BYKdb

Dataset for cluster tadcd of phylum acidobacteria

[Download (right click)] [Alignment] [Repertoires]

270 sequence(s)

>gnl|bykdb|A0A0B6WWQ6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Pyrinomonas methylaliphatogenes] (length=789 residues).
MMKGDPEKEPQSLIRLDASAPYPKLYADYDHRWEREERTQQIVAGYWRAVRRYLWLVIGLVALAAAATAIYMARQPDLYL
ARARVEIGSEEDSALSLSPTGGPVVINRSSDPTYFSTQLQILTGSQLLRRVVRTLDLEHNPEFLRPRAVRDLSPWLNLRR
MLMLGTGQEKSAGQRGTRGQMPLPSEIAPATESQDDFDVAMRLDPYVRTIASSLKVDPVKEVRLPVKETRLIDISFRHPD
PYVAATVVNTIAETYKLSNLEKRTSARATTSQFLQRRIAELQAQIRAGEAQLLAYSKSHQILSLDPSQNTVVERLAGLNR
QLLDAENERKLAEAAYLASLEPGAAEAMVEKEDGISVAALNKLTELRQRRAQLLVEATEEMPEVKEVNEQIAELERQINE
ARARAKDVMLTNLRTRYRQALAREEALRQAFDEQRGETLTQNEAAINYRIIQQEIETNKSLLDNLLQRAKENGMAMAGVA
NNIHIVEYAFPPNRPIGPARLQAVGLAIVLGLAVGIGLAIFLDYLDDSLQSAEEVERELHLPALAAIPTVSSRRSLSKAV
ALQTDGTAHPELLVGDGGESGLAETYRQLRTSVLLSTPGHAPKTLLVASSAEAEGKSTVAVNVALILAQTGAQVLLIDAD
MRRPKLHELFGLKNERGLSTLLSSEIRNGDAFKCIHDSARGVQVLTSGPLAPHPAELLGSDQMRALLEELRARFDYIIVD
SPPIAYFTDGVVVATLVDGVMLVVRRGKSSRRIVRRTQKILHDVGARIFGVVFNHAGMPSDAAYYRYNR
>gnl|bykdb|A0A0B6WXT1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Pyrinomonas methylaliphatogenes] (length=786 residues).
MQDNRLLPLSQTEQQLDRPLHDLTLGQPATFIEQAHLREYWAIVYKRRWLILSLALAVTSLVAIYMYRQPNVYEAMVTID
IEPRRSVLQTKGDVQVVSVPNDPNYWSTQIKLLQNPQLARQVALTLDLPNNPAFLSGQAGPSLTSSLRRILSRRKKEENE
QGKLQVVTDSEVDAENLTPEQLAKLEPYEEAILAGITVEPVEKTNLVNIKFQHSDPEMAAKVANTIADVFIYNNLERETQ
GAQRASVLLAKQIAELQLKIRQGEEARINYLRSHNLPLGQAKGQNLTLERLATLSGQLLEAENERKNLQSAYEAAQRETD
IWSVPEVQSDQRIQKLRDRIGELEEKRAALLVQYTPEWPEVKKVDEQIKRLKQDLDKAPYEVIKAMRSRYEAALARENKL
KQAYYQEAAAANEQNQAEIELSRITQELETNKQFYNTLFQRQKELEITSNDRANNITVATPARVPREPVGPKRLRNILIA
LLVALGAGIGLAFLLDYLDDTLKSAEDVERYLHLPTLALIPAPRTERLLLKGKASEPEGVAEKTALALISDVRSPITEAY
RHLRTQLLLSTAGQPPRTVLLTSSQPSEGKTTTAVNMAMMLAQMGAEVLLLDCDLRRPRVHVHFNLANAKGVANYLAGER
NLDALMQTYAPLPNLKIMTSGPVPPSPAELLSSEEMRRLIDEASARFAHVIIDSPPAVSFTDAAILSTMVDGVVLVVHGG
HSSRAIVRRAKKLLQDVGAHIIGVVLNNVKLDAHDYQYYANYYAAYYDEEEDERDLPEGAAERGAH
>gnl|bykdb|A0A136JPP4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium OLB17] (length=847 residues).
MDQDQRLTPLPKGLELNQPAGDLTTSYAAYYDHESQSGKRTLRQYVRVVTKRLPMIGAIAVVVTAAAAFYSFRQPSIYSA
STEMLIEPRKAAPTAKDAININFGLDETTYYNTQLQLLQNPDLMKKAVVALGLQREPDLFGSSNRGFFASIKSLFVSPKS
PETPKGALPVLTGTENADPAAVQLSPEEAARAGQYAGILSGGLHVEQTERTSLFTLTINSTNPQIAANVANKVGEVFIEE
DAKRELETTQSAYDELTKSIADLKVTIADQENKLTEYMRSSNLPLQEKGSDLAASRLQTLSEQWLSAADDRRKLEARYNG
AVQASSRGEGRNIPDLYENKVYQDTVRLNTERKAKLQDQIREIEKQIKDAETEKAELLVKYTPEYVKVKQVEEKIASLKT
TKQQTETEVSQIIDRDQKKIEKDAVSGALVSLRSQVDAARRREDQLLNAYEVEAERANVQGQAATTLTTLKRALETNRGL
LDTYTQRQKEQELALASGKPNNIKISERAEAPTYPVGPNRARNIFIALLASLGAGIGLAFLLDYLDDSIRTSDDISRALG
LPTLAMIPHHGINEKKRRSRRGLGSETNAKAASNTALITLEERHSPMAEAYRHLRTSLLFSSAGKPPQSILVTSSQPSEG
KTMTAINTAITLAQADADVVLIDCDLRRPRMHSHFGLSNSQGLTNYLSGEKSTENLIKAAPGLPHLKIITSGPIPPNPAE
LLSSNEMRNLLQFLRGRFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSMHLMRQTRTRISALGARIYGVVLNGI
TSESVEYDYYGTGYYTYYKNRPDDTTPIMDDADVVGQYGNSADSFKP
>gnl|bykdb|A0A136KC10 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium OLB17] (length=810 residues).
MEMERPADPTIAATGRYPGYPQTGQAEGFQLIDYWRAIRKRLWLVAGIAVVMTTLATIYIARKPNVYRAKAVVQVDNEQV
NPDLVTNDRARPISNADPSYFNTQLQLLWSESLLRRVVKEHNLDANPEFQALARTDSTSTFGRILRSVGLASGETQKSEQ
LAAIDPNSTLASADEIAEAVRLTPFVEVIRRSLSVDPVRESRATVKDTRLIEISFNSTDPALAAFVANAIAETFVNQNQE
KRTGTSRKTNDFLQERIASLQSDIRRDEEKLVEMTQNAGILKTSDDSTIVMDRLSGLNKSMLEAENARKNAEANYFEVAK
SPERLAAMAEAEMARFITEQQNNIRAFQSDTLKKISDLRQARALKLQEYQEGAPEIKEIDAQITSYQNSIDNAVQKFQGD
LEKYREATKKTLLYNLQTKYLQAKANEDKIRADFNKQFGEATGQNQSAVSLALLKQTIDTNKGFLENLQKQVSSNDVAAQ
GSDNNISVTEPAVPSNIPVSPRRLATVLGALFLSTLFGMGLALFLEYLDDTVHSTEEVESLLHLPALAAIPTIQSMPKRR
LQLVGEGGETPEDRPGSELLIHADPRSSLAEAYRQLRTSILLSTAGHAPKSLLITSSLPSEGKTTTATNTAISLAQTGAQ
VLIIDADMRRPRLHSVFGIGNADGLSTILANELSEAEILNLITQDPSSKLHLLPSGPIPPNPAELIGSEQMAKLLKTLEG
HFTHVVVDSPPIASFTDGVLIASMVDGVILVVHSGKSSRQVVRRSRQLLNDIGAKILGVVLNNVNLRAQDNYYYYQSYYT
RDNYRSGDDA
>gnl|bykdb|A0A192WQ77 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium Mor1] (length=714 residues).
MVDTTKAAGSGNASPDQTAHFREYWRVIWNGRYTIAAVFVVVVALAAVKTFLATPVYRAVAVIEVQPKSSSITPGQDVSG
LGSAGYGWFAENKYHNTQVEIMRSHDIAERVVDTLGLRSDPFFEAAHNPVQTFRSMIRVDPRRETGLIEVSIEGKDPEQI
TAWVNEVARAYVERNLEVAQESVSFAVDQLTGQVKIMEQKLIEAEEARREAQSEAGISDLDGSLAIVRDRQSQYSKELTG
IEIELGKLDKSLTRLKELQDSGGDPMTLPELASDSELKELNRQRIRVERDIASADVSYRPGHPKYEEKVAELATVDRKIA
ARIDEVVSGLRSEYGLKRDQERYLRGQLRSVQDRSEQLGEATSRLETKRIESETRKQVFDSMSKVTNQISLAAGLLTNNV
RVLDEAIIPDTPIRPRKKVALMIGGLVGMFLGIGLVFFLDYLDNTFRTPKDIEQHLGLSVLSVIPKHSEKKLASGVIKEA
YQSLRTSLIFSSKNRTRKVVLVTSSGPQEGKSTTISRLGRALATGGEKVVIIDCDLRRPTQQVHNEVPRSPGLTNFLAAP
ESDKDWRPFAKETDTATLQIIPAGPTPPSPPDMLTSDRFLWLVNELQKEYDWVLIDSPPAAALSDAPLLATLAHMVVMVV
RHNHTDRDVAIRAMTQVKNVNEHLIGAVLNNVDIDKSFSKDLYYTGYYYYSSDDGERKKKRKKSDKDLKVGAGA
>gnl|bykdb|A0A1E3Y9R6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium SCN 69-37] (length=749 residues).
MAHLPNAGGRQASAKGGGWHPTDYLRVLYKRRWVAIPGFLLVFVSGAIGSIRTVPVYEARTQIIIEKDARRNTSINTVLE
ERESWYQDDFYPTQYRVLQSRTLAQRTARVLAREPAERVPAASTWSFSPSAVVGTTIAAVRHWFGPAPVLPAASDGADPA
PGAVSPQEAALTSRVQAGVSVVPVRNSRLVDLRFRSPDPEFAARVVNQHAAQYIEQSLEFRLAATTQTNAWLTSQLEEQR
RLVEESERRLQDYKEQNNATSVDDKQNIIVQKLNALNEQFVQARIARMNAEVQVNAMAERRARGESLESFPPVLASPVVQ
KLRADIVAKESERARLGTQYGPAYPAMRDLASQIEAANRDLDLEIDKVAAALQAEFQTARAREAALQQSLAGQQRESLGL
DRQMLDYSALEREAQSNRQLYENLLARAKETGAAGEYRGTAIQVLDPATVPSAPVLPRTPRDLLLAALAGGLLALGLAFG
FEYFDSRIKLPEEIKTHLNLPFLGMIPVFPDAGRDGEAPLLQPDAPAAFSEAIRAVRTAVLFSSAEDGARSVVVTSTGPH
EGKTVVSSSLAITLAQAGQRTIVVDADMRRPRMHEALDRSQEPGLSNVLVGEASLADAARTTAVPNLTLLAAGHIPPNPA
ELLSSPRYAELIAELKRRYDWVVIDAPPVMPVTDAAVVAHGSSGVLFVVGAEMTPRQTAIAAVEQLRSANARFIGAVLNR
VNIQRHAYYYSPYYRKEYGKYYQRSPNRA
>gnl|bykdb|A0A1F2Q9F5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPHIGHO2_02_FULL_67_57] (length=772 residues).
MSDEKSVERYEPAARTLERRRPGVPAPLQTLEMEPAADLLSYWRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKAL
LEIEREGPNILTVQELFQIESASDTYLETQYRILESESLARRVVDQLRLDQLAEFSRPGFRLRGGKRETPASPQTFAVGA
AGVARDPVAYQNALETFSRRLAVAPIKRSRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLSEQLLE
IKANLEKSEEQLQAYARQNGLLFLENEAGQPENIVNERLLQLQAELTRAQAERIAKESLYRLTQAGEYGALPGIFENKLM
QDLTVQLAELRRQHAQAATTFSPDYPTVKQLQNQIDEIERLLAQERARAAERLANDYQAAMRRETLLRRAFADQQAQAGR
VAEKSVQYNILKREVDTNKQLYEGLLQRLKEAGMSAGMKASHVRVVDPAQPPDKPAKPSLALNLLLALVLGLGLGLAAVF
LQEHFDNSLKTSEDVERFLHLPVLALIPSLESLNGRRRAYGLPTPKRLASRSVVPAAAPLWHLVSGNGEGSTKLGEAFRS
LRTSVLLSTPEQAPRLLLTSSAQPGEGKTTVTLNLAISLAQLGERVLLVDADLRRPCIHKAFKMAGGRGLVSYLTGQQEW
EAVVHPSPVENLDLVICGPIPPNPAELLSSERLRAFLRQALQRYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTP
RELVQRAYVYARDVGANVIGAVLNNLDIRSDDYYYGRYYRYDYYGTGEHPPK
>gnl|bykdb|A0A1F2Q9L4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RBG_13_68_16] (length=766 residues).
MVARRPAAPDKIGFEVEPESEFHISQWLGVVRRRRLLLILVAGLVAAISIVLYFMTPRQYRATTVLQIERRPTSAAAMQQ
PMQIDDWFDAQSFYPTQYRLLQSRGLAERVVKNLRLADDPVFNPGRSRLPGGSGGAVTASDDAATLAGLAYGVLGGLEVN
PIRNTRLVEVSYVATTPELAARIANGVADTYIDWGVETRFATVGKASTFLTSQIEALKQEIQDKEAQLQAYSRRSDIVAL
DPSSNVTLQRLEGLNKDYVGAMSERIGKEAHYKELANTPDDMVADTVSGGLVTQLRGEQLKLERDYATKLNTYKPEWPAM
QELKAQIDKGRQHLGNVTKEMVGKARDSARAEYQGALRREEALVAELTRQKSDAMQLNSAAVEYNNLKVEVSTRRTLLDE
LVRKQSETEVASRLQGTHDSNIVVVDRALVPGGPYRPSLRRNLGLGLVLGLALGLGFVFFLEYLDRSVKTAEDVDRILSL
PVLAVIPDVARSRNGYGYGGSYGYGYGQRRGKGQPGRPTLAGQRPGGDSGAGQIELVSHFKPRLAVSEAYRSLRTALLLS
TTNRLKSVVVTSAIPGEGKTSTAVNLAVVLAQLGRQVLLVDADLRKPRLHEIFGVSNRLGLVNFLTGSADETGIFLRTSV
PNLYLTPTGPVPPNPSELLSSERMMDLVAVAYQRFENVVFDSPPILPVTDATLLGAMSDGVVLCVGSGMVLREDARTCRQ
RLQLSEVRILGAALNRFREHHGRYGKRYRAYQKYVDDAAVGASPRA
>gnl|bykdb|A0A1F2QQH9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPHIGHO2_01_FULL_67_28] (length=772 residues).
MSDEKSVERYEPAARTLERRRPGVPAPLQTLEMEPAADLLSYWRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKAL
LEIEREGPNILTVQELFQIESASDTYLETQYRILESESLARRVVDQLRLDQLAEFSRPGFRLRGGKRETPASPQTFAVGA
AGVARDPVAYQNALETFSRRLAVAPIKRSRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLSEQLLE
IKANLEKSEEQLQAYARQNGLLFLENEAGQPENIVNERLLQLQAELTRAQAERIAKESLYRLTQAGEYGALPGIFENKLM
QDLTVQLAELRRQHAQAATTFSPDYPTVKQLQNQIDEIERLLAQERARAAERLANDYQAAMRRETLLRRAFADQQAQAGR
VAEKSVQYNILKREVDTNKQLYEGLLQRLKEAGMSAGMKASHVRVVDPAQPPDKPAKPSLALNLLLALVLGLGLGLAAVF
LQEHFDNSLKTSEDVERFLHLPVLALIPSLESLNGRRRAYGLPTPKRLASRSVLPAAAPLWHLVSGNGEGSTKLGEAFRS
LRTSVLLSTPEQAPRLLLTSSAQPGEGKTTVTLNLAISLAQLGERVLLVDADLRRPCIHKAFKMAGGRGLVSYLTGQQEW
EAVVHPSPVENLDLVICGPIPPNPAELLSSERLRAFLRQALQRYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTP
RELVQRAYVYARDVGANVIGAVLNNLDIRSDDYYYGRYYRYDYYGTGEHPPK
>gnl|bykdb|A0A1F2QXK7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPHIGHO2_12_FULL_67_30] (length=772 residues).
MSDEKSVERYEPAARALERRRPGVPAPLQTLEMEPAADLLSYWRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKAL
LEIEREGPNILTVQELFQIESASDTYLETQYRILESESLARRVVDQLRLDQLAEFSRPGFRLRGGKRETPASPQTFAVGA
AGVARDPVAYQNALETFSRRLAVAPIKRSRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLSEQLLE
IKANLEKSEEQLQAYARQNGLLFLENEAGQPENIVNERLLQLQAELTRAQAERIAKESLYRLTQAGEYGALPGIFENKLM
QDLTVQLAELRRQHAQAATTFSPDYPTVKQLQNQIDEIERLLAQERARAAERLANDYQAAMRRETLLRRAFADQQAQAGR
VAEKSVQYNILKREVDTNKQLYEGLLQRLKEAGMSAGMKASHVRVVDPAQPPDKPAKPSLALNLLLALVLGLGLGLAAVF
LQEHFDNSLKTSEDVERFLHLPVLALIPSLESLNGRRRAYGLPTPKRLASRSVVPAAAPLWHLVSGNGEGSTKLGEAFRS
LRTSVLLSTPEQAPRLLLTSSAQPGEGKTTVTLNLAISLAQLGERVLLVDADLRRPCIHKAFKMAGGRGLVSYLTGQQEW
EAVVHPSPVENLDLVICGPIPPNPAELLSSERLRAFLRQALQRYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTP
RELVQRAYVYARDVGANVIGAVLNNLDIRSDDYYYGRYYRYDYYGTGEHPPK
>gnl|bykdb|A0A1F2RFI7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10] (length=781 residues).
MSEEMSLEKIPPLKGEVPATTTVAAYTISQEEEAATPSFLDYWRVLRKRRWTVLGLLLLVVVTVMIGTLKQKPVYRAKAV
LQIDKESSNIFSFKDFVADIDPFDESYLETAYKVLQSRTLARRVIDKLQLDKLPEYDEKPSWFAKLLSKSRSESQQLPAE
DLALDPKYYNVLDNFQDRLTVNPVRRSRLVEISFDSYDPALSARTANALAANFIDQNLEAKWDATQKASDWLSQQLVGLK
GRLEKSEEDMQRYAKDNAILFLDEKQSLTTEKLKQLQEEATRAQADLFQKESLYNQVRTGDLSSVPGILENKLYQDLSIK
LADLRREYSELTATFTPEYPRVKRLKNQIEEIERTVQRERGAFAKRVTDDYRAALNRKRLLDQAVEQQTKEINQIAEKSI
PYNILKREADTNKQLYEGLLQRLKEASVSAGLRASNIRVVDQAEVPEMPAKPQKLVNLALALIFGLGLGVGMAFFQEYLD
NTLKTPEDVQRFLHLPTLGIIPAASANGRAGLSYGYGYGYGYGSRKSLPEDTSAPDGEKKLHPELIAGDGTNPLSEAYRS
LRTSVLLSTSGRPPRVILVTSGQPGEGKTTTVVNLAIALVQLGGRVLVVDSDMRRPRVGNLLELPATPAGLSTYLTGQFG
LDDVVTPTQIPNLFAIPCGPIPPNPAELLSSELMRQFLEQARQKFDYVILDSPPVLHVSDARILAARVEAVILVAHGAAT
PREAVNHAKQHLHQVNGNLIGVVLNNVDFSAVGYDYYYRYYRKGYGYGYGGYGSGCEEKQA
>gnl|bykdb|A0A1F2RZS3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_60_20] (length=783 residues).
MEENNSLERVSRGQIDAPASVPVSSYPVEVLEEQDSFPLLEYWRVLQKRRWTILSILLLVVVTVMIGTLKQRPIYEAKTV
IQIDRESPNILSFQGFVAEMNPYDDSYLETAYKVLQSRSLAYRVINKLNLAHSPEFAKEQESSPSWLGTLWPGGAEQPEG
PLSPEEQLDPKYSAVIDNFLGRLQIVPIRRSQLVEITYESYEPSQSARVTNTIAANYIDMNLEAKWDATQKASEWLSQQL
VGLKGKLEKSEEDLQRYAKENSILFLDEKQSMNAQKLQQLQEEATRAQSDLIQKESLYNQIRDGDFSSVPGILENKLYQD
LSLKLNDLRREYSDLSATFTEEYPRVQRLKSQIDQTAAALDRERQAFAQRVANDYKAAANRKRLLDQAVAQQTSDFNAMA
EKSIQYNILKREADTNKQLYDGLLQRLKEASVSAGLRASNVRVVDPAEVPTLPSKPRKLMNLALALMVGLSLGIGMAFFQ
EYLDNTLKTPEDVQRYLRLPTLGVIPAANAASRKKLAYGYGYSSRQTLAEVTSEAANGKPLSLELIGANGNAALSEVYRS
LRTSVLLSTSGRPPRVMLITSGQPGEGKTTTTVNLAIALVQLGGRVLVVDSDMRRPRIGTLLKLPTTPAGLSTYLTGQFP
LEDVLVGTHVPNLYAVSCGPVPPNPAELLSSKLMRQFLEQAAQKFDYVLLDSPPVLHVSDARILASQVEAVVLVAHGAVT
PREAVKHAKEQLQQAGANLIGVTLNNVDFSAVGYDYYYRYSRGYGYGYGEHPYARPEANKQDI
>gnl|bykdb|A0A1F2S1W5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18] (length=842 residues).
MSVPSQFERKSPESSVLGLDAAPDAGLAPQPSAATGGSGYGYGYGYSGSMPSGDSELSFIHYLQVLYRRRYVAATAFLVV
VLSVALYTFTAVRIYEGTVRILIERDDPNVVSFQEVLEQNEVTDDYYETQYRLLQGRGLARRTIDALNLWSHPQFTQPAR
PTVRSVIMMPVNAVARWFEPPRPVEPPDAAETRVQSRVINRFLAALDVSAVRYSRLVDVSFRSNDPALAARVSNALADQY
IKQSVELRSNTTKEASEFLVQQLAEQRNKVEASEQALQAYRERTGSVSFEERQNVVVQRLADLNAAVTKANTVRIQKEAT
YNQVKAVLENPAAIDTVPAILSNAFVQQQKTELAQLLRQRAQLSEKLGPNHPDMIKVNTAIQLAETRLQAEVAQVLQAMR
NDYEAALTEERTLANELNRQKIEAQQLNRTSIDYSALQRDAAANRQMFEALLKRTQETGVSEELKTGNIRVVDLAENPTG
PISPNIFNSLLMALLGGLTLAVGLAFGLEYADDRIKNPDEMKKHLGLPFLGMVPALFDKGAHTPLIGRGVSALFTESFRS
IRTNVLFSSTEEGGRLVVITSSAPGEGKTMVVTNLAVALAQAGHRVLLMDADMRKPRVHEVFGVPSSPGLSNLMVANATA
SEVIQESSTPGLWVLSAGTHPPNPSELLGSKRFKEFAAFLMQYFDWVLLDTPPVMAVTDASIVANLSHGVLFVVGSEMTS
RRVAQRAVEQLELGQAKFLGTVLNRVDLEHNSYYYSRYYRPEYGGYYGPGAPGGTQTGTGAGPPAANSGGVGTRAARVAA
ATAAKAASVAATVGSRLVRRTAESASGTLQPGLRTRGDIRHL
>gnl|bykdb|A0A1F2SVH2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_10] (length=755 residues).
MSEESPRIAMAGEDARAQTSPVYGYGSNVLGDTEVHLLDYVKVLYKRRWTALTAFLIVVLSVSVYTFTATPVFEARVQIL
IEKEATNVVTFKEAYEQNQVTDDYYQTQYKILQSRALARRTLDALKLWDHPQFNPKPDDSLTMRKIALAPVVLVAGWFKP
AQPLEPPLPDESKVQSNTIDRFLRALTVAPVRNSRLVDVRFDSPDAAFSATVANALARAYIEQHLEFKFLSSKEASDWLG
ERLAEQRKQVEASEQAVQRYREQTDSVSLEEKQNIVVQKLSELNAAVTRAKTERIEKEAAYNQIRTVQNDRATLDTIPAI
LSNGFIQQQKNVLADLQRQQAQLSDKLGPNHPDMVRLSSAVREAESKIQGEIAKVVQAMRNDYRQTVAQEQSLMSALEQQ
KSEALSLNRKGIEYGVLARNAASNRQIFESLMQRTKETGISGELKTSNIRVVDAAETPRGPVRPNTRNNLLLALFGGATL
AVGLAFFFEYLDNRIKSPDEIKQHLGLPFLGMVPALFDKALENPLISDGVPSNFSESFRNIRTNLLFSSADEGGRSVLIT
STGPSEGKTVVATNLAVALAQAGQRVLLMDADMRKSRVHIVFDRSQGPGLSNVLVGNAKASEAVHKTAVPGLWVMPAGPH
PPNPAELLGSKRFKDFMASLVEHFDWVMIDSPPVMAVTDSSVIAHLATGVLFVVGAEMTSRHAAQRALEQLEQARAKSIG
AVLNRVDLQHNSYYYSQYYRREYSDYYQNEGSART
>gnl|bykdb|A0A1F2T595 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21] (length=846 residues).
MSTQIPPEFSQKAPASQGSGSESPVFNAVPSNGSGGSGYGSGSYGGYSGYGYGTSVTSDSELTLVHYLQILYRRRYAAIT
VFLATVVTVALFTFTATRVYEGSVRILIERDDPNVLSFQQVFEQSDGADDYYETQYRILQGRGLARRTIDALDLWRHPSL
NQPPRLTIRGILFWPVGKLASWFEPARPPQAADAAETRTQTVVINRFLANLGVSAVRYSRLVDVSFRSADPGLAAKVANE
HSKQYIEQSLEFRTTTTREASDFLTQQLAEQRKKVEASERALQEYRERTDSVSLEERQNIVVQKLQELNAAVTRANTARI
QKEAVYNQVRTVLEDPAAMDTVPAILSNTFVQQQKAALADLQRQRAQMSEKLGPNHPEMVKINVALRGAETRLQNEIAQI
AQAIRSEYEAALAEERSLSASLNQQKIEAQSLNRAGIEYGALERDATANRQMFEALLKRTQETGVTEELRTGNIRVVDPA
EMPTGPVSPNIINNLLLALFGGMVLAVGLAFTLEYADDRIKNPDELKKLLGLPFLGMIPALSGNRASPPLISEGVPGVFS
ECFRSIRTNVLFSSTDEGGRMIAVTSSAPGEGKTVVSTNLSIALAEAGHRVLLLDADMRKPRVHEIFSRRVDPGLSNLLV
GNATASESIFESEIPGLWLMPAGTHPPNPAELIGSRRFRDFTAFLLQHFDWIIVDTPPVMVVTDATIAANFAHGVLFVVG
AEMVSRRVAQRAVEQLELGQAKFVGAVLNRVDLEHNAYYYSRYYRPDYGGYYGPPGGGGGGGTVAEPVVARPAAASILGG
AGAGARAARVAASAGTSFTRRTLASVFRSVQSGVRSAQNFRIERHL
>gnl|bykdb|A0A1F2TCR2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21] (length=762 residues).
MFDTHDLQQAPAIAIEAPPQLPMPPVAQSQQPLHVLDRLSAVFKHRRVAGAAFVIVVMAMMVQTYSTIPLYLATARVMIE
DERSIAVANLNANDPMFWQDSTQYYNTQYSILKSRVLGQRVVRRLHLQDNPAFNGQAPPRRGPLIAVRNARASLGKAIRR
LITRPIQTPAVEPAAPDENAAEAGIISQFIGSINIIPEQTTRLVSIQYRSPDPRFAALAANTIAEEYATQNLDLHLDNVL
GKLAWLDDELKKQQQKVTDSEAAMMQYREQKDALSLDSSQNTVLPRLNSLNDSVTRARLARLQKGQVYEQVRAVKPDSDE
ADNLSIIATSPGVVTAKSRLADLNSQRLTLSSRYMDTHPDIQKLDAQIAIAKKDLIAQRQRVIETAKTDYEAAVAEERSF
ASSLEDQKRVAMDLDRKSTDYSMLQRQADGDRKMYDTLLQEQKSLQVISNSRSNNVQLMDRAEVPAAPFTPNPRKDWFTA
IMAGLLVGVGLAFGIEYLDDTVKTPEDITKVLGLPLLGLVPAIRGERVPLLSEQVPHDFGEAFRSLRTSLVFTGKSEGPR
VIAVTSSQPLEGKTTTACNLAMVLALGGSRVLLIDADMRRPGLHKIVGIPNSVGLSHLLVGQVRVREAVQRTSEANLFVM
TAGRTPPNPSELLASERMKGFLTNLAGGPFDWVIIDTPPVLAVTDAVIVSRLVSNVVFVVGSEMTRRGHAERALQTLLSG
RPQSIGAVLNRVDFDRNKYYYARYYGYQYKSYYGQTNTTPAA
>gnl|bykdb|A0A1F2TPT3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21] (length=778 residues).
MSDEPRSNPPAEATPPDDIRLSMEGTAEPALRRYENDALWQGLEGEDRHFQYYLAVLYKRRWIAITALLVVLTFAINRNF
TAVPVYEASVRVLLDAERLNLVNVEDVIDQRRPLDTELAILRSRWLAAKTVASLGLIQNEPVAGRGAGNGVGKRDGQAGK
SGPDGWWSAASLFVSRAFGGFPPPPRAAEPLAGERPAEAPQISAFLGGLSLAPTANGVLDIKYRSSDPVLAARFANAHAQ
EYINENLEMRVAAVREVTGWLTARLAEQKEKLDASEQALEHFREQNQLITAEGSPIVMARLNELSASITRAQTGLFDKEA
SYNRALALRANPDKLDQLPQMLNNAALQQLRLELERLRRDRATAARTLRAQHPSMLKLEETIQATQAKLDVERSRVLEAM
REDLGVSRAAEANLGKELESLKIEATAQNRKNVELSILTREVASNRQIYDMFMQRARETGVAKDINPSRIRILDAATVPS
SPVGPDKGRSILGAVFAGLGLALVLAFGFEYLDNRIKLPEEIGQRLGLPVLGFLPEIKLKSGVTGPLATNGVPPEFSEEL
RRIRTNLVFSFAGDATRSVVITSASPTEGKTVVGSNLAVALAQAGERVLLMDADLRRPMIHTHFAFPQEPGLSNVLVSGA
KAGEVVRRSAVANLWVLPAGRCPPNPSELLGSYQFRKFLAALGQHFDWIVIDTPPVMAVTDACVVGHAVTGTLFVVGADM
VSRRTARRAVEQLMMANAKVIGGVLSRVDPGRFGQYYSSYYRGNSRKYRDYYKGAASA
>gnl|bykdb|A0A1F2U158 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29] (length=751 residues).
MSESSPAHPTPASAPTSSGAPRAPQPLTYAVDKDVHILDRLAVVYRYKRIALSVFLLTALALMIQGYSGEQVFQAKAQVL
IEDERSTAMPGIAAADYYQDPIPYYNTQYRILRGRDLARRVVKRIDLQNVAEFNGTAKPAETPVTKARDAGDRLLRFLAR
TPTPIAEVPKPDETADESALVSRFLGRVQVVPVAESKLVDVYFTSADPQFAATAANALADEYVASNLEVKMQGTQSMLDW
LEKEVATQQSKVEQSERDLAEYRDRENAMSLDEKNNIVLSRLNALNDAVLRARTTRIEKESVNNQIKSLGTTPVDSIPAI
AQNAQVQLHKAQLSELQRQKAQLSERYGEKHPDIINVNARLGDEQRQLDLETAKALQTVRNEYERAVLEERTFAANLEEA
KKDVQDLGRKSVSYNVLEREARSNRTVYESLLQRENELRVSSNSRANNVRVVERAEVPAGPLTPTGRRTWLLSFAVGLVA
AISVAYGLDYMNDTIKTPEDVTRMLKMTFLGLIPSVRGDKHPVLASSHAPHDFSEAFRSLRTSIASRYPGEGAKTMIVTS
AQPLEGKTTTAANIAMALAYGGARVLLIDADMRRPGLHRSLRLTNDRGLSQILTGQARVRDVIQRTVDPNLLAITAGRTP
ANPSELLSSERMKTLITNLRHGPFDWIVIDTPPVLAVTDAVILAPMVAGVTFVIGAEMTRRRLAERALETILASHPKMVG
VVLNKVDFARNKYYYSRYYGHQYKSYYARVG
>gnl|bykdb|A0A1F2USE2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_60_22] (length=808 residues).
MGEEIPDSKREVPDGRIERYEPSPPMLARPEPPVPVAYETVETEEAPDLLAYWRVVQKRRWTILTIFFVFLTLVLLWTLK
QKPIYGATVLLEIEKENPGLATVQELFELDAVSDTYLETQYKILGSESLARRVINQLRLDQRAEFNPPQPWWSWGGKETA
AAAPTLVVGTSEPEQDPAAYQGVLRRFQDRLAVAPVKYSRLVEVHFESEDPALAAQATNTLAANYIEQNLEARWEASQKA
SEWLSQQLTGLKAKLEQSEEELQTYAHEQGLLFLQNQRGENENIVNQRLRQLQEQLTQAEADRYQKEALYQLLAQGDYAS
LPGIHDNTVMETLTVKLAELQREHAQLTTTFTAKYPRVEQLENQIQEVQGLLGQEQDKAAERIRKEYGAAQQRQEFLRQA
FQKQEEQANLIAEKSVQYSILQREVETNQQLYEGLLQRLKEAGVSAGLKASNIRIVDSARPPEKPAKPKVLLHLAMGFLL
GLGLGVGAAFLQEYLDNTLKTPEDVERFLHIPALALIPSVESLSGRRGRAYGYGYGLYGQTRQLESGAEGTTEKGLARGG
TPHGWYRIDELDPQRSTLAEAFRSLRTSVLLSTAERPPRILLVTSAQPGEGKTTITLNLAISLAQLGQRVLLIDGDMRRP
CLHKVFQLYESGGLSSYLTGQAEWRRYALSTGVPHLDLMACGPIPPNPAELLSSERMRTFLQEALGEYSFLVIDSPPVLH
VTDARILARLAEGTVLVVKGAATPRELARRAQLHCRDVGATVVGVVLNNLDVRSGDYYYYYYRYYRYGYGYGYGSQENHP
PEDHAEQS
>gnl|bykdb|A0A1F2V330 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_60_22] (length=728 residues).
MPSDGTGKEISVLALLDIVMRRKLFVLIPAAVLIVAVGIYTVYQPPLYRAQALLGVEPGARNYVQTMDGSVARVQDQLLT
IREVLFSRPVLEPVMRNFHLLPMPDGKISDTDLDRMRESIKITVEGSDSFHLAFEGRGRTQVMNVTNDLSERFIRRLANM
REQQVNEGAGLLNAELETLRSQLNEQEERLKIYKESAVNELPDRLATNLSLFAATQAQLRSSSGLKANDQARLAAVQQEI
TELEKEGVLDAAPPKEKTPAETNLEERRLHLKQLRSVFTEQYPEVVSTEREIKELEKAVAAAPPKPTVAEPSAARMHYVQ
IRAEKESLEQRLTSYGQEERALESEMGRLQRRVQSTPQHEIAITELTRGYEATKTRYNALLAKQQEAGLASRPERMNKTV
AFRIVEPASLPKGPSTPRRSRLLLVGLFVGLALGLAVAFVAEQMDTTFGNIVEFQTFTNLPAIAVLPSMSADLDPGVKPL
TGTIPLIPPCGGDLSPTLLAFADLHRNHIVMVTDPHSVASEQCRMLALKTRQQLSGVRSPLLAISSVVGGEGKTVTSLNL
SLALAGTVSGRVLLIDSDLRKPRVHEYLGLKPGKGFSDLLRAPEDEIGKYVSKLGDLYIMPGGSSLANPVSLLASQSVRS
VFERLRGEFDFIVVDTPPVLPIVDTHILAGLVDGVILVVRARYTRREVLERGLESFQATKLLGAVVNDVDYQRSRYAYAY
QYQAGLPV
>gnl|bykdb|A0A1G7JVV8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Terriglobus roseus] (length=751 residues).
MPPLTNQPSDRVVPETNAGFSAITAESALSEALNVLRKRKWVLIIAAILGILYGVYQAATQPIVYVATGRIQVAKPNGQA
SLGVATGNLTGSLQSEDLETEVLIISSESLMLSVAQEMNLANNPDFMGSGPYRNINDPIVRAAVIGKLSNAFKVASIPRT
QMIRITVTANKAQLAADLVNHLINAYQQRSFESRFASTQRVSQWLQGQLDDLKQQVEASQEQLMDLQKKIGVLGLGADAS
KPVTTQVTAAVEALSTAAIAAKVQRILAESRYRVLASSDPALMESNLQASGAGQESELSKLRDDAAQTKAQIAQSSVSLG
PKNPQILALQAHLREVDREIKTEETRMVTEAKQALVAAQANEAQTEGALEDQKNQSYRLRDDLVEYTLRQRDYETNRALY
EALLAKLRSASVQAGLDALEIDVVDPAFKPIGPTMTPRSSILSRDLILSLVFGIMLAFALESLDTGIRSVSEVEHITQLP
SLSIIPRVRRMQSDGSGSATVAQTNIGVLATSKSQFSEAFRSLRTALLLATTGHPPKFILITSSTPSEGKTTVSTNLAAI
LAQRETRVLLIDADLRRPNVHHRFGLNGRVGLSTVLSGGATLEEAVKNVPEVPNLDVLCSGPVPPFPTEMLSSESMKNLL
QECGELYTHVVIDSPPILSVTDAVILAHYADAIVMVVRHGKSSRNVVRRARDLMVRSGAPVTGVVLNSVDINAPEYHGYY
GYSGYSYSNIDSESWESNGRENERNNKGGQA
>gnl|bykdb|A0A1H4T6W9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Terriglobus roseus] (length=765 residues).
MNQPVTHDPANPAGFTSTAADSALSEALAVIRKRRWILIACAIVGILYGYYLASTQPIIFTATGRIQVHEANSTATQMMG
SSLSQETNLENELGIIMSDSLLLNVARNMNLVNNPDFMGGKAARFRDINDPVVRTEVLRRLGGAVVATVIPRTAMVRITC
TASKPQLAADIVNQVINAYQQRSFETRFESTKRISQWLSGQLDDLRQQVETSQEQLIDLQKRLGVLGLGFDATKPPTTQL
AVSVDALSTASVGAKVQRILAESRYRVLANSDPDLLESNLDVAGGQSELSKLRSDAAETQASIAELSITLGPKNPKIVAL
QAHQREIQRELRSEENRLLTEAKQALVAAKANEDQTSSALEEQKQESYRLRDDLVEYTLRQRDYEANRTLYESLLSKLRA
ASVQAGLDSLEIDIVDQALKPAAPSITPRSTILLRTLLISLVAGLMIAFTMESLDTGIRSVAEVEQITQLPSLSVIPRVR
RLSSDTGTMSVAQNNIGVLATSKSQFSEAFRSLRTSLLLATTGHPPKVILISSSTPGEGKTTVATNLAAILAQRDTKVIL
IDGDLRRPNVHHRFGLNGRVGLSTVLSGGSTLEDAVKNVPEVPNLDVLCSGPVPPFPTEMLSSEAMHDLLLYCCSIYTHI
VIDTPPILSVTDGVILARQADAIVLVVRHGKSSRNAVRRSRDLLVRSGANITGVLLNSVDINAPEYHGYYGYSGYSYSNI
DSESWEAGSNATPGGGQGKARDGGNRSSGPGEPSGAEGHDGEDRA
>gnl|bykdb|A0A1H5SQF5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Bryocella elongata] (length=771 residues).
MPYDPLQDVTSRSASTHRRSAFRREMHLSDALVILRKKLWLIVGCVVVGVGLAVLLTSLMQRRFSSTVTIEVHKEGGTSL
SLEDLSGAGQQLIGGDQLSVDLLTQQAVIGNENIAMKVLEDLGLTNSQPFLALRPANATASGQSLLETDPTYRDSAVNLF
QSRLKITLVKGTRLVNVTYTDADPKQAARVANAVVEAYLISSTQQRYDATSKTSAWLTNQLSDLKNKVAESQRRVDDFRQ
KVGIIGAPTMSSAGSPQVGSDLGSVELARLNDLNAQLTAAETVRIAAEAAYRMTQSRDADVVLGIDSSQLNGAPGALASL
DTVRLHQLRTQTGQLEVQISAETQKYGPRNPAILSLKSELAELQRQTNEEISRVGNQAARNLDLARKTEDGLLQSVDREK
LRLGHMTTSADQLLLLEQEETSNRTLYQDLYGKLEAANILAGAKSSNVTIVNPARVPSGPSRPQPVQNIALGFLAGLATG
LFLAFATAYHNDVLSTPEEVASLTSLPLLGLVPQAGKRRRWAYAYPYAPTKKADAAAESEGKFAWVLKAPRSVVAEACRQ
IRTAILLSRAEQPRTLLFTSSFSGEGKSTLTSNMAFAFGLQGSRVLLMDADMRRPTLHTKLGLTNGSGLSQCLTSDIDPA
SVIQVHPDMDKVHVMTSGPVPPAPSELLGSPRFVKLLEQMKKEYDYVFIDSPPVLLVTDAVLTSTLVDGVILVVRSGVTR
RTPLRRALEQLAPSRNRLLGLILNAADIESSEFGGGYKYYGDSTYYEDSDA
>gnl|bykdb|A0A1H5Z7N3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Bryocella elongata] (length=772 residues).
MIPVRAQTSQASESEVVMPQAMQDRASGDTTLSDAWLTIRKRKYWILAAALIGILLALYQSATQPRLFEAYGNIEIRSGA
SNEYKIGAATGGSGIESSSAHLPTQVSILKSDTLLLTVARDLDLANNPWFLGTQKSKQAQPHRNIDDPVVRQMVLYTLRA
DVNVSVIAKTDLIHISCQTFSADLSAEIVNKLIREYIFRSLESSAEAQKRVSDFLSTQLGDLKQQVETSQEQMIDLQKKI
GILGFDPTHNEITTSLEDLNRAVGQAQISRIMAEVRYHTLSGMDPNQIDDSVASTQVGSSGNLTSGAPGAGDQQLATLRT
QMETTKADLAKLNVAMGDRNPQIRALRAQVDTLNQEIRAEQDRILAQARQNYIASRTNEQQTRGALEAEKSTAYQLRDQM
VQYTLRQREYETNRQLYDGLLQRLRSAAVEAGLESTEIEIVDNAVPPVYPTLKPRSTILMIDLVVALIVGLIVAFVLDSL
DTGLRDVMEIERITGLPSLAVIPKTRRTSAEQNATGLVARNIGVLAAPKSQFAESFRGLRTSLLLATAGKEPKVVLVTSS
TPSEGKTTVSTNLATVLAQRDVKTLLIDADLRRPTVHHRFGLNGKIGLSSVLTGSATLEQALQRVPELPNLDVLVSGPVP
PFPTEMLSSQVMRNLVEQCRGIYTHIVIDSPPLLSVTDSIVLAPEVDTVVLVVRHGKSGKQAVRRARDLLIRSGAPLAGI
ALNAVDLNSPEYYSYYGYYGYSGYGSQGVEHDGWASKSDKRKSKSKEERGGE
>gnl|bykdb|A0A1I6MH75 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella pectinivorans] (length=753 residues).
MDRQTTETTSPTGVPHTPGGGFAAATAATETTLSDALMTLRKRKWVLVACVLLGMVYGSYDAITQPRLYESHSRIQVRSG
ASNEYRVSAVPGMGQDTQTKMNTEIAIMQSDTLLLTVARELNLPNNSDFLEIKGKAPHASLDSPAVQAGTIRRLNGHLKV
SLIPKTEIIAISYTSLNAKLSADIANKVVSDYIQRSFETRFQSQQRVSAWLQNQLDGLKQEVETSQEQMMDLQKRLGTLG
FDPKDNQTTSTLEDLSKASGAAHIARILAESRYRMLSGMDPGTIDGTIDMNPGTMPVQFAQLRSQIALAKANYAQLMTTL
GPNNPKALELSNEIKELDAQLAAEQKRLLIQTREAYLATKANEQQTSAALEQQKTDAYKLRDDLVEYTLKAREYETTRTL
YDGLVSRLRTASVQAGLESTEIDVVDLAMIPASPRLQPYSSVVLTACIFALLVGIILAFTLESLDTGLRSIAEIESVIEL
PSLAIIPKARRTAAEQVGSLTTAQRNINVLTQPKSQFSESFRALRTSLLLSSTGHPPKFVLFTSATPSEGKTTTACNLAC
ILAQRDTRVLLIDADLRRPNVHHRFGLSGKVGLSTLLTGTTGLEESLQRVPEVPNLDIMASGPVPPFPTEMLSSAAMTSL
LERCATLYTHVVIDSPPILSVTDGVILARQADAVVLVVRHGKSSKQIVRRARDLLIRSGAPITGLVLNAVDLNSPEYYGY
YGYSGYSYTSIDSDSWESQKRAGENPVEGKNGQ
>gnl|bykdb|A0A1Q3QQB6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriales bacterium 59-55] (length=750 residues).
MGLQNTQPSADGDTSELNSPRFGSAVTDTALSDAILTLKKRRKILILAILLGLGYGIYKAQTQPKLYEAVGRIQVRSGSS
NEYