILASDTTADDMLRSVVRDVSSGLFIMPSGPVPPNPAELLGSDQMRKLLATLSEK
FTHIVIDSPPVNSFTDGVLIGSMVDGVLLVVHGGKSSRDVVRRSRQLLLDVGAKIVGVVLNNVSVRSHEYYYYYQRYYHQ
SYYTQDPSEEVVATRS
>gnl|bykdb|A0A2V8QL35 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=362 residues).
MGRVYDALKRAESPERRITASKSAIRQNGNSGNVLYPGWPGNGHDHPWERNAFTGMPSAYDSASTAHTAEAASGPALPAG
TASRDAGATLGAVGSARAIEFSSREVSAARVEPHLVALTDPRSVACEQFRALRTQLLQAGEREHKRAFVITSAGQGEGKT
LTALNLGWLLAQTDGATALLIDADLRQPCAAEYLGIQTEVGLSEVLTGETKLTQAILKLEPSGLHLLPGGAAREDVAELL
SGPRFGRLLEEARKLFDYIIIDAPPLGVFTDANLLINRADAALLVVRAGVTRYAVVDRLLEQLPRERMLGVVLNRAQGKP
DDAVYYYQPRYQRAASAADVGDAGDAFEDRPGMIYIEEEGVS
>gnl|bykdb|A0A2V8QZU0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=366 residues).
MGRVYEALKRAAEQNGSKAKKEEKLAHDSRDERPPAPAAETNGHGRPHAAPGASAPVVGVNRDADDAAEFLFRRSKHFQS
PESATVSASNEHTVTPGGSALPAAASRAAGATLGADGSARTPEFVTLDISAARVEPHLIAITQPRSAHAERFRSLRTRVL
HAGERKKMQAFVVTSAGVMEGKTLTAINLSWLLAQTDGVRALLIDGDLRNPCAGDYLGLDAPTGLSEVLAGEATLAESIV
RLEPAGLHLLPGGAARDDVAEMLSGPKFSAVLKEARRMFDYVIIDAPPLGIFTDASVLINRADAALIVARAGRTRYAALE
RLLEPLPRERLLGVVLNGSDEQLSEQNYYYYRRYGSRRDAGKEQEG
>gnl|bykdb|A0A2V8R0I3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=395 residues).
MSSCASVATLQRRLKMSGQPSAVPVLGEEPMGRVYDALKRAESAQRHNHKPSDFSGRHNGDADNVSLFTPKNEQEHPWSA
SPFTAMPAAIDSAPTAHTAEETGGPALPGGPASRDAGATLGAVGSARAARFRSRDILAARVEPHLVAITQPRSPECEQFR
ALRTRLLEAGERKRMRAFVITSPGVGEGKTLTALNLAWLLAQTDGVKALLIDADLRQPCAAAYLGIETDCGLSEVLTGVT
RLTEAILKLNPAGLHVLPGGASREDVAELLSGPRFARLLDEARKLFDYIIIDAPPLGIFTDANLLINRADAAMLVVRASK
TRYAVVDRLLEQLPRERVLGVVLNRAETRLDDAAYYYQSRYQRQSPLVEAGTEEVADDEATDQPEMIYIEEGFVS
>gnl|bykdb|A0A2V8RSQ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=361 residues).
MGRVYEALKRAAAHGDAKSKRPDDAGPSRVDNTNGNAQHANGNGAAHTRAPVADPLFDRPSAFFHAPDAAHSSASTEHTA
QAGVGSALPGGVAARVAGATVDAVGSTRDATYTSIEVVTSRVEPHLVAITDPRSPHAEQYRSLRTRVLHAGERRKVQAIV
VTSAGIAEGKTITALNLAWLLAQTDGVRALLVDGDLRQPCAAAYLAFDAPVGLSEVLAGQASLNDTIVRLDPSGLFLLPG
GTPRDNVAELLSGPKFSAVLAELRRSFNYIIIDAPPLGIFTDATVLINRADGALVVVRAGRTRYGTLDRVLEPLPRERLL
GVVLNGADSAPDAQSYYYQRRYYRRDETQPGAPTKDVEEDV
>gnl|bykdb|A0A2V8SEH0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=286 residues).
MNATLTPRQPEGSAHAARRAGPRRPEAAAPAARPIGSSGAADEHLVSLLVPNSIEGEQYRALRHQIEQRHKDDGLTVVAI
SSPTPADGKTTTAINLAGALAQDPQARVLLVDGDLRVPSVSEQLGLGEVAGPGLVEAILDPGRSLDDVVRDLPLFNLSVL
PAGRSPSAPYEVLKSPRLGDLFQEARRRFDYILVDTPPIVPVPDCRVISKWVDGFMVVVAAHKTPRRLLQEALNVTEPGK
LMGLVFNRDERLLTRAYGYYGYGQQHGRARAAERGRGGAPRSQPCP
>gnl|bykdb|A0A2V8T7Z1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MMSRPSIEAERSVVSHPAARATAPAPPQKVEGHVVALTAPGSFEAEQYRTLNLVLERMQPGRPLRVIAVSSPAVGDGKTT
TTVNLAVTMAQNPAARVLLVDADVRRPAVGRKLGLGKVRLPGLVELIADPSLGIGGLARRVGPANLSVLLAGRSHADPFD
VLRSPRFEEFLRQARESYDSVVLDTPPLLMVPDCRQLSAWVDGILLVVAAHRTPRRLVEEALNVMEPDRLVGLVFNGDDR
PLSGYYRSYRAYGYPPRLARAAARRPRLR
>gnl|bykdb|A0A2V8TBM7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=224 residues).
RTSLLLSSAGQPPKTVLVTSSQPSEGKTTTVVNIATMLAQTGADVLVLDCDLRRPRVHAHFGLPNSRGVTNYLSGDSQVA
DLVQTYERMPNLKVITSGPVPPNAAELLGSEEMRKLLYLLTENFTHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSS
RAVVRRAKQQLQDVGAHIFGIVLNNVKLEGTDYYYYSGYYSGYYSDDDTAPEGAATAGERPGAG
>gnl|bykdb|A0A2V8TKD8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=274 residues).
MSAFSGGDRDHTSDRSERACPAQSAGGLRGLDRHLVSLVAPASFEAEHYRMLRARIEARQEGKALQVIAVTSATIGDGKT
TTAINLAGALAQAREARVLLVDADLRRPSVALQLGLDDPRGSGLADAILDPERSIESVILRRLPLNLGLLTAGRLPPAPY
EALKSPRLGALFEQARRLFDYIVVDTPPLVPVPDCRLLARWVDGLLMVVAAHRTPRKLVEEGLNLVDPAKTIGVVFNGER
RSRSGYYGYYHAYGRPPGRARRPGARSPAHDTLR
>gnl|bykdb|A0A2V8TKR9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=209 residues).
MLLSAAGSPPKIVLVTSAQPGEGKSTTVVNTAISLAQLGSSVLIIDCDLRRPSTHKILGINPAEGLSSYLTRNIGIDRLI
HKLQIPNLSLLPCGPIPPNPAELISSARMRDLLKEMAARYDHILIDSPPMMNVTDPVILSRMVDGVILVVHGGKSPRTTV
QRARQELQGVGAKIYGVVLNNIDLRREGYDSYYYHYNRYYGGYPSDTNV
>gnl|bykdb|A0A2V8UVN4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=319 residues).
MSKIFEALQKSEGEVAQEALPVLTDGGSQLGGVKVVDKILRETTGERRPADASDGAAEDLPAAATAIDVAGLESARRAAA
ETVEAVPGIRTVALHLSVETPVLPFDVRDGRAGEQYRTARTKLLHHPRQPRLVVISSAGSGDGKTVTSINLAGAMSLKTE
AEILLIDADLRKAQIAPLLGISGEPGLADVLMGTCRLEDAIVRLEQFPNLCVLPSGKPTAHPTELLDSNRWTALCASVRQ
QFKFVILDTPPIAAVADYDLIDAQCDGVVLVVRPDHTDRKLCMQAIDIVPKDRLLGVVLNCVRDWFLWKTQDYYSYTEN
>gnl|bykdb|A0A2V8VI82 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=279 residues).
MREAETGSGAGTQPDAGQPTRTVRSAPSHGPAGPIDQRLVSLLAPDSFEAEQYRTLRHVVEERRGEMSVIAVTSAAAGEG
KTTTAINLAAALAQDAESRILLVDADLRVPSAGRLLGLGDDLPGIADAVREPGALLEDFVRRRPPSRLSILPAGRTSDNP
YDVLKSPRMGEIVQAARRRYDTIVIDTPPIVPVPDSRVLAKWVDGFLLVVAAHRTPQRLVEEALHLLSHAKVAGIVFNGD
DRPSSAYYGYYYGYGRPRGDGRYDRGERPGSRKVAALWR
>gnl|bykdb|A0A2V8VU54 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=282 residues).
MSGYIDAKPDGSVDLMGRSRTATETQGVRGLDPHLVSLVAPASFEAEQYRALRSRLESRPEGRALQVLAVTSAVVGDGKT
TTAINLAGSLAQARDARVLLVDADLRRASAGLQLGLEDPRGAGLADAILDPDRSLPGLVQSLPANLGILPAGRLAPQPYE
VLKSPRFGAVLEEARRMFDYVVVDTPPLIPVPDCRLIARWVDGLLMVVAAHRTPRKLVEEGLNLMEPSKVIGIVFNGDAR
AFSGYYGYYHAYGRPPGRGRRPPQPATRETAPREAAPEPPLK
>gnl|bykdb|A0A2V8W2M7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=312 residues).
MSRIHEALKKAVEERVSHLSVGESLNLAAIAGSMQAPAVPARQVAEQPARVTPPPPSEAGAFLRFDDLVKRCAHPTWKPD
MRFSLFHRTDDDAKIGTERFRTLRSRLYQIAAAKQLRKVLVTSSVPNEGKTFVAANLAQSIVHQPDRRVLLIDADLRAPL
LHVTLGAPTSPGLTDYLRGEANEYDVIQHSSEVNLCFIPCGHPVSNPSELLSGDRMKKLLDLVTPVFDWVILDSPPSLAI
HDASILADLCDGVLFVVRAGETNHETAERAASEFRNKNLLGVVLNRVEQAAGYGDYYYGSLGEEEQPVLRAS
>gnl|bykdb|A0A2V8W380 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=344 residues).
MDSAEPPAKPVKPRTLLNLSVALFLGLALGICAALFQERMDDTLKGDDDVERLLGLPSLALIPVVAPANGNHLGIHRFLP
RDKSLVLAGNGSGKNSRSWHLIDRDGAQHAALGEAFRSLRTSVLLSTPDRPPSSLLVTSTQPADGKTTVACNLAISLAQL
GHRVLLVDADLRSPSLHKLFGIDRSLGLVSYLTGQQDWRAVVHPSGSRGLDLLLCGPVPPNPSELLSSQSMGALIRSASA
EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGTTPREQLLHAQSGIRSVGGNLIGVVLNSVDIRTNGYYNYGSYGSN
RGDPPQETFVPTNLHLPPQQKASD
>gnl|bykdb|A0A2V8W5N5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=327 residues).
MSRIHEALKKAHEERHSSQAADTVTLSVETPRTQVIAGIGLRAPAAETRARTETIPAPSRSAPELRFDSLVAHCTRREWQ
PEPGKNVFSNAAATACGAEQFRTLRSRLYQIRGNQPSYTLLVTSSLPDEGKTFVAQNLSQAIVQKPRQRVLMIDADLRYP
QLHLALGAPMAPGLTDYLRGEADEMAAIQYSDNENLCFMPGGKQVTNPSELLSNGRLKILLDRLTPIFDWIIVDSSPCLL
VADASMVAGVSNGVLLVVRAGSTSVDVAEKVCQQLKGKNIVGVVLNGAEKSDLVDSHYHAYGYGEPMETPVSGLRRRVSP
LHSWGPR
>gnl|bykdb|A0A2V8WG13 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=306 residues).
MSRIHEALKKAAQERSSQVATGTVPDLADVATGLESPFGNKMQAGEPAVRSARVSEGSSFLDFDDLLRRCAHPNWHLDPR
LNIFLKTDEGRIGRERFRTLRSRLYQIAATRPLKRVLVTSSVPSEGKTTVAANLAHSIMCQPDRRVLLIDADLRCSGMHE
LLGAPGGPGLTDYLRGEAEKEAVIQNGLEGNLCFIPGGSEVSNPSELLLGDRMKKLLDLVTPIFDWIILDSPPALAVHDA
SSLADLCDGVLFVVKAGETNHQLAEKASAEFLKKNLLGVVLNSAEIDASYGDYYSGYATDDQKDSY
>gnl|bykdb|A0A2V8X713 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=298 residues).
MSRIHEALKKAEEEKSPTRSAPGAGPLDFAGDVAEPSPLGTLYPQMPGGAPTPEFCLGLEELRGRCAKPGWKMNPDYDVF
SAKQTSFPCAEQFRTLRARLYRLREKNPIRILLVTSTLPGEGKTFVALNLALAITRQHERGALLIDADLRASRLHVRMGA
PSAPGLSDYLNGRADEFSVLQADAKADLFLIPAGRFVPNPAELLANGLLKGLLDRVSPLFDWVILDAPPVLAVSDAGVLA
GLCDGVIVVVRAGATAHDLVQTTLQEFRGKNLLGVVLNRAEREANYGAYSYGYGVDTK
>gnl|bykdb|A0A2V8X987 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=308 residues).
MSRIHEALKKAAQERSTQIGAGLDRDVADVAAEIHRPVTVEPVVAVLAEQPRATIGGGHTGSMRYEEIVRRCSRPDWRLD
PRASAFQDSNSGHSGAERFRTLRSRLSQIAGTRTLRRLLITSSVAGEGKTFVASNLGQSIVRQPGRRVLLLDADIRMSRL
HVGLGAPSRPGLTEYLRGEADEYSIIQKGMEGNLFLIPGGSPVFNPSELLLHERMKRLLDLLTSAFDWIIIDSPPALLVH
DASILADLADGVLFVVQAGMTHVGEAEKAAEEFQNKNLLGVVLNKVEKRDSYGAYYHGHLSENAEKAT
>gnl|bykdb|A0A2V8XG53 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=327 residues).
MSRIHEALKKAHEERHSSQAADTVTLSVETPRTQVIAGIGLRAPAAETRARTETIPAPPRSAPELRFDSLVAHCTRREWQ
PEPGKNVFSNAAATACGAEQFRTLRSRLYQIRGNQPSYTLLVTSSLPDEGKTFVAQNLSQAIVQKPRQRVLMIDADLRYP
QLHLALGAPMAPGLTDYLRGEADEMAAIQYSDNENLCFMPGGKQVTNPSELLSNGRLKILLDRLTPIFDWIIVDSSPCLL
VADASMVAGVSNGVLLVVRAGSTSVDVAEKVCQQLKGKNIVGVVLNGAEKSDLVDSHYHAYGYGEPMETPVSGLRRRVSP
LHSWGPR
>gnl|bykdb|A0A2V8XHT0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=304 residues).
MSRIHEALKKAAEERSAQLAAGLETGVVEVTGELRRPITQGPGIAQPTAAPRVPTGDNQDVPFHYEELIKRCAQVEWRLD
PVSSVFLNSKPGEGGPERFRTLRSRLYKIASTRKLQKVLITSGVAAEGKTFVASNLAQSIVQQPELRVLLIDADLRSSRL
HVLFGAPSCPGLSDYLRGDADEYAVIQKGTKENLFLIPGGSLVSNPSELLLNERMKHLLNLVAPSFDWIIIDSPPTLPVH
DASILADLVDGVLFVIRAGSTDAAIAERTAAEFQGKNLLGVVLNQVERSDSYGDEYQNYYAERD
>gnl|bykdb|A0A2V8XNW2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=312 residues).
MSRIHEALKKAVEERVSHLSVGESLNLAAIAGSMQAPAVPARQVAEQPARVTPPPPSEAGAFLRFDDLVKRCAHPTWKPD
MRFSLFHRTDDDAKIGTERFRTLRSRLYQIAAAKQLRKVLVTSSVPNEGKTFVAANLAQSIVHQPDRRVLLIDADLRAPL
LHVTLGAPTSPGLTDYLRGEANEYDVIQHSSEVNLCFIPCGHPVSNPSELLSGDRMKKLLDLVTPVFDWVILDSPPSLAI
HDASILADLCDGVLFVVRAGETNHETAERAASEFRNKNLLGVVLNRVEQAAGYGDYYYGSLGEEEQPVLHAS
>gnl|bykdb|A0A2V8Y4D3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=302 residues).
MSRIHEALKRAEEQRPSAWKPAEPTPFGVAGGEGGSASAVSRALYSPKWGEIPAPGRRLRLEELRQRSSKPGWKLNPDYD
AFSPQHSSALCAEQFRTLRSRLYRLKEKSPLRTLVVTSTLPGEGKTFVALNLALAIARQHERRALLIDADLRASRIHVGL
GAPSAPGLSDYLSGKADEFSILQADPKVELFLVPAGKPVPNPSELLANGMLKSFIDGVSPVFEWVIVDTPPVLAVADAGI
IAEFCDGVMVVVRANKTPHDLVKTTLQEFRGNNLLGVVLNDASEGANYGGYSFRAGFGTDKK
>gnl|bykdb|A0A2V8YCY6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=244 residues).
MCPSHRCRKPSGPCAPLQVILVTSALPREGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLGTGKYAGLSSYLA
GVSSLDLVSVPHPAIPNLVAIPTGPLPPNPADLLSSHKLADAIVELRAKFKFIVVDSPPIMAATDAVILSVHADGVLLVV
RSGETPKVAFMRTRDLLASVKSRVLGVVLNAVDSSAPDYYYSYRYYPYSYGYGPQEAGEAAQGEASESVGGAISRHHDDD
SQAL
>gnl|bykdb|A0A2V8YMQ4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=258 residues).
MAMGQAFAGCWIIQSFLGPGRMERRVTLARAGTALIKEDSVLLSTADHPPGSLLITSTQPGEGKTTVATNLAISLAQLGQ
RVLLVDADLRFPSLQRLFCIRENLGLVSYLTGQEDWRTAVCPSGSPGLDLLPCGPVPPNPAELLSSKSMGAFLGSAKSEY
AFVILDSSPLLTLADSRILASLVDGVLLVAKSGATPREQIRQSQSGIRSAGANLIGVVLNNVTLHTNGYYGLGIYGSNGN
SHSETISDPAEPWNRLSK
>gnl|bykdb|A0A2V8Z1Y8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=297 residues).
MSRIHEALKKAALERSAQLVTELESAEVLGEIRRSVPGPLETEVPRPQAPPRIAGSREPAPSCFGELVKRCAHPEWWPYR
GSSVFGDPAAGHAGAEKFSTLRSRLYQIAEARTLRRLLLTSTVAGEGKTFVAANLAQAIIREPERRVLLLDADLRVPQLH
AVLGAPSSPGLTDYLLGDADECAIIQQGLQPNLFLIAAGRAVSNHSDLLLSKKMKHLLNYLTPIFDWVIMDSPPTLPVHD
ASVLADLADGVLLVVQAGSTAVDDARKAAEEFRNKNLLGVVLNQVEKSDAYIAPDYH
>gnl|bykdb|A0A2V8Z2X8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=300 residues).
MSRIHEALKRAEEAGPSAWRPSEPTPLGIVGAGGVAGAHRILSSPIRAEMPMAGRCLGLEELRHRCIKPGWKLNPDYDVF
STKQSSALCAEQFRTLRSRLDRLRKKSAIRTLLVTSTLPGEGKTFVALNLALAIARQHEKRALLIDADLRASRLHVRLGA
PSAPGLSDYLSGHADEFSILQADPKVELFLVPAGRPAPNPSELLANGMLKGFIDKIGPIFDWVIVDAPPVLAVADARIIA
EFCDGIMVVVRAGQAGRDLVKTTLQEFRGNNLLGVVLNGSDQDASCASYSYYAGFELDRK
>gnl|bykdb|A0A2V8ZIV5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=380 residues).
QYNILKREVDTNKQLYEGLLQTLKQTGVSASLKATNIRIVDSAVPPVKPATPKIPLNLTVASLLGLGLGISAAFLQERLD
DTLKGADDVERLFGLPALALIPSVHHLNGDRSSVRKLLDSASTLRSSQNGTASTPGAYWHRIDQRGKPQAALVEAFRSLR
ASVLLSTADHPPGSLLVTSTQPGEGKTTVATNLALSLAQLGQRVLLVDADLRFPSLQSLFGMREKLGLVSYLTGQQDWRE
AVRPSGSPGLDLLLCGPVPPNPAELLSSKSMGAFLVSAKSEYAFVILDSPPLLTLADSRILASLVDGVLLVVKSGATPRE
QVMQSQSSIRTAGANLIGVVLNIVRLHTNGYYGLGMYGMNGNSHGKTSSDEADSWRTLSK
>gnl|bykdb|A0A2V8ZJV2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=316 residues).
MSRIHEALKRAAEERAAQLAAGSEASSADVRSELELLRRGPECTGPAVSARGTTSGNENTLLCFEELGKRCVKLEWQIDP
HNSVFVNARPGQEGSERFRTLRSRLDKIASTRKLKRVLLTSAVAGEGKTFVAFNLAQSIAQQPDLRVLLVDADLRSPRLH
HLFGAPICPGLSDYLRGDVDEYAIVQKGMNESLFLIPGGSLVSSPSEVLRTERMKQLLNRVTPLFDWIILDSPPSLRADD
AGILADLADGVLLVIQAGSTAAQIAERTAAEFQGKNLLGVVLNQVEKRDCWNDYYGGRIVQLETTDRALPAGERLS
>gnl|bykdb|A0A2V8ZLE9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=302 residues).
MSRIHEALKRAEEQKPPAWKPSEPTPLGFGGNVNTAVAREALHSPTPTPKGIPTVGRGLRLEELRQRCIKPGWELNPDCD
VFSTKQSSSLCAEQFRTLRSHLYRLREKNPIRTLLVTSALPGEGKTFVALNLALAIARQHERKALLIDADLRASSLHARL
GAPAAPGLSDFLGAKVDEFSILQADPKFELFFVPAGRPVPNPSELLANGMLKAFIHGISPVFDWVIVDAPPVLAVADAGI
IADFCDGVIVVVRAGETAHNLVKTTLQEFRGSNLLGVVLNGGSEAANYGGYACSAGFGLAKR
>gnl|bykdb|A0A2V9A773 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=299 residues).
MSRIHEALKKAEEQRPPAWKPADPTPLGFGDDGIAVAAGAMQSPRREEMPTAGRCLRLEELRQRCIKPGWKLSPDYDVFS
TKQSSALCAEQFRTLRSRLYRLREKSPIRTLLVTSTLPGEGKTFVALNLALAIARQHERRALLIDADLRASRLHVRLGAP
SAPGLSDYLGGRADEFSILQADPKVELFLVPAGRPVGNPSELLANGKLKGFLNGINSVFDWVIVDAPPVLAVADAGIIAQ
FCDGVIVVVRAGETAHDLVKTTLQEFRGNNLLGVVLNGANEGADYGGHSYYAGFGMDTE
>gnl|bykdb|A0A2V9A795 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=618 residues).
MYQRVLERFQDRLTIEPVSRSRLVTVQFDSNNADLSARVVNTLAEDYIDQSLEARWAATQKAADWLSQQLVGVKSKLEKS
EEQLQDYARHNGLVFLETDKGASQNVANERLQQLQEELTKAEAERYEKEALYRLVQSGDYGSLPGVVENKLIQDLSERLA
ELKRELAQLSTKFNAGYPRVKEIQSQIDETEAALKEERQRAADKITNEYFAALRREGLVKEALEGQQKQVNVIAEKAVQY
NILKREVETNKQLYEGLLQRLKEAGVSASLKASNIRIVDSAEPPAKPAKPRIPLNLAVAALLGLGLGISTAFLQERLDDT
LKGADDVERVFGLSALALIPSVHHLNGDRPSVSSLLGRTNLLRSGQNGTASNPAARWHRIDQGQRPQPALIEAFRSLRAS
VLLSTADHPPGSLLITSTQPGEGKTTIATNLAISLAQLGQRVLLVDADLRFPSLQRLFCIREGLGIVSYLTGQQDWRAAV
RPSGSPGLDLLPCGPVPPNPAELLSSKSMGAFITSAKSEYGFVILDSSPLLTLADSRIVASLVDGVLMVVKSGATPRDQV
MQSQAGIRSAGANLIGVVLNSVTLHTKGYYGLGIYGSNGNSHSEIISDTADSWGTLSK
>gnl|bykdb|A0A2V9AGR3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MSRIHEALRKAEQERASSAAVGRKDELPAINTDALSSSPVAPRNGKLFAPTTGIRDVMAPPSFEVLASRCVHLNWRLDPQ
VSLVDGGESETGGAERFRTLRSRLFQIAATRPLRRVLITSSLPAEGKSFIAANLAQSLACRQDSRVLLIDGDLRAPRLHL
ALCAPKSPGLTNCVRGETDEFSVIQIGAQSNLAFLPSGDAVADPAELILGGRVKKLLDFVTPAFDWVILDSPPALAVHDP
SLFADLCDGVLFVVKAGETSYENAVKGSSEFREKNLLGVVLNQIQEADMYAGDYYYGKTYGRTRK
>gnl|bykdb|A0A2V9AND3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=297 residues).
MSRIHEALKRAEEQRPPSWKPAEPTPLRFGGERLAPGVLQPSLQQEMPTARRCLGLEELRRRCLKPGWKLNADYDVFSTK
QSSALCAEEFRTLRSRLYRLREKSPIRTLLVTSTLPGEGKTFVALNLALAIARQPERRALVIDADLRASRLHVRLGAPSA
PGLSDYLNGRADEYSIIQADPKVELFLVPAGRPVHNPSELLGNGLLRDFLHGMSPIFDWVIVDAPPVLALADAGIVAEFC
DGVIVVVRAGQTSHDLVKTTLQEFRGINLLGVVLNGANLEANYSSYSGYAGVGMDKK
>gnl|bykdb|A0A2V9AWB5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=307 residues).
MSRIHEALKKAAEERAARLTFDVDPREGDGEVRSEPESPLTQGIDLLPPVPSTRTEAVDSSTIASFSFEELNKRCARKEW
RLDPLNSVFLNSKPGEEGPERFRTLRLRLYKIATTRKLKRVLITSGVASEGKTFVASNLAQSIAQQPELRVLLIDADLRS
SQLHVVFGTQGRPGLSDYLRGDADEYAVIQKGMSKNLFLIPGGNLVSNPSELLLSERMKHLLNVVSPAFDWIILDAPPTL
PVHDASILADLVDGVLFVIRAGSTHAEIVERTASEFQDKNLLGAVLNQVEKSDSYGAEYQNYHSDRD
>gnl|bykdb|A0A2V9BCK9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=628 residues).
MKATKMYEKFFGLRESPFNVNPDPRYLFLTPSTQEALASLAYGIRGRKGIILLTGEVGTGKTTLLNRLLDWLRHEQAVTA
FIFNTRLSVTEFFDCLTADFGISCQSPSKSHVLLGLNRWLLDRYRAGETAVLIVDEAQNLSQQLLEEIRLLSNLETSTEK
LLQIVLSGQPELEEKLKHAQLRQFRQRITVRARTGPLSLQETHGYIAERLRIAGANGEPIFAPGAVESVYNYARGIPRVI
NVLCEHALINSFADQQRPVPTHLVDEVAREFELGSLEPTTQPTSTACPENTLAAESPLEDFIGSIGAVPSARLDHCGTQG
RERMSRIHEALKRAEQERAPIQSANEAKPSDSLLAEGAHRDGGEWSALGMVSPVGPGIESPNSHHLRLDELRRRCATPGW
KLNPDYAVFCKQSLAVCAEQFRTLRSRLYRLRDKQPVRTLLVTSAVPGEGKTFVSLNLALAIARQHERRALLIDGDLRAS
RLHVRMGAPSAPGLTEYLRGEADEFSIIQADSKDDLFFIPAGRSVLNPAELLADNRMKVLIDRMAPVFDWVIVDAPPVHP
VGDAGVLAGLCDGVIVVVRAKLTAYDLVQTTLQEFRGKNLLGVVLNGADEEATYGAYSYYAGYGMDRK
>gnl|bykdb|A0A2V9BLX2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=293 residues).
MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSSFKNSAPGMGASGDLGESRLGQCRKMKIPAVGKLLGQFGSGPALEA
AEESYRALRTRLLRARSAQGLRSVVVTSATPGEGKTLTSLNLSLCCAQLHDLRVLLIDADIRTSGLSRTLGFPPGPGLVD
VLSGKCEPRNAILATDIPNLYALGSGSHTTQPAELFASSHWQEFISWCSESFKLVLIDSPPVLNLTDVDLIAAACDGVVM
VVRAQHAKREVLQKCAGQIDPKKLLGVVYNAVESGAHDHYSYGGYTAARKEST
>gnl|bykdb|A0A2V9BTJ7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=306 residues).
MSRIHEALKKAAQERSAQLAAGTAPSFLEVADVPRTAVPLRELDEPTSPERSPAKGGSFLRYEDLIKGCARPIWKTDARM
SVFEGGDDGHVGAERFRTLRSRLYQIGGTRQLRRVVVTSSLPAEGKTFVAANLAQSIVRQPDRKVLLIDADLRASRLHQL
LGAPRSPGLSDYLLGMADEFRVVQKGSESNLCFIPAGSEAPNPSELLLNDRMKRLLDLMTPIFDWIIIDTPPALPVHDAS
MMADLCDGVLFVVRAGATDHEMATKAAAGFQDKNLLGVVLNRVDGDAGYGGYYYSYPSGEEVKKSS
>gnl|bykdb|A0A2V9BW09 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=260 residues).
SLALRGNEQLGPQLPASPGKHPVGFEDVKRVRWPMDSEKRIVAWADPHAIGAEKFRVLRYRLQHLRMARALSKVLVTSAI
PREGKTVVATNLAFTLARSSSHVLLVDADLRLSAVHQMLGIPPMAGLGEVLQGRLDVRAAIRRLDPSGLYYLPAGHPPPN
PAELLQSPRIQELLTQISSAFDWIVLDAPPVNLFADARHLANLADAVVLVLRVGVTPRESTQQVSAALDGAFIAGVVVNG
DVNPLQDRYYYSYYPRHKNA
>gnl|bykdb|A0A2V9C3F6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=300 residues).
MSRIHEALKKAEEQKPPAWRPTDPTPLNYVGESEVAAASGVLHSPRRGEMPATGRCLRLEELRQRCIKPGWRLNPDYDVF
STQQSSALCAEQFRTLRSRLYRLREKSPIRTLLVTSTLPGEGKTFVALNLALAIARQHERRALLIDADLRASRLHVRLGA
PSAPGLSDYLSGRADEFSILQADPKVELFLVPAGRSAPNPSELLANGTLKRFLDGMSPIFDWVIIDAPPVLAVADPSIIA
EFCDGVLVVVQAGETAHDLVKTTLQEFRGNNLLGVVLNGANEGTNYGGYSYYAGFGMDKK
>gnl|bykdb|A0A2V9CBY1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=346 residues).
MSRVYEALKNAQEQRTIRGPLEAEVTAQESSVGGPVHNGKTASRIREILSALTAEGAPPQEQRTIRGPLEAEATPQESSV
GGPVHNGKTASRIPEILSAVTAEVAPPARSLQLEELQQRCAKPGWKPQLRWNVFSNERSCKRQAEQFHTLRARLYSLRDT
RPIQTLLITSTIAAEGKTFVAMNLAQSIARQRGRRALLVDADLRASRLHIALGAPSAPGLSDYLAGESDESAVIQAGAQE
GLFFIPGGKPRSNPAELLANNKLRALFSRVLALFDWIIVDAPPALPVSDASVLSGMCDGVIFVVRAGMTAFDMAQAACGE
LRNKNLLGVVLNGVEEEAIYGAYGYY
>gnl|bykdb|A0A2V9D4I4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=318 residues).
MSRIHEAMQKAAQERAAAPATEIAPFPFDAEPAPERELKTVASASANGAVTETQISTSAAPSPEPLRFEDLQRQCTRSEW
RPDPRCTVFSNPALSTLCAEQFRTLRSRLYQLRASQRLGTILITSAVPGEGKTFVAANLAQAIVRQAERRVLIIDADLRS
SHLHRMLGAPAAPGLSDYLRGDANELAVTQSGQEGNLWFIPGGTNIANPSELLSNGRLKSLLDHMAPFFDWIILDSPPCL
PVMDANVVADLCDGLLFVVKAGSTPAEIAQRARQELGGRNLLGVVLNAVSEKALAYGSYYNHGYGNGRVKEPMKEKSD
>gnl|bykdb|A0A2V9D5W7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=318 residues).
MTRIHEALTKAGQEYPAAQAIDSLFQLDSTRPIESESKDAPPSGIGSPRRVNILAPAATDPLELDDLRKRCSYPEWSFDP
AVDVFSDQGRSALGAEQFRTLRSRLCQLRGNRPVRTILITSAVAGEGKTFVAFNLAQAIVRQPDQRVLIIDADLRCSRLH
GIFGAPNALGLSDYLGGRADELAIIQSGHEGNLYLIPGGTRIANPSELLANGRFKRLIERVAPLFDWIIVDSTPCLPVTD
ANIAANSCDGLLLVVKAYSTPAEIAQRARQELQDRNVLGVVFNSVQESIVSYGSYYNYPQNGHDEVKKTQAHRNKFRQ
>gnl|bykdb|A0A2V9D656 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=307 residues).
MSRVYEALKNAQDQQTIRGPLEAEATPQESGVGEPVHNGKAASRIPEILSAVRPEGAPPARLLQLEELQQRCAKPVWKPQ
LRWNVFPKERPCGRQAEQFHSLRARLYSLRDTRPIQTLLITSTTAAEGKTFVAMNLAQSIARQPGRRALLVDADLRASRL
HIALGAPCAPGLSDYLAGESDECSIIQADSQEGLFFIPGGKPRSNPAELLANNLLRALFSRVLPLFDWIIVDAPPALPVA
DASVLAGMCDGVIFVVRAGVAAFDMAQAACGELKHKNLLGVVLNGVEEEAIYGAYGYYYGGNGTGGE
>gnl|bykdb|A0A2V9D6L7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=315 residues).
MSRIHEAIQKAAQERSAAPATDFAPLPFDVELAPERKSVAPASVIGCVTPVSTSASTSAEPLEFDDLQRRCTRPRWRPEP
NSTIFSNPALSTIGAEQFRTLRSRLYQLRSSQPLRTILVTSAVAGEGKTFVVANLAEAIGRQRDRRVLIIDADLRASRLH
LMVGASAAPGLSDYLRGDIDEVAAIQSGQDSSLYLIPGGTKIANPSELLSNGRLKKLLDRVAPLFDWIIIDSPPCLPVAD
ANVVSNFCDALLFVVKAGSTPAEIAQRARHELEGRNVLGVVLNSVSEKGLAYGSYYNYRDHAHDPLKESTNRILD
>gnl|bykdb|A0A2V9DKV4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=263 residues).
MRTVGSRPYFQGRRNQTILGLNDLWQRCRKPGWTLDPTYSAFSNSKSFTSCAEQFSKLRTRLYEFRDNEPLHTLLVTSSL
PAEGKSFVSLNLALAMMRQHNRYVLLVDGDLRAPKLATCLGVPGAPGLTEFLQGAADASSIIQTDTEGKLFFISAGSAVS
NPTELLSTERLECFLRQMAALFDWVIIDAPPVLPVSDAIVLAGRCDGVIVVVRAGSTGYDVVSTALQELRGKKILGVVLN
RAEEKEATYGAYPYYGGNGMDKK
>gnl|bykdb|A0A2V9EVA0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=306 residues).
MSRIFEALQKIQSQQTPVVPGAETIPPEPVAFWTEQREEELRPTSSFAPSEPSPRPSLTSFAPGLNALRQRCAKPAWKLH
KDSLVLFNEQSFDRCAEQFRILRARLYRLREKKPFRTLLVTSAQAGEGKSFVSLNLARAIVHQHERHALLIDADLRAPKL
HVSLGTPSSPGLSDYLRGDADEFSIIQSGTGENLFFIPAGRPVSNPTELLGSTRAKSLFERLNTLFDWVIVDTSPVLPVS
DATVLAPMCDGVILVVGAGRTSSDLARTACQELRESRLLGVVLNGVEDDAVGSPYAYYGRSEHVRS
>gnl|bykdb|A0A2V9EY04 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=283 residues).
MSKFFNETQKANQWAQSKLPEPDRDVREMLESIKQGSILETATANAQLPQCQQVQVGNGNATHLVLRQDQSSKVALEAYR
ALRTRLMRAQSRAGVKTIAITSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDADLRTCGLTALLDHPCTLGLAEVLAGKA
TLEEAMVATNQKNFFVLPAGTISSPPPELFTGSHWQELLGRCSELFEVVLVDTPPIIPLADFELISVACQGVVMVVRARH
GQRETLQKSASSVDRKKLLGLVFNGTDANEKHYYGYKYAEAKA
>gnl|bykdb|A0A2V9G0N7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=300 residues).
MSRIHDALKKATEEKASQSPASPAQTFVDVREGISRFAQARNEVGTAPKNGSGNAVKQPCVRFEQLLKRCAHPKWTLDPA
RSVFGGPDSKKLGAEPFRTLRSRLSQIAGTHVLKRIVITSSVPAEGKTFVAANLAQSIIRQPDRRVLLIDADLRASRLHV
ALGAPSTPGLTDYLRGEVDEYAIIQSGPDENLCFIPGGNDVSNPSELLPSDRMRHLLDVVTPMFDFVILDSPPATPVHDP
IVLADLCDGVLFVVRAGVTDFEVAERAVAEFREKNLLGVVLNGAEQGAAYGEYYNHYTGR
>gnl|bykdb|A0A2V9G1P7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=700 residues).
PTIKELYELDAVSDAYLRTQYSILASESLARRAIDQLHLETLREFNSRKWWQLWPETRKPSTTQTFAVGPVPQVRDRELS
ERVLERFLDRLTIDPVNRSRLVAVRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAEWLSQQLVGVKAKLEKSED
ALQGYARHNGLVFLETDKGASQNVANERLQQLQEQLTKAQSERYEKEALYRLVQTGESGALPGVFENKLIQDLSERLAEL
KREHAQLSTTFNPDYPRVKEIQSQIDEIAASLREERQRAADRMVNDYSAAVRRENLVQQALDDQQKQVNLIAEKSVQYNI
LKREVDTNKQLYEGLLLQLKEAGVSASLKASNIRLVDSAQPPAKPVKPKILLNLAVAMFLGLGLGIGTALFQERMDNTLK
GDDDVERLFGLPSLALIPVVPPSDSDQHGIHRFLPRDKAFEFKGNGAGKNSHSYWHRIDRDETQHASLVEAFRNLRTSVL
LSTPDRPPSSLLVTSTQPAEGKTTVACNLAISLAQLGHRVLLLDADLRYPSLHKLFGTSGSLGLVSYLTGQQDWRAVVRP
SGSRGLDLLVCGPVPPNPSEMLSSQSMSALIRSASAEYGFIILDSSPMLALADSRILAPLVNGVLLVVKSGTTPREQFMH
AQSGIRGVGGNLIGVVLNNVDICTNGYYNYGPYGLNPDCPSHETVVTANFQMPPQQKASD
>gnl|bykdb|A0A2V9G7Y0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=277 residues).
MSKFFNETQKAHQWAQQKLVNQDLDVRQILASLKQGPANDAPPAGARLAHCRHVALGNGNAARLLLRQDDFLIAALEAYR
GLRTRLMHAQAKSGLRSIVITSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDGDMRTRGLTAMLDHPNSPGLAEILSGDV
GPDEAIVATNQKNLFILPAGTISSPSPELFTGTRWQEFLGQCGEMFKVILIDAPPIRPLADFELISAACDGIVMVVRAHH
GQRETLRKTASTVDKKKLVGVVFNATDVSVKDYDGYE
>gnl|bykdb|A0A2V9GAQ1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=751 residues).
MTEENKLVPRENGSLGGSDLLPVPIRLPVWELSPREPHLYDYLLILRKHQWLILSFLHRENANILPFQGTDSYDIMMDQD
NYIETQSKILTSETLALQTIRNNGLSARPEFSSPNGPSEAVALGSLANQKRPPELGQFLGSLTVKRVPNSHLMDVSFEST
DPQLAARIVNAHISSYIEQNFRSKYEATTRASTWLTDQLTELKIRVQKAEDARIAYERRNQIWTLDDKQNITSQRLGDIN
RQLTDAQSERMKKESLYQFAKSGNLDAIPQVQSNLALTELLKKRGEVSSDYTDALNQYGPNFPKVQRLQAQLKDYDLSIE
KEKKYILDVLESDYREAQQRESLLMQALDQQKTETNQMAEKLVEYNILKREAEANKTLYDGLMTKLKETAISQGLRSSNI
RVVDPEMIPSTPARPAKARNMVLAFLVGLVGGIGLALMREYLDNTVKTPDDVETHSRLPSLAVVPQFTGSNGSGKHHGPL
LGFSSNGHEKRMELVAHHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALPREGKTTAAANLAVTLAQLGDSTVIVD
ADLRKSGIGRLLNLASGNYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLPPNPADLLSSHRLVEAVAELRTKYKFI
IIDSPPIMAATDAVILSVQTDGVLLVVRSGETPKKAFTRTRDLLSSVKCRILGVVLNAVDSSAPDYYYSYRYYPYSYGYG
PQEAAEAPHEEDSEAIAHRVSRDRDDDSQAL
>gnl|bykdb|A0A2V9GQ44 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=300 residues).
MSRIHDALKKAAEEKASQSPASPAQTFVDVREGISRFAQARNEVGTAPKNGSGNAVKQPCVRFEQLLKRCAHPKWTLDPA
RSVFGGPDSKKFGAEPFRTLRSRLSQIAGTHVLKRIVITSSVPAEGKTFVAANLAQSIIRQPDRRVLLIDADLRASRLHV
ALGAPSTPGLTDYLRGEVDEYAIIQSGPDENLCFIPGGNDVSNPSELLPSDRMRHLLDVVTPMFDFVILDSPPATPVHDP
IVLADLCDGVLFVVRAGVTDFEVAERAVAEFREKNLLGVVLNGAEQGAAYGEYYNHYTGR
>gnl|bykdb|A0A2V9GQV7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=228 residues).
NGNAARLVLREDGSLNAALEAYRGLRTRLMRAQSKSGLHSIVITSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDGDMRA
HGLTSMLDHPNSPGLAEILSGDVAPDEAIVATNQKNLFILPAGMVSSPPPELFAGTRWQEFLGHCGEMFKVILIDAPPIL
PRVDFELISAACDGIVMVVRAHHGQRERLQNTASTLDRKKLLGVVFNATDVSAKDYHGYEYGYGYGKD
>gnl|bykdb|A0A2V9H7U2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=447 residues).
LKTQNVDALEQYGPKHPKVERLRSQVNEIQSLIDTERKRMVERLRNDYVAARGREKLLAAAVAKEKVGVGALSQLLIQHN
LLKREFDTNQQLYDSLLQRLKDATVSAGLRATNIHLVDPARPPKVPVRPQKLYNIAVSIAVGLILGVMLAFVKEALDSSI
KSIEEAERVVNAPALAVVPLEREIPHRAARSLTRNNGTSKPGDAELALLKQPSSALAESFRTLLTSVVLSTAPRPPQVLL
ITSATAREGKSTTALNLAIALAQRGDSTLIIDADLRRPGIAESLDIDDGEGLASFLTGAHSIEAALRQFSPVPTLWVLPA
GPKPPNPAQLLSSSAMESLLKELRQRFKFIVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTARGAVVRARRVLENAGAR
ILGLVLNKVDVRHNGYYGYYGHYYYSSGSGKTKRTPASESVSSHLQG
>gnl|bykdb|A0A2V9HAK9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=250 residues).
ESLKQGPPINAPPAEARLARSRQVTLGNGNATRLVLRQDDSLDAALEAYRGLRAKLMRAQSKSGLRSIVITSSLPGEGKT
LTTMNLGLCYAQLPQQRVLVIDGDMRTRGLTSMIDHPSSPGLAEILSGDVAPDEAIVATNQKNLFILPAGTVSSPSPELF
IGTRWQEFLGHCGEMFKVILIDAPPILHLADFELISAACDGIVMVVRAHHGQRETLQKTASTLDTKKLLGVVFNATDVSV
KDYDVHEYGY
>gnl|bykdb|A0A2V9HB55 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=662 residues).
KILTSETLALQTIRNNGLSARPEFSSPSGPSEAIAVGSLANQKRPPGLGEFLGSLSVKRVPNSRLMDVSFESTDPQLAAR
VVNAHIASYIEQNFSSKYEATTRASAWLADQLTELKIKVQRAEDARIAYERQNQIWTLDDKQNITSQRLSDINKQLTDAQ
SERMKKESLYQFAKSGNLDAVPQIQSNLALTELLKKRSEVSSDYTDALNQYGPNFPKVQRLQAQLKDYDQSIEKEKKNIL
AVLESDYREAQQRESLLTQALDEQKAETNHMAEKLVEYNILKREAEANKTLYEGLMTKLKETAISQGLRSSNIRVVDPAM
IPSTPARPAKTRNLALAFLVGLVGGIGLALLREYLDNTVKTPDDIETLARLPSLAVVPQFTGSNGHAKKRGLLQGPAANG
HEMRIELAAQHLPKSQMSEAFRALRTSILLSRADHPPQVILVTSALPREGKTTAAANLAVTLAQLGDSTVIVDADLRKPG
IGRLLNLGGGKYAGLSSYLAGVSSLDLVCVPHPTIANLVAIPTGPLPPNPADLLSSHKLADGITELRTKFKFIVIDSPPI
MAATDAVILSVQADGVLLVVRSGETPKAAFTRTRDLLNSVKCRILGVVLNAVDSSAPDYYYSYRYYPYSYGYGPQEVVEA
PHEEDSEAVTERVSRDDDSEAL
>gnl|bykdb|A0A2V9HRN3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=298 residues).
MSRIHDALKKAAEERASKSPASAAQTFVDVTEGISRFAQARNEVGTAPKNGTSTAVKQPCVRFEQLLKRCAHPKWTLDPA
RSVFGGTDSKKFGAEPFRTLRSRLSQIAGTRVLKRIVITSSVPAEGKTFVAANLAQSIIRQPDRRVLLIDADLRASRLHV
ALGAPSTPGLTDYLRGEVDEYAIIQSGPDENLCFIPGGKDVSNPSELLPSDRMRHLLDVVTPMFDFVILDSPPASPVHDP
IVLADLCDGVLFVVRAGVTDFEVAERAVAEFREKNLLGVVLNGAEQGAAYGEYYNHYT
>gnl|bykdb|A0A2V9I4J1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=437 residues).
MEASAVQPLLAESRRQGVPIGEAALRSKLLEPAELADVIRRQAFQLLRHALEKQFSVQSFQVSATGFSVPAQIHFENLLL
EVARGDSKPFQVYPWQLVVMNNGKDLTHLPWYPQELSVLSELRRSRTLQDLATATGLEYVRLTKILDVFRKLQVVDIVDE
ETGQDDTKGSAAVGGQSRFPFEHLIPEISNAVLSEKLEVLKNEFSFVSEQFKALKVRINETQADHAVQTIAISSPRPQDG
KSLIAVNLAFCLAQDLDRRVILVDGDLRNPTVNRYLGVSVEPGLSGYLENGHLQPYCYMRRFKNLYIMTAGGVCTNPVEL
LSQDKMRELIQYLKTEFDTIIFDAPPFAPIPDARIIMGLSDGLVLVVRRGKTPFSAIEKAFKVLDRKKLLGIVFNDVKPM
LLHTHYDHGYYRYGKQGAYPYYGTRKPRSRSKTYLEN
>gnl|bykdb|A0A2V9J901 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=237 residues).
MAPAIQTHAEVLEAFRSLRTSILLSASPVPRVILITSALPGEGKTTTAVNLGAALASFGSKVVVIDCDMRRPSCHRSVGV
KNSPGFVQCLTGHVELAEAVLPAPGVPNLSVIPCGPIPPNPAEVLSSSLAAESLRKLRADFDYVLVDSPPLLSVADGRIL
ATMVDGAVLVARAFETPYDLVCRARSLLYGAGARILGVALNDVDLRREGYGHNGSYGYSYTGYGAPGSEASSRHGNT
>gnl|bykdb|A0A2V9JMM3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=742 residues).
MQLTEVAKGASILAILDAARRRKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVERPPASDLLKMGGTPGPPGIQEQL
RVIRETLFARPLLQEVLKEFTLYGPATDPDWATEDMKKRIRIQVEGTDAFYIGFEDGDRQAVAEVANRLAELFVKSTSAS
QEQNVEEAAGLLDQELARLRDKLADEDEEIKEYKQKVGEELPEHLGTNLKLVEALEMRLQAKRDSIGENQARRAQVLEEM
KGLQKEPAQEIQRELPVEEPTAEQKALDEKRLKLKELEAKYTEQYPEIPRLRKEIADLEQAVAAGPRRKSRSDATAATSR
RYPGPDASMRYLALKGELEGIDQRLRSYAPEEKALQAEIASLRQRVASAPKHERALAEMTREQALTRSQYQGLLEKQNEM
KMAERLRQKGQSLVFKVVEPASVPSAPSSPKRERILLLGFVGSLGLGVVLAFLVEQLDTSFDSADDFKTFTNLPLLAVIP
SVRSKSRSGRKLPEGGKGDPHLPQPNLRHLQKNRVVTVTDPGAIASEQYSILAMKLRWHLGEAPSRVLTVTSASGGEGKT
LTAVNLSFALAESGLGKVLLLDADLRKPRTHEYLGIEPRPALSNLLQDPERDIYREAVRLKDLFVIPGGSDFENPVGVLG
SERMRRLVERLRLEFRFIVLDAPPILPIADPQVLAGYADGVLLVVRARRTRRELFKHAIESFRATNVLGVVLNGADYAGS
RYARAYEYYRRTYYKQNIRTGT
>gnl|bykdb|A0A2V9JMZ4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=498 residues).
MTVQLLLDHIRPILEGSKDGTLLLGNQSEIIKVFCRQGLIEAVSSNLEQYHLGQHLVTEGFMEASAVQPLLAESRRQGVP
IGEAALRSKLLEPAELADVIRRQAFQLLRHALEKQFSVQSFQVSATGFSVPAQIHFENLLLEVARGDSKPFQVYPWQLVV
MNNGKDLTHLPWYPQELSVLSELRRSRTLQDLATATGLEYVRLTKILDVFRKLQVVDIVDEETGQDDTKGSAAVGGQSRF
PFEHLIPEISNAVLSEKLEVLKNEFSFVSEQFKALKVRINETQADHAVQTIAISSPRPQDGKSLIAVNLAFCLAQDLDRR
VILVDGDLRNPTVNRYLGVSVEPGLSGYLENGHLQPYCYMRRFKNLYIMTAGGVCTNPVELLSQDKMRELIQYLKTEFDT
IIFDAPPFAPIPDARIIMGLSDGLVLVVRRGKTPFSAIEKAFKVLDRKKLLGIVFNDVKPMLLHTHYDHGYYRYGKQGAY
PYYGTRKPRSRSKNYLES
>gnl|bykdb|A0A2V9K0H7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=293 residues).
MSRLHEALKKAEQQKTENGSPLDLERPTVIPGDGKGVAVLPPAELPSGAAELRVLLMERCSQSLWNPDRKMMLFFDRRNP
VVGVEEFRTLRSHLSLIREQLPLQSLLVTSPLPSEGKTVVAANLAQVLVQQREQRVLLVDSDLRYSRMHLSLGASRSPGL
SDYLSGAKDELAILQRGPLENLFFIAGGKAASNPTELIGNGRLRLLLRRLCPAFDWIIMDSPPVIPVSDAKLLAEYLDGV
LIVVQSDATPHDLARKACQEFASKKIVGVVLNRVKPEYSYGSQYYATTPETKK
>gnl|bykdb|A0A2V9L2P7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=372 residues).
MNQLLIEHNLLKRDFDSNQALYESLLQHLKDANVSAGLRATNIHFIDSAAVPTVPVRPQKGRNIAFAMAVGLALGMGLAF
VREALANSIKGAQEVENLIAAPALAIVPDVSSSVTRSGLFAKRSEVKAKKAEMVELSVLKNPGASISEAFRTLRTSILLS
TAERPPQLLLVTSAQPHEGKTATSLNLAFTLAQMGSRALVVDADLRKRRIARALQMSNEKGLSGILTGGYGLQEALLRVE
DIEGLWVLSSGPNPPNPAELLCSTKMQELLKQMRERFDHVIVDSPPVLPITDATILSSRVDGVIMVVENEVTTRATLSRA
CSVIRHSGGKILGAVVNKVDARRDGYYGHYHYYGYYSKGYYDYAEGKGNGQG
>gnl|bykdb|A0A2V9LS17 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=316 residues).
MSRIHEALKRAEQEMEGRSIPSVGTQIAELAEAGTAVPEKLPQSATGIEPAALSELEEPGSDLTLEVLESQVRRFKWNPN
VKTMLFFGEENYALGTEEFRTLRSHLFGLNETSATRSLLVTSASPREGKSFISSNTAQILARQPDKRVLLIDADLRWSRL
HLFLGTPAVPGLAEYLSGEANELSVIQRGPLENLYFIPGGKHPANPAELVSNGRFKNLLRRLSPVFDWIVVDTPPAIAVS
DAQVLAAACDGVLLVVAAGSTSCEASQKTRDQFKGRRVLGVVLNRVDPRGSSSYKYYDYYRGAAENANGKGRRAKT
>gnl|bykdb|A0A2V9M815 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=742 residues).
MQLTEVAKGASILAILDAARRRKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVERPPASDLLRMGGTPGPPSIQEQL
RVIRETLFARPLLQEVLKEFKLYGPATDPDWATEDMKKRIRIQVEGTDAFYIGFEDGDRQAVAEVANRLAELFVKSTSAS
QEQNVEEAAGLLDQELARLRDKLADEDEEIKEYKQKVGEELPEHLGTNLKLVEALEMRLQAKRDSIGENQARRAQVLEEM
KGLQKEPAQEIQRELPVEEPTAEQKALDEKRLKLKELEAKYTEQYPEIPRLRKEIADLEQAVAAGPRRKSRSDATAATSR
RYPGPDASMRYLALKGELEGIDQRLRSYAPEEKALQAEIASLRQRVASAPKHERALAEMTREQALTRSQYQGLLEKQNEM
KMAERLRQKGQSLVFKVVEPASVPSAPSSPKRERILLLGFVGSLGLGVVLAFLVEQLDTSFDSADDFKTFTNLPLLAVIP
SVRSKSRSGRKLPEGGKGDPHLPQPNLRHLQKNRVVTVTDPGAIASEQYSILAMKLRWHLGEAPSRVLTVTSASGGEGKT
LTAVNLSFALAESGLGKVLLLDADLRKPRTHEYLGIEPRPALSNLLQDPERDIYREAARLKDLFVIPGGSDFENPVGVLG
SERMRRLVERLRLEFRFIVLDAPPILPIADPQVLAGYADGVLLVVRARRTRRELFKHAIESFRATNVLGVVLNGADYAGS
RYARAYEYYRRTYYKQNIRTGT
>gnl|bykdb|A0A2V9MDJ6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=498 residues).
MTVQLLLDHIRPILEGSKDGTLLLGNQSEIIKVFCRQGLIEAVSSNLEQYHLGQHLVTEGFMEASAVQPLLAESRRQGVP
IGEAALRSKLLEPAELADVIRRQAFQLLRHALEKQFSVQSFQVSATGFSVPAQIHFENLLLEVARGDSKPFQVYPWQLVV
MKNGKDLTHLPWYPQELSVLSELRRSRTLQDLATATGLEYVRLTKILDVFRKLQVVDIVDEETGQDDTKGSAAVGGQSRF
PFEHLIPEISNAVLSEKLEVLKNEFSFVSEQFKALKVRINETQADHAVQTIAISSPRPQDGKSLIAVNLAFCLAQDLDRR
VILVDGDLRNPTVNRYLGVSVEPGLSGYLENGHLQPYCYMRRFKNLYIMTAGGVCTNPVELLSQDKMRDLIQYLKTEFDT
IIFDAPPFAPIPDARIIMGLSDGLVLVVRRGKTPFSAIEKAFKVLDRKKLLGIVFNDVKPMLLHTHYDHGYYRYGKQGAY
PYYGTRKPRSRSKNYLES
>gnl|bykdb|A0A2V9N406 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=310 residues).
MSRIHEALKKAEEQRAASQGGNIEPASISEMVNESAATAVAPAVEHTPSAVSAVPSFSSPFTFDTLLASCAQARWSPDSK
TMLFFNSDDEQGYGMEEFRTLRSRLYQMREKQSLKKVLVTSSLPKEGKSFVAANLAQVMVRQQGRRALLIDGDLRGPRLH
QVLGTASSPGLSEYLLGEVDEFGAIQRGPMDNLFFIPSGRTVSSPAELVANGRLKFLLNRIEPLFDWIIIDSPPAVPVSD
AGLLANYCDGVLIVVRSNATPFDIARKARQEFRDTSLVGVVLNGIDVGSSYTQYYYSSYGHPNSQGDGRR
>gnl|bykdb|A0A2V9NLA9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=315 residues).
MSRIHEALKKAEEQRSAEHEMHIEPPLASAPEVVPDPISMPVAAVPPLADERDRRTVSAAMPSFGTGLSVESLLSRCVAG
HWTPDRKTMLFFNGDEQGYGTEEFRTLRSRLYQLRDRLPLKKVLVTSALPKEGKSFVAANLAQVLVQQQGRRTLLIDGDL
RGARLHNALGTESSPGLTEYLLGEADEFAILQRGPMDNLFFIPCGRKVTSPAELVANGRLKTLLNRLEPLFDWMVLDSPP
AVPVSDAGLLANYCDGVLMVVRSNSTPFDMARKARQEFSGKQLVGVVLNGIDQGNSYSQYYYDAYGKPNGKNEQR
>gnl|bykdb|A0A2V9NPF4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=301 residues).
MSRIHEALKKAEQERAMSQSPGAIETAPAVLEAPLETTPFLRSEPTEARFASGGIAESLLARSRQTAWNPDLKSMLFFSG
EEHGSGMEEFRTLRTRLYQIREKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGKRALLIDADLRCPQLHVLVGAEP
GPGLSEYLASESDEFSILQRGPMENLFLIAAGHRSQNPAELLANGRMKFLLERLQPIFDWIIIDSPPAALVSDAGLLARY
ADGVLLVVRSNTTPADAARKARQEFADHNLVGVVLNGITPELSPYSQYYYSVYSEDGKAKG
>gnl|bykdb|A0A2V9PNZ0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=301 residues).
MSRIHEALKKAEQERAMSQSPGAIETAPAVLEAPLETTPFLRSEPTEARFASGGIAESLAARSRQTAWNPDLKCMLFFSG
EEHGSGMEEFRTLRTRLYQIREKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGKRALLIDADLRCPQLHVLVGAEP
GPGLSEYLASESDEFSILQRGPMENLFLIAAGHRSQNPAELLANGRMKFLLERLQPIFDWIIIDSPPAALVSDAGLLAKY
ADGVLLVVRSNTTPADAARKARQEFADHNIVGVVLNGITPELSPYSQYYYSVYSEDGKAKG
>gnl|bykdb|A0A2V9PTS3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=301 residues).
MSRIHEALKKAEQERAMSQSPGAIETSPAVLEAPPETTPFLRSEPTEARFASGGIAESLLARSRQTAWNPDLKCMLFFSG
EEHGSGMEEFRTLRTRLYQIREKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGKRALLIDADLRCPQLHVLVGAEP
GPGLSEYLASESDEFSILQRGPMENLFLIAAGHRSQNPAELLANGRMKFLLERLQPIFDWIIIDSPPAALVSDAGLLAKY
ADGVLLVVRSNTTPADAARKARQEFADHNIVGVVLNGITPELSPYSQYYYSVYSEDGKAKG
>gnl|bykdb|A0A2V9Q1Y8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=409 residues).
MIRKSRARPRKSAAVCVVIIWQPXXXEQKQQENKLNESAIEFSLLKRDFETNRTLYEGLLQKLKEAGVTAGLRSNNIRQV
DIARTPAGPAEPNIPRNLGFALALGLTSGIGLAFLLEGIDNTVRTPEQAQLISGLPSLGMIPLGSRTAAEANPTGLSVAA
SKEAVELITISRPQSQMSESYRALRTSLLLTSLGAPPKTILITSALPQEGKTTTSINTATVLAQKGTRVLLIDADLRRPS
IHKTLGMGPRAGLSNVLTGGTTLQQATVRSTLLPNLFILPAGTPPPNPAELLASSQMLDLLAELREQYDHIIVDTPPTLS
VTDAVVLSTRSDAVVLVIRSGQTTKPALRRSRDILAQVNARVAGVLLNAVDLDSPDYYYYYEYQGKYGQRYYDEDMTGGD
SVRAASGSA
>gnl|bykdb|A0A2V9QMU9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=329 residues).
MARVPIEPAEPDVPRNLSFALVLGLTTGVSLAFLLEGIDNTVRTPEQAQAISGLPSLGIIPDGSKLSIESSARRRLSLTS
SREAIELVTQSRPQSQMAEAYRALRTALLLSSVGAAPKVVVVTSALPSEGKTTTSINTAIVLAQKGNRVLLVDADLRRPS
IHKTLGMGPRTGLSSVLTGSANVQQTIVRSALLPSLFILPAGPPPPNPAELLSSGNMKKVLDELREQYDHIVVDTPPTLS
VTDPVILSTRADAVVLVIRSGQTTRQALRRARDILLQVNAHATGVLLNAVDLNSGDYYYYEYQGKHGQRYFGQDEPAIAE
EAKATSSGA
>gnl|bykdb|A0A2V9QY75 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=350 residues).
QKLKEAGVTAGLRSNNIREVDIARTPGAPAEPNIARNLVFAFALGLSSGIGLAFLLEGLDNTVRTPEQAQAISGLPSLGM
IPLGSKIGAEAGAKQGLVVASSKEPVELITQARPQSQMAESYRALRTSLLLTSLGAPPKIILITSALPREGKTTTSVNTA
IVLAQKGTRVLLIDADLRRPSIHKALGMGPRVGLSNVLTGGATSQQATVRSPILPNLFILPAGTPPPNPAELMASQQMFD
LLAELREQYDHIVIDTPPTLSVTDAVVLSTRSDAVVLVIRSSQTTKPALRRTRDILTQVNARVAGVLLNAVNLNSPDYSY
YYEYQGKHGQRYYDESQTDENSIAAASGGA
>gnl|bykdb|A0A2V9R269 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=301 residues).
MSRIHEALKKAEQERAMLHPSQRVEMPAVLETPEMPAGAVAGAVGRGIPGMATGMEALMTRSRETRWSPDPKKMLFFGTE
EHASGMEEFRTLRSRLYQAREKQPLSKLLITSALPKEGKSFTTANLGQVMVRQHGRRVLLIDADLRNPQLHNQFGAEIGP
GLGDYLRDEADEYSIIQRGSMENLFLIPAGRISPNPAEMLSNGRIKTLLHRLEPLFDWIIIDSPPAVPVADAAMLANHCD
GVLLVVRSNSTPIDAARRARAEFTGRNVVGVVLNGITAEMSPYMQYYYSAYSPNVRTEDKN
>gnl|bykdb|A0A2V9RKJ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=315 residues).
MSRIHEALKKAEEQRSAEHEMHIEPPLASAPEVVPDPVSMPVAAVPPLADERDRRTVSAAMPSFGTGLSVESLLSRCVAG
HWTPDRKTMLFFNGDEQGYGTEEFRTLRSRLYQLRDRLPLKKVLVTSALPKEGKSFVAANLAQVLVQQQGRRTLLIDGDL
RGARLHNALGTESSPGLTEYLLGEADEFAILQRGPMDNLFFIPCGRKVTSPAELVANGRLKTLLNRLEPLFDWMVLDSPP
AVPVSDAGLLANYCDGVLMVVRSNSTPFDMARKARQEFSGKQLVGVVLNGIDQGNSYSQYYYDAYGKPNGKNEQR
>gnl|bykdb|A0A2V9RN95 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=256 residues).
MPSFASPFTFDALLARSAQARWSPDSKTMLFFNSDEQGYGMEEFRTLRSRLYQMREKQSLKKILVTSSLPKEGKSFVAAN
LAQVMVRQQGRRALLIDGDLRGPRLHQVLGTASSPGLSEYLLGEADEFGAIQRGPMDNLFFIPSGRTVSSPAELVANGRL
KFLLNRLEPLFDWIIIDSPPAVPVSDAGLLANYCDGVLIVVRSNATPFDIARKARQEFRDTSLVGVVLNGIDVGSSYTQY
YYSSYGHPNSKGDGRR
>gnl|bykdb|A0A2V9RTW2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=308 residues).
MSRIHEALKRAEEQRAASQGGQVPSSQTPEAVLSDTPTEAQVVASPSTGVAPPSFAAPFTFDTLLARASQHDWTPDTNTM
LFFKAEEQGFGTEEFRTLRSRLYQMREKQALKKVLVTSALPKEGKSFVAANLAQVMVRQHGRQALLIDADLRGARLHHLL
GTSATPGLAEYLLGENDEFGIMQRGAMENLFFIPSGRSVSNPAELVANGRLKILLNRVEALFDWIIIDSPPAVPVSDASL
LANYCDGVVMVVRSNATPVDMARKARQEFRDKHLVGVVLNGIEADSSPYNQYYYGAYGRPDAKGATQR
>gnl|bykdb|A0A2V9S1P8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=311 residues).
MSRIHEALKKAEEQRVASQGGRPVEPVQPADAAVAEPLAATPPAPQGTTASVGASIPSFGSPYTLDTLLARCPQGRWSPD
RKTMLFFNPEEQEYGNEEFRTLRSRLYQIREKQSLKKVLVTSALPKEGKSFVAANLAQVMVRQEGRRALLIDSDLRGSRL
HEALGTSSSPGLSDYLLGEKDEFAVMQRGSMENLFFIPSGRSIGNPAELVANGRTRFLLNRVEPLFDWIIIDSPPAVPVS
DAGLLANYCDGVLMVVRSNATPFDVARKARQEFRDKHLVGVVLNGVSTESSYTQYYYATYGRTNGRHESQG
>gnl|bykdb|A0A2V9SVU9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=429 residues).
MNSQMKEVDAQIQVEMKKIVSRVRSDYLAALQRETMLRAALDKQKQEANKLNESAIDYSLLKRDVETNRTLYEGLLEKLK
EAGVTAGLRSNNIRPVDEARVPMYPAEPNVPRNLSFALALGLTTGVGLAFLLEGIDNTVRTPEQAQALSALPSLGLIPLG
LKAGVEMSMKQRLSVASSKEVVELITQSRPQSQMAESYRALRTSLLLTSLGAPPKVILITSALPQEGKTTTSINTAIVLA
QKGVRVLLIDADLRRPSIHKTLGMGPKTGLSNVLTGNATLQQATVRSSILPGLFILPAGTPPPNPAELLASSNMKDVLAE
LREQYDHIVVDTPPTLSVTDAVVMSTRADAVVLVIRSGQTTKQALRRSRDLLMQVNARIAGVLLNAVDLNSPDYYYYYEY
QGKYGHRYYREEEMDNGGASLPSVRAGSA
>gnl|bykdb|A0A2V9TGF1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=308 residues).
MSRIHEALKRAEEQRAASQGGQVPSSQTPEAVLSDTPTEAQVVASPSTGVAPPSFAAPFTLDTLLARASQHDWTPDTNTM
LFFKAEEQGFGTEEFRTLRSRLYQMREKQALKKVLVTSALPKEGKSFVAANLAQVMVRQHGRQALLIDADLRGARLHHLL
GTSATPGLAEYLLGENDEFGIMQRGAMENLFFIPSGRSVSNPAELVANGRLKILLNRVEALFDWIIIDSPPAVPVSDASL
LANYCDGVVMVVRSNATPVDMARKARQEFRDKHLVGVVLNGIEADSSPYNQYYYGAYGRPDAKGATQR
>gnl|bykdb|A0A2V9TMX2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=695 residues).
MYQATSKVAIFPEVPNVLGFKDAENIAPDYEYEATLETQVAILRSDALALKVIEGMRLYQDPRFTAVKQSSPESPMGEPS
MQPDPVQAAGLLGAFRGGLSVQPVPSTRLIQVSYTHSDPRFATEITNALVKTFIEENFRTKYNSASQTSEWLGKELADLQ
LKVQTSEEKLVRYQKDHGILGVDEKQNIVTEKLGELNKELTEAETDRIQKEADYKLAVNGDPEMFMKTSPDGRGGSGLLD
KLREKEADLETQYAMATTQFGSGYPRVTELNNQLKQVRAAIEAEKTKLQQKMRDDYLAALQRENLLDSAFNKQKQEANKL
NESATIEYTVLKRDAETNRQLYQDLLQRLKEAGVSAGLRSSNIRIVDIARVPTQPISPNVHRSLVLGFLLALGLGVGLAL
VRETFDSTVRSMEEVRAVSTLPALGTIPLQLVTDERFRKRRLTISPDGERSGMLALVTYERPKSEAAEAYRALRTSILLS
SFGAPPKVILVTSAMPREGKTTISANSALVLAQRGSRVLLVDADLRRPGVEKLFGIRAHGGLSTLISGSSNAEEVILPSS
EVPNLWILPAGPIPPQPTELLGSTVMKDYISRWRNEFDHIIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTRPALRRA
CDLLLQVNARVMGIVLNALNLHSVEGYYYYGTQYSNNYYSEESPNNKPKAASKIS
>gnl|bykdb|A0A2V9U6D9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=310 residues).
MSRIHEALKKAEEQRAASQGGSIEPAPIAEMVNDPAATAVAPAVEHTPSAVSAMPSFSSPFTFDTLLARCAQARWSPDSK
TMLFFNSEDEQGYGMEEFRTLRSRLYQMREKQSLKKILVTSSLPKEGKSFVAANLAQVMVRQQGRRALLIDGDLRGPRLH
QVLGTASSPGLSEYLLGEVDEFGAIQRGPMDNLFFIPSGRTVSSPAELVANGRLKFLLTRVEPLFDWIIIDSPPAVPVSD
AGLLANYCDGVLIVVRSNATPFDIARKARQEFRDTSLVGVVLNGIDVGSSYTQYYYSSYGHPNSQGDGRR
>gnl|bykdb|A0A2V9UEM7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=299 residues).
MSRIHDALKRAEQERATSMGGQLEPALEQPELQPVGMPEHAHMQTAVMPPIQGSSFSYESLLARCPVSNWNPDTRTMLFF
QEDENRKGAEEFRTLRSRLYQIREKLPLKRLMVTSALPKEGKSFVAANLAQVMVRQHGRRVLVIDADLRSPGMHRHLGAS
QTPGLSEYLMGECDEFAIMQRGPMDNLFFVPAGRQATGAPELLANGRLKLFLQRVEPLFDWIILDTPPVIPVADSTLLAN
FCEGVLMVVRSNSTPSDLARRAREEFQDKLLLGVVLNGIPADQLPKSRYYYGEAVSSPA
>gnl|bykdb|A0A2V9VC62 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=318 residues).
MSRIHEALKRAEQERAASQGGRVDSAPVMDLPASPEPLPGMAEAADATRTAPTAPIPGAPGNGQKVPSFATSFTFDTLLA
RSAQADWKPDPTTMLFFSQEDNALGTEQFRTLRSRLYQLREKISLKKILITSALPQEGKSFVAANLAQVLVRQHGRRVLL
IDGDLRVARLHTALGTTSSPGLADYLLGESDEFSIMQRGPMENLFFLPCGRTVAHPAELIANGRLKMLLQRVEPLFDWII
LDSPPAVPVSDASQLANFCDGVLMVVRSNATPYDTAQKARQEFQGKTLVGVVLNGITRGDSYSRYYYEAYEKTAKPKA
>gnl|bykdb|A0A2V9VQW5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=314 residues).
MSRIHEALKRAEQERAASQGTRTDGTPVMDLPATESVPAMPETAQASKAAAPGTPGNGQGTPSFTTSFTFDTLLARCAQG
EWKPDEKTMLFFNPEENALGTEQFRTLRSRLYQMREKASVKKILVTSALPQEGKSFVAANLAQVLVRQHGRRVLLIDGDL
RVARLHSALGTTSSPGLADYLMGESDEFSIMQRGPMENLFFVPCGRTVTHPAELIANGRLKMLLQRVEQLFDWIIVDSPP
AVPVSDASQLANFCDGVLMVVRSNATPYDTAQKARQEFQGKLLVGVVLNGIMRSDSYYSRYYYESYEKTARQKA
>gnl|bykdb|A0A2V9VR38 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=276 residues).
MFGHDPARFQVSPRGAQSQTVGDRYLQGSRRTRHPSQAAVPNGGVLPRSAYFPAAVEFRRSAQGYPQEGKTTTSINCAVV
LAQKGVRVLLIDADLRRPSIHKTLGMGPHSGLSNVLTGSTTTEQAITRTTILPNLFVLAAGTPPPNPAELLASTNMRDLL
AQLREQYDHIVIDTPPSLSVTDAVVLSPRADAVVLVIRSGQTTKQALRRSRDVLTQVSANVVGVLLNAVDLSSPDYYYYY
EYQGKYARYYREDDSSEHDHDEEHAVEESSPSSSSA
>gnl|bykdb|A0A2V9WCB3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=309 residues).
MSRIHEALKKAEQERAATQAMAVPPPMAAMPMSEQPVFADTPPVPAMPASMGLGMPTFGGGLNMDTLLARCPRTEWTPDP
GSMLFMNGDDHARGTEEFRTLRSRLYHLREKMTLRTVLVTSALPKEGKSFTSANLAQVLVRQHGRRVLLIDADLRGPRLH
LMLGTPMGPGLSDYLQSKNDEFSIIQQGPMENLFFMPSGSGIEDPSELIANGRLKMLLQRLEPLFDWIIVDSPPAIPVSD
ASVLAKACDGVLMVVRSNATPSDAARRARQEFPENALVGFVLNGTSEENAPYARYYYEAYENKGTATKA
>gnl|bykdb|A0A2V9WTP3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=317 residues).
MSRIHEALKKAEQERAASQGGPVPSNFSGAESPVTEPRVIDADTAARVAAVAPAVSAHASPGLPPFGSPFSLETMLARCA
AVQWSPDPKTMLFLNGDDNARGSEEFRTLRSRLYQIREKMTLKKILVTSALPKEGKSFTAANLAQVMVRQHGRRVLLIDA
DLRGPRLHLMLGTSSAPGLSDYLQGANDEFSIMQRGALENLLLIPSGCEVSNPAELVANGRLKFLLQRVEPLFDWIIIDS
PPAVPVSDASLLANSCDGVLMVVRSNATPVDMARKARQEFPDKVLVGVVLNGTSADTEAYSRYYYGAYEKRGTEAKA
>gnl|bykdb|A0A2V9X518 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=282 residues).
MDVPAVEAAGMPPVIERAPLSTAASAAAAGPAFSNAFTFDTLLARCAQSEWNPDPKSMLFFNDDERKYGAEEFRTLRSRL
YQMREKMPLKKVLITSALPKEGKTFVAANLAQVMVRQHGRRALLIDADLRGARLHQALGTSSTPGLSEYLLGESVQRGPM
ENLFFIPSGRTVSNPAELVANGRLKFLLTRVEPLFDWIIIDSPPTVPVSDSSLLDNFCDGVLIVVRSNTTPFDMARKARL
EFQDKHLIGVVLNGIEADSSPYSRYYYGVNGNNKEMQETVQG
>gnl|bykdb|A0A2V9XEV6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=315 residues).
MSRIHEALKRAEQERAASQGGHVESLHPMDVPAVEAAGMPPVIERAPLSTAASAAAAGPAFSNAFTFDTLLARCAQSEWN
PDPKSMLFFNDDERKYGAEEFRTLRSRLYQMREKMPLKKVLITSALPKEGKTFVAANLAQVMVRQHGRRALLIDADLRGA
RLHQALGTSSTPGLSEYLLGESDEFSVMQRGPMENLFFIPSGRTVSNPAELVANGRLKFLLTRVEPLFDWIIIDSPPTVP
VSDSSLLANFCDGVLIVVRSNTTPFGMARKARLEFQDKHLIGVVLNGIEADSSPYSRYYYGVNGNNKEMQETVQG
>gnl|bykdb|A0A2V9XV04 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=368 residues).
MSRIHEALKKAEQERASTQGERVPSSYATTPVADVPGYDDIEVNRVPPSLGMPELGGPSSLEMLLGRCPQPGWNPDLQTM
LFMNGNDSAKGTEEYRTLRSRLYHIREKMPLKKLLVTSALPKEGKSFTSANLAQVMVRQHGRRALLIDADLRGPRLHQML
GAPKGPGLAEYLLGKADEASVIQRGPMEGLFFMASGESIEDPAEMVASSRLKVLLQRIEPVFDWIIIDSPPAIPVSDASV
LAKACDGVLMVVRSNSTPSDVARKARMEFPDQMLVGVVLNGTDRDEAEYARYYYESYEKKPALPSVLPASRSCAAGGRGP
DCLVVVCRGDHPSEPGELVASAERGGWVRQDSGRDSNRALDFALARPV
>gnl|bykdb|A0A2V9Y3Q6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=310 residues).
MSRIHEALKRAEQERATSQGGHLEPLHTTEGPVMDPIQASTVVEHPPVAPSTGIPPFSNPFTFDTLLARCAQTNWSPDAK
SMLFFNSDERKYGVEEFRTLRSRLYQLREKMSLKKLLITSALPKEGKTFVAANLAQVLVRQHGRRALLIDADLRGARLHQ
ALGTNFTPGLSEYLLGESDEFSIMQRGPMENLFFVPSGRTVSSPAELVANGRLKFLLNRVEPLFDWIIIDSPPAVPVSDA
SLLANFCDGVLIVVRSNTTPFDIARKARQEFEDKHLVGVVLNGIEPDSSPYSRYYYGSYGNKETQETIQG
>gnl|bykdb|A0A2V9ZA03 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=272 residues).
MMKDLGLTRNAAASPRMLHDLDSDLAVSNEPPGIEVEVPPNPRLVAMMEREGVGAEKFRVLAARLQYFRKQRQLKKVVIT
STIKGEGKSVVSANLAVTLARRQRTLLIDGDLRQSGLRELLTTHGLPGITDWWQETADVSEFLRRVNGFPLWYLPAGEAM
GQPLEILQSQRMSEMLTQVAEWFEWVIIDSPPLAPVADPNLWAMQADGTLLVVEQGKTPKKLLRKSLESIENLKLIGVVM
NGSQDADHQYYRQYYKSPANSRASAGHERRLS
>gnl|bykdb|A0A2V9ZCI3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=298 residues).
MSRIHEALKKAEQERAASQGSQIDSSHVGEMPVMDPASVATGVAAAPGPATPAFSSQFTFDTLLARCVSVNWHPDEKTML
FFTKEDHAPGMEEFRTLRSRLYQLREKMPLKKILISSSLPKEGKSFVAANLAQVMVKQHGRRVLLIDGDLRGSRLHQTLG
CPNTPGLSNYLMGENDEFAVVQRGPLENLFFVPAGKQVSSPAELVANGRLKFLLNRVESLFDWIIVDSPPAVPVSDASLL
ANFCDGVLIVVRSEVTPFDMARKARMEFRDKQLLGVVLNGIDSSSSAYSRYYYGYGDQ
>gnl|bykdb|A0A2W0B5E2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=219 residues).
MAAQATSEQSEAYRALRTSVLLSVASRAPQTVLITSAKIGEGKSSTALNLAMALAQCGSSVVLLDCDLRKPVLARLLGIQ
NERGMSTHLTGHDSINDVIQQYKEQPNLWLIPSGPIPPNPAELLCSEAMESLFGELRRRFKHIIIDSPPLLAVTDATVLA
SAVDGVILVVESGVTPKKFVSRARNILDGANARLLGVALNKVHMRHDGYYGSYYSGYHA
>gnl|bykdb|A0A2W4TWK5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=304 residues).
MGRIDEAMRRAGGASATVEEAAQPAVPVELPTEAFPAEPGQRPEPSERPVRHARPAMDAPVVDDEPEPALPPLEGRIAPA
LERKVVIDRELDPVSREQYRRLAMALHAAQGTGGVKVIAVSSALANEGKSLTASNLAMTLSESYQKRVLLIDGDLRRPSL
QQIFGLPGEGGLTAAFAPRSDHRIRLHRITPHLTVLTAGRPTTDPMAVLASERMRDLLADVREDYDWVVIDTPPIGLLAD
ANLLADVSDGMVLVVKAGTTPYDVVQKAVELLGRDRILGVVLNQAEPDSLADRYQSYYYSPARS
>gnl|bykdb|A0A321LMC5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium AA13] (length=332 residues).
MPMGRVYKALVKAGRITEQFQQPEGAVFGDAIGPDFFDERDDSFIKESGSTRNSQPASSRREARASAAASNLRVGEFARN
NQGFVEPRQSFSIHDLRVDQHLAGLIERDDLARERYNTLAVRLINLAAKHNRRSLLVTSALEGEGKTTIATNLAWVMARQ
SGKKVLLLDADLRRPSICKMLGLKSPHGLVDVIERRAAVSDSIVAIKPHGMYVLADRSNGDIPNLSAGDILTTSRVEGVL
DELESAFDFVVIDAPPITDFADAQRLAALADGTVLVVKAGRTHHSAVANALKLIPKERRVGVVLNVAEVFNEEVTYYYGA
KNKRRGWFGKKH
>gnl|bykdb|A0A321LXF5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriia bacterium AA117] (length=308 residues).
MSRFFNESRKASRHVTVGPRNVDLQEHISRLREGLETHSRPSSSQVRQVLAPLEDANNIASQVVAARLENCRSIRLPRDN
EQLLLVPQYNLPMQQAMEAYQTLRTRLVKHEGRHGMRSLVISSAAPGDGKTLTAFNMALCFARIQNWPVLLVDADLRTQG
MSSLLGRAGAAGLADILESDCAYDQAVLQTDVPDLYVLPAGKSSTPAPELFSRAAWKEFIGWSSESFKLVLIDSPPMLDL
ADFELIASPCEAVMLVARSGKTSLETFTKTCARVDPKKLAGVVLNACEEVGDKDYKYYRYAVGGPSSS
>gnl|bykdb|A0A350D2W9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=428 residues).
MQRLKAELDTARDLLKNETGGLVKAAYSEYQAALKKENSLKDLFERQKDEAFRLNSNAILYNGLKIEIENKKSLLESLLK
RQSETGVSARLRGLRTSNIRVIDRADLPINPSSPKKLRNLLLALFLGLFGGAGLAFVMEYLDNTVKSAEEVGRYTGLPTL
GVVPVFGDDSNRAYGYYYSYGQKKGEEKGKGGKEDSGKPKNIELIVHFAPESAFAENYRSLRTALLLSSPQGSLKTIMVT
SPLPEEGKSATISNLAVSLAQTGKKILLIDADLRRPKQHQIFKMKNHEGLTSYLALDLPVQKLIKPTMVPSLYLINSGPI
PPNPAELLGSDRMSKLLALLKDQFDFVLIDTPPILTVTDAQILGKLVDGLVLVVQAGTTPREALVQTRELIDLLKLRTLG
VVVNSLNLENHGYYGRHYYRHYYKESRG
>gnl|bykdb|A0A352EZH8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=364 residues).
MGRVYDALRRSGTDGSAIVFEPQPSSSDYRGEIRTHRLVPSAQQIEEELFSASSILNRTEDTVTSSAFTAHTAYATGGTA
LPAGQSSGAVGATLDAARPARVSGLVSYDVDATRVEPHLVAITQPRSAYCEQFRSLRTRVLQAGEREQMRTFVVTSAGMG
EGKTLTALNLAWLLAQSEGVKALVIDSDLRQPCATNYLAIDAPRGLSEILGGELSLRDAIVRLDPAGLYLLPGGQAREDV
AELLSGPTFAGVIAEARRLFDFIIIDAPPLGIFTDANVLISRADGALLVVRAGKTRYAQVNELLEQLPRERMLGVVLNRA
DEELESGAYYYQQRHYRQPRVPAGEDRLRLVSELEEDEEVAIAS
>gnl|bykdb|A0A352FU10 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=363 residues).
MGRVYDALKRAESAERQVTSSKSSVRQNGNSGNVLYPGWPGNGHDHPWERNAFTGMASAYDSASTAHTSEAASGPALPAG
TASRDAGATLGAVGSARAVEFSSREISTARVEPHLVAITDPRSPECEQFRALRTRLLQAGEREHKHAFVVTSAGMGEGKT
LTALNLAWLLAQTDGATALLIDADLRQPCAAEYLGIQTECGLSEVLTGETKLTQAILKLEPSGLHLLPGGAAREDVAELL
SGPRFGRLLEEARKLFDYIIIDAPPLGVFTDANLLINRADAAMLVVRAGVTRYAVVDRLLEQLPRERMLGVVLNRAAGKT
DDAAYYYQPRHQRVASAATTDVADREAVEDEPEMIYIEEEGVS
>gnl|bykdb|A0A353CAT5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=671 residues).
MLRAIGLASDTTKDTTSTADSVNSLNSGLVSADEIAEAIRLAPYVEIIRNNLTVEPVREPRATFKDTRLIEISFRHTNPE
LAAFVVNGLGETFASTNQEQRSGTSRKTSDFLQKRISDLQADIRNDEVRLVELERSEGILKTPGDQTIVLERLGGLNKDL
LTAENDRKTAEAEYNSVKGSPERLKSLAEAESARYITERENFILNNRTETDKAIAGLAATRAKLLEEYKESAPEIKEIDS
QIASLERSLKTATDRANAEIATFRERTAKTLIDVLETKYRRAKEKEDKIRAAFDVQVNEAQGQNAGAVMLKLLQQSIETN
KGFLDNLRKQQSSNDIATQGTDNNIRVAAFAIPPDTPVAPRRLTTVLAALFLSTLFGMGLALFLEYLDDTIRTTEEIENY
LQLPALAAIPTIDSMPKRRLLLVGNAERPAEDDPANSELLIYADSRSSLAEAYRQLRTSILLSTAGHPPKSLLITSSLPS
EGKTTTATNTAISLAQTGARVLIIDADMRRPRLHSVFNITNGIGLSTLLSSELSEAEILKAIRTDDGTKLNLLTSGPIPP
NPAELIGSEQMASLLKVLQKHFTHVVIDSPPITSFTDGVLIASMVDGVILVVHSGKSSRQVVRRTKQSLIDVGAKIVGVV
LNNVNLRSQDNYYYYQSYYHRDNYRSGDDPK
>gnl|bykdb|A0A355ESH9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=674 residues).
VRSLDLMADPSFNPGAAAAKERTGATTAEEDEATLGKLAQQLKGGLTVDPVRNTQLVRLSFRSSSREFSAKAANAFAESF
IDMGVEDRYASAGKASTFLGSQIETLKQEVAEKEAQLQAFSRSSDIVTLDPQSNVTLRRLETLNTALMDAKKERIEKEAH
YHEVMTGPLDAVADSLAPGVISGLRTQQLQMEQDYETKLKTFKPEWPEMVSLKSQIETGKQHIDSVIREMVQKARSNASS
NYQAVLRQEQSLAAELETIKRQAIDQNSSAVQFTNLKVEIQTRRELLDELLRRQSETEVAVRLQDTRESNVRIIDHALVP
DGPFRPSLRKDLTYGLLIGLLFGIGVALFLEFLDRTVKSPEEVERRFSIATLAVIQDIAETGKAYGSPAYGYGYGYGYGY
GDPPTGEPSRVRPTKGKAKVAGGGWLEKKKGTPGPQAQIELVPHERPRTLISESYRSLRTALLLSSARELKVVAVTSAMA
GEGKTATASNLAVVLAQLGRPVVIIDCDLRKPRIHQVFKLSNRSGLVNQLTGTAELDAVIFPTEVPNLWVIPSGPMPPNP
SELLASERLRDLLRTLRSRFDYVIVDTPPALAVTDATLVGIQTDGVVLTLRSHKVTREEVRLVRDRLRQADVKILGAVLN
RYRALQAGAAAGYRYAEAYGYGAEETGSKAGSAA
>gnl|bykdb|A0A359M0J2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacterales bacterium] (length=801 residues).
MHPEDPNSGTSHRPQALTPIVLPRNAQPALYTPFPSEPAPEAPATNWVQFHLAILKRRFWWVLALGFLGTGVGFLVFLPQ
DPQYMAATTIELQPINENFLGAFDPLSGSFSSQNLNAQTQISILRSYSLLSAALERMERESTLTAAAPAGRFAALRRRLG
FVPLEPLEATREATFIAARSVMPRIVPGTRIIQITASSTIPEVAANLVNAVAAEYVYQNQQFRSNSVQRTTQWIAGQLEE
TKFKLEQAEQKLQDFVRKSGNVFVNSEDTLANSKLRQLQAELTAAQTDRINKENRLNVAKGKPVETLPGEIAGGLSTQQG
ALDSLKRQRADLLTTLMPGHYKVQRIQAQIDELEQSLERERVNIVERLKNDYEAALKREQMLTSAYSRQASAVTGQANVA
AEYGTLKREVDILRQSFNALLQQSNQVSIGSAIPVSSVRVIDTAKPNNTQMSPSLFRELARGLGLGLLLGYGCAFLHERV
YRKRQERRFAAPGNSGRLLNVPELGVIPSNAAPERFGKQFFRIRVRRRKSKPLSLTGTGTAAPAAETPPSNPRLEFLEIW
KGKPSIVAESFRLTLTSLTRSGPGSLAPGLVLVTSPSPGEGKTTIAANLGVAMAEVNRRTVVIDMDLRRPSLHNTFGSIP
EVDWTSLVMDDAPITAERIEPLLQATDFEGLSLLAAKAASASTIHSIFNSPRLGELLAVLRQRFAMVLLDSPPVLQFPEA
RLAGRFADGAVVVLRSRHTERDAAMIALRRMAEDGIPLLGTILNDWDPKSGAHHSHGYGADYYSKYYEYQTMAESGKSGT
S
>gnl|bykdb|A0A399W9E4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=332 residues).
MSVLQALQRKNSENPTSTKPKVVAFDAPGRRNLPPDLLGTGLAIGSPRSAFDGQPNSSLGTALPDVETGLTAGAKPNADT
LTRSHRRPLPDCVSWTVDAERVEPRLVAITSPNSSYCEEYRSLRTNVLHKSQRQNLQAIVVASANPSEGKSVTAVNLAWM
LAQTDGVRALIIDSDLRMPSLADYLGIETEKGLSDILTSDARLQDTIVKLEPSGLYLLAGGTARPDVAELISGPKYAELL
AEAREMFDYIIIDAPPLAIFTDATVLINKADGALLVVRANRTKYSALDRILEPLPKDRMLGVILNQSEEVLDESHYNYGY
YNYRRMAEDAAS
>gnl|bykdb|A0A3B9LSB4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=454 residues).
MVDATEEAPEVKEVDQQIAELERQVKDVRSRKSVTLLTNLETDYRQTLAREQALRKAFEQQRGETLSQNEAAINYRIIQQ
EIDTNKTLLDSLLQRSKENDVIMASKPNNISIVDYAVTPDGPIGPNRSSTVSMALFLSLGLGVGLALLLEYFDDTLRSSE
EVERLLQLPALGVIPSANASARRRLMGASGALQKRNGHSDSPELLMNVDGHSPLAEAYRHLRTSVLLSTAGRAPRSLLVT
SSLPGEGKTTTAVNTAVSLAQTGASVVIIDADMRRPRLRSIFGLSDRAGLSSILSSDVSEADMLEMVSTDEATGLRVLTS
GPIPPNPAELLGSDQMRRLMATLQSQFSHVVVDSPPVNSFTDGVLLSSMVDGVLLVVHGGKSSRHVVRRSRQLLHDVGAK
IFGVVLNNVALQSHDYYYYQRYYGARNYKSDGDDDIEPTSHARRNGSHNTLDLN
>gnl|bykdb|A0A3B9MKY6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=362 residues).
MGRVFDAIKRASAADQGGEQKRHQPDLERHGESPSVPGLPSARQIEEQLPSRSSFLSVSHETAQNSASSAHTADIPGGLA
LPGGKASRDAGATLGAAGAARVDGFATYDISPARVEPHLVAVSQPRSPYCEQFRSLRTKLLQAGERKQMRAFVITSAGVG
EGKTLTALNLAWLLAQTDGVRALVIDSDLRQPCATEYLGIDAPIGLSEVLGGAVRPEEAIVRLDPAGLYLLPGGKARDDV
AELLSGPSYARILTDVRRMFDYIIIDAPPLGIFTDANVLMNRADGALLVVRSGKTRYALIDRLLEQIPREKLLGVVLNRV
DEQFDETAYYYQRHYYNRDRGLTEAKTKQLPGERQEEVALVN
>gnl|bykdb|A0A3D0NW85 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=673 residues).
RGFLRAIGLASSPDAQSDASLSEFAASPNSGLMSADEIAEAIRLAPFVDVIKRNLSIEPVRESRVTVKDTRLIEVAFRNT
DPQLAAFVVNGIGETFAASNQEQRSGTSRKTSDFLQQRIADLQSDIRRDELKLVELERTEGILKTPGDQTIVLERLAGLN
KDLLTAENERKTAEAQFLSVRNNPERVSALAEAESARYITERENFLLNYRNETQKTIAGLTANRAKLLEEFLPTAPEVKE
IDSQIKSLEDSLANATEKAQAEIQAYRGRTADNLLKVLETQYRRAQEKENKIRSAFNVQFQEAQGQNAGAVMIKLLQQNI
ETNKGFLDNLRKQQSSNDIASQGSDNNIRVAQYAIPPKNPVSPSRTTTVLAALLLSTLFGMGLALFLEYLDDTIGTTEEI
ESYLQLPALAAIPSIDSMPKRKLLLVGGSDRPDEETEPLNSELLINADPRSSLAEAYRQLRTSILLSTAGHAPKSLLVTS
SLPSEGKTTTATNTAISLAQTGAKVLIIDADMRRPRLHSVFGVSNGEGLSTILSSEMSENEILGVIQQEPSTKLNLLTSG
PIPPNPAELIGSQPMAELLVTLQKNFTHVVIDSPPITSFTDGVLIASMVDGVILVVHSGKSSRQIVRRAKQLLNDVGARI
FGVVLNNVDLRSQENYYYYQSYYSQSQYRRDEE
>gnl|bykdb|A0A3D0NWU2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=515 residues).
SASQRGEGMNIPDLYENKIFQDTMRLNNERKAKLQDDIRNIDKQIQQAETEKSELLVRYTPEYPEVKKMEERIASLKESR
TRTEQEVSSIIDRDQKRIEREAVGGALTALRAQLDAKRKEEAQAQAAYDREAALANIQGQAQTRLTTLKRDIETKRNLLD
TYTQRLKEQELAIANSTPDNIKMAAAAETAPRVGPNRTRNIIVALLLSLAAGIGLAFLLDYLDDSVKNSEEIGRQLGLPT
LALIPHYFGSEKKRLRLAAENGGSPGTSLVALEERHSPMAEAYRHLRTSLLFSSAGKPPQSILVTSSQPSEGKTTTAINT
AITLAQADVDVVIVDCDLRRPRIHNYFDLENSEGLTNYLSGDRNTKNLIKACRDLPRLKVITSGPIPPNPAELLSSNEMR
NLLQFLRSKYKHVIIDSPPAISFTDAAILSTQVDGVILVAMAGKSSMHLMRRFKQRLGNIGARIYGVVLNGIKQGSVEYG
YYGSGYYDYYKSADADTTTPRMDSDANGNGSNGRA
>gnl|bykdb|A0A3D5SKZ1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=362 residues).
MGRVFDAIKRASAADQGGEQKRHQPDLERHGESPSVPGLPSARQIEEQLPSRSSFLSVSHETAQNSASSAHTADIPGGLA
LPGGKASRDAGATLGAAGAARVDGFATYDISPARVEPHLVAVSQPRSPYCEQFRSLRTKLLQAGERKQMRAFVITSAGVG
EGKTLTALNLAWLLAQTDGVRALVIDSDLRQPCATEYLGIDAPIGLSEVLGGAVRPEEAIVRLDPAGLYLLPGGKARDDV
AELLSGPSYARILTDVRRMFDYIIIDAPPLGIFTDANVLMNRADGALLVVRSGKTRYALIDRLLEQIPREKLLGVVLNRV
DEQFDETAYYYQRHYYNRDRGLTEAKMKQLPGERQEEVALVN
>gnl|bykdb|A0A3M1SNQ5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MKILKALQRRKQENERIVPFERKYQPESYAPTTFPLGDIKIGAPTSSEPEIASNDSPITFTQAETLVFPRVEIDPEIVHQ
RLISIKAPNSGYCEEYRNLRTHILHESQKRHLKVITITSINPNEGKSITALNLAWLLAQTDGISTLLIDADLRNPSLASY
LGIEPDKGLAHVLSGEIKLRESICRLEPSSLHLIAGGAIKSDSSELLSGPKFRDLLQHLKKMFDYILIDAPPLAIFSDAK
VSINQSDAAILVVRSGHTKYSTMTRILEGLPREKMLGVVLNDSEDLLQNESYYRSYQKYAEVVDS
>gnl|bykdb|A0A3M1SSE1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=317 residues).
DIPVSPRRLLTVMMALFLSACFGIGLAFFLEYLDDTIKTAEDVENYLGLPVLVVIPSMNAAQKRRLLLVESSDNEPASKN
RSELLIYDNSRSSSLSEAYRQLRTSILLSVAGHAPKSLLVTSSLPAEGKTTTAVNTAITLAQTGAKVLVIDADMRRPRIH
SIFNISNREGLSNLLSSEIKRDKVLDSIYFDMSSRLYLLPSGPVPPNPAELIGSAQMSTLMEIFQKEFTHVIIDSPPIAS
FTDGVLIAAMVDGVIMVVHSAKTSRQIVRRSCQLIQDVGAKIFGVLLNNVNISSQDNYYYYQSYYYNSYYKKEEEEE
>gnl|bykdb|A0A3M1VTE1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MTAGGSGRGADRGSPTRYAIGAGVGARPRRPRPRITLAPTEELVVAREPNCPAAEAYLRLRSALLHESDGTPPRVIVVTS
GMPQEGKSLTAVNLALAFAACGDERVLLVDGDLRRGGLARFLEPAPRAGLRELLEGKVPEEEALLEVSGTRLAVVPAGRP
VANPVGLLSSGRMAGLLAEWRSRFQRVVVDTPPIVPFADAGILGELSDGVLLVARAGRTPKALIEQVVEEAGSVKLLGVV
LNDWTGSLADRRTGYDSRYYSRYYGKGGR
>gnl|bykdb|A0A3N5G7M6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=233 residues).
SARPLLVDREISTGFGEAFRAFRTNVRLSMLPGGMRSVVVTSACAGDGKTLVASNLAVALALAEHRVLLIDADLRRPTLH
TAFNVKSEPGLTDFLIGEGRIANLIRRTRIPRLHLLTAGTLPPNPSELLDSQRFRKFLARLGNHYDWVILDSPPVMPVTD
AIVLAEAATGVIFVTAAETTPIPASRSAVDQLRRAPAPLLGVVLNRADLKRRGYYTRYYRRAYQAYYGHPTPA
>gnl|bykdb|A0A3N5NSX5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=595 residues).
ARRLTRAATPSGATAGQPSATDLANAFLGAVHVEQVRGSRLFNVSITSSDPQFAARAADALAAEYVQFNLEYRTDATRKS
LDFLAGEIAKQQTKVEDSERAMAEYRESNNALSLEDRQNTVVSSLNQVNDEYTRIRTVRIQKEALYNQIKSLPPSSVGDA
PAVGASPAVQSLRTRLAELQRQKVQLNERYGPKNPQVIENDNAIADTTQQLQTALTAAVAAIRSEYQTARATELRLADAL
KQSQGAAMELNRKNVGYTVLEREAQSNRGIYEALLQRQNELQIVSNSGGNNVRLMDRAVVPGSPFTPDVRRNYMLGALTG
LLLSLGLVLAIDYLDDTVKTPEDITRRLKLPFLGLVPAVKGNNHPLLSQEVPHEFGEAFRALRTSLVFSSGTEGTRVIAL
TSAQPLEGKTTTACNMAIALAYGGSRVLLIDADMRRPSVSRTLGIENNVGLSHLLTGQATARQAIHRTNVQNLWVMTAGM
TPPNPSELLASDRMKTLIANVQTGPFDWVLIDTPPVLAVTDAVIIAPWVSGVVFVIGSEMTQRRLAERAVETLLTSRPHV
LGAVLNRVDIIRNKYYYSRYYGYKYKNYYVKSNAA
>gnl|bykdb|A0A3N5NYV3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=303 residues).
MSRLAEALKRASAEQESDGAEQQEPIKREKPPTSHPKLAVAEATAKLESAVQAEAASVATEAESEATAPRVTSSVTSLIA
EKLVVTPSISPVSLEQYRRLAATLHRRQTESRIKTVLVASTMAGEGKTLTAVNLALTFSESYGRNVLLIDGDLRRPTTHA
VLEVPNILGSGIGSKQETDQKLSLIQVSPRLSVLTAGQPDPDPMSRLASDRMRRVLMEAATQFDWVIIDTPPVGTVPDAN
LLATMADVVLLVVQAGRTPARLVQRTADALGRERVMGVVLNRADDLVVSSDSSSSYAYGPNNN
>gnl|bykdb|A0A3N5P5F2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=530 residues).
IERNLQFKFDASKDAADWLTNQLDAQRKNVEETELALQRYREQNNATSTNDPEVIQRLSGLNAAVMEARTARLEKEAALT
QLRAIQHDKAALASAPAVVANASVQRLNQELADLQRQDAQLSRQYGERHPEMIKVRTAIQQIRQKLDAELHNAVQAVEGE
YVGAQAREESLTRELEAQKADVLAINRKSIGYAALERDAASNRQIFEALLQRAKETGISSELKTNNIRIADPADVPRVPI
SPNKQRDLLFGVMVGLVAAIGMAFLFEYLDNKIKSPPEIRTYLNLPCLGLVPRIAGKHGSSPLLLNNGAPDSFAEAFRAV
RSNVLFSVSPECRRLVVTSTAPREGKSVVASNLAAGLAMAGHRVVLIDADMRRPRVHAIFDVELSPGLSQLIVGSAKAEV
IRRSRIPNLWIVPAGEVPPNPAELLSAQQFEHFLNSLSARFDWVILDAPPVLAVTDASIVAHSASGVVFVTSADLTDRNA
AVQAVSQLRSAKANFLGVVLNRVNLSRNAFFYAPYYRREYTDYYSRALRS
>gnl|bykdb|A0A3N5PFU4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=230 residues).
MNTFATQLVSLTNPASFAAEQYQNLRLKIERLRQTRDLRVIAVTSPGAADGKTVTSINLAGALARGAAARVLLVDADLRR
PQVADHLHIPQGAAGFADLVVSARASLGEAVRPLDGFNVDVLPAGVVAGPIHDVFRSARLPQLLSEARARYDYVVLDTPP
LVPVVDSVLLSRVVDGVLVVVAANKTPRRLLEEGLNALDSAKVLGLVFNSDVRPLYGYDNNYRRYFSRAH
>gnl|bykdb|A0A3N5YKY1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=314 residues).
MQVFATPSAATHPNVPPTVGVGGASAVPPAAAFPGAAGPTAAPASPAAAPASFPGNGGHQPLPIVVPNPVLAGGRRARSV
TLHPLLAAALEFGSPAAEQFRALRTRIGQVEFGGRDCRSLVVTSPMPGDGKTVTSANLALSMAQEFHRKVLIIDADLRKG
ALHRMFGVDNEPGLTDVLAGDVPLEEALIWIPEYRLTLLPAGRPTNQPTELLGSFEMRRAVDTLRTHFDRIVIDTPPALA
LADVGVVGPLSDGVLLVVRAGQTPRPAIERALRQVAPARVLGLVLNDVGEISSGYAYGRVDNQNAGRRVARSGA
>gnl|bykdb|A0A3N5YN96 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=371 residues).
MSRIQRVLDKAEREGQVRRTTSEVPPAADTAAAGRVSSPVSPQPPVASRRAVPPEPPMQVFATPSAATHPNVPPTVGVGG
ASAVPPAAAFPGAAGPTAAPASPATAPASFPGNGGHQPLPIVVPNPVLAGGRRARSVTLHPLLAAALEFGSPAAEQFRAL
RTRIGQVEFGGRDCRSLVVTSPMPGDGKTVTSANLALSMAQEFHRKVLIIDADLRKGALHRMFGVDNEPGLTDVLAGDVP
LEEALIWIPEYRLTLLPAGRPTNQPTELLGSFEMRRAVDTLRTHFDRIVIDTPPALALADVGVVGPLSDGVLLVVRAGQT
PRPAIERALRQVAPARVLGLVLNDVGEISSGYAYGRVDNQNAGRRVARSGA
>gnl|bykdb|A0A3N5ZFD3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MAEALSASPAEPRSAAAQPRATGPMAVFHGFDPSVRERIVTGHAETNGNLAVMTVATEQYRRLAATLHHAQMEKGLKIVM
VVSSMAGEGKTLTATNLALTLSESYQRQVLLVDADLRRPSLHRVFGLPNATGLNEALTEEAGNPPALFSISPQLTLLAGG
RPHPDPMAVLTSDRMRRLMEEAAAGFDWVVVDTPPVGLLPDANLLAAMVHAAVLVVEAGKTDYASVQRAVAAIGRDKIIG
IVLNRAERPAGTYGNYERYYAGYAKRTEG
>gnl|bykdb|A0A3N5ZNH4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=262 residues).
MPSLGVIPTIAKPGRTQKFLAAKNSEEDENSTALLNANELRFRVWESYRSLRTSILLSNSGKPPRTILVTSSIPGEGKTT
TVANIGIVLAQTGARTLLVDLDMRKPALDDKFNCRGEKGMSSYLSGNSDLSSLIRPTAYPNLFILPAGFRPPNPAELIGS
DKMETGLKLLGEYFKYVVVDSPPVLAVTDALVISPLVDGVVLVVRGGATPKDVVRKAGGHLVGVHARILGAVINNVNMDA
PEYVHYYRHYYDETYSNDFSAA
>gnl|bykdb|A0A3N5ZPQ7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=529 residues).
MDPAQASRLCSYPCAAFPTPKATEVNRFESSMDNRKAILEYMKQIEVQEKTGSLYLVHGAADHTELTEMKEVIRVYFHGG
LVSAMSSSLPEYRLGQYCLKEGIIDPPDLHKQIKGRDHRPLGEAIVAAGLAEPVEIQQLLQKQAIDVFRRALENGFRIES
FEPMSVHLGIPLKARLDVLLLDLARTAANTFEPGLYEKIGLIAEHTFATLPWQPAELAVLDCLLQPKNLEELMGETGLPE
SQLVACLQTLRALGMIEIREEETEEERSVALTVRERLPLEQLVPEAADALLSQQLETVTNEHSFASEQFASLKVRIKESR
AGSPHKVITVTSPHIQDGKSLVSANLAFSFARDSGTRTILVDCDLRRPSLHRYLGIPPEPGLIGYLSTNLLRPYCFMRQV
QGLFVLAAGGISDSPIELLSLRKMRELFDYLRIEFDVVIIDSPPLNPISDTRLISGFSDDVILVIRRGRTPFATIEQGLK
VVDRKKILGVVFNDLDEKESQFSYYQHSYYHPGKDRQSSRTRRRKRNAP
>gnl|bykdb|A0A3N6BI26 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=629 residues).
MTSQLSWLKRTVSNLRPGRSDAPKTGADESGAGRDKNRDVLDTFRDRLEVAQVPNSRLVEIRWVSPDPTLAAAVSDTLAE
EFIEQNLQTKFEANTRATEFLKKQLQDMKGKVEKSEQELVKYARENNIVNIGPDRGSMVLQTLEDLNRQMTTVEGELIGK
TADYQAVRDATPESFPQSLRTPSISLLEERLFGLQQNLASLSAQFGSEWPAVIQVRQQIQEVEKQLLREKKETINRVQSE
YRVAVNRRQMLLGALNRQKAEANQLNQDSIQYNILQREVDTNRQLYEGLLQRLKETGISAGMRASNIHVVDHAEVPEAPY
SPQRAADLALGLGVGLFLAIGLAFLMEYLDNTLKTPEDMEQSLGLPSLGVIPAMADLPAGSSRLLASRNESGDSKTDLPA
AISPARFRVWEAYRSLRTSILLSHSGKPPKVIMVTSSVPGEGKTTTVANTGIVLAQTGARTLLIDLDMRKPALASTFGYN
GNQGISAYLSGNGDLSSQIRQTSYPNLFLLPAGFRPPNPAELIGSERMESALRLLGDYFKYILIDTPPILSVTDGLLLCP
HVDGVVMVIKGGSTPKEAARKAGNHLTSVGARILGALINNVDMNAPEYSYYYRHYFDERYNTDLSSAAG
>gnl|bykdb|G8NS05 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella mallensis] (length=747 residues).
MIPSRPENFSAEPDSRAASAGPAATDATLSEALMTIRKRKYVILAAALLGMIYGFYKGSTQPHLFESYGDIEIRSGSSDQ
YRIAGSTGAGGNRLPTEVAILKSDTLLLTVAEDLDLANNQDFLGMTQRPPHVNIEDPNVRQATIGRMQAIVSVANIPKTD
IIRISCSTFNAKLSADIINKLIDAYIKRSFTSRVSSTQRASGWLTSQLDELKHQVETSQNQVIDLQKRIGVLSIDPTHNQ
ISSSLEELTTAAGTAQIARILAESRYRVLSGMDPNSLDQTVANTTNNVAATQLATLRSQRETDMANYAKLTAPGNLGPNH
PQVKAAHAQIEELDKAIKQEQDRVIAQAKQTFIAAQANEQQTRAALEDQKSEAYKLRDDLVQYTLLQRDFESNRTLYEGL
LEKLQTARVQAGLDSTEIDIIDQAVPPAQPSLKSKSSIMMLNTIIGIVLGAILGFILESLDTNLHSVAEIEAVSGLHSLA
LIPRARRTGIDTSNLSVIQRNLATLSSPKSQFTEAFRGLRTSLLLSTAGKLPKVILLTSATPSEGKTTVSTNLACVFAQR
DVRVLLIDADLRRPTVHHRLGLNGKVGLTSVLTGSHTLEQAIQNVPEMPSLDILVSGPVPPFPTEMLSSETMAELLEKCR
GIYTHILIDSPPLLSVTDGIILGRDADAVVLIVRHGKSNKHTIRRARDLLLRAGVHITGIALNAIDLNSPEYYGYYGYSG
YSGYGSAGMDAAGWESQSGKSTGKGQK
>gnl|bykdb|G8NXD3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella mallensis] (length=282 residues).
MITLNLREYQTIEPHLMIASASNGDAGSPHKHQNAVVDRPASDQSDAINWLNMVPKLERLPQKHRTTIAFESGADSRACE
QFRLMQHRLVTARPAGGVVLITSPSAEDGKSLNCQNLAWALAEAGHKTLLLDLDLRRPSLLAALGGVCPQSIEQVLKGEV
TPEAAIRSVGDLPLYIIGLDKAVSKPVPLLRAPELSNLLKWAQKNFQWVLLDAPPVLPVADVEQLLPSADLVLMVVRERV
TRRAAVQRAAEMLGEHLSSLIFNDVTMSIAAGYGANYDRGYR
© 1998-2019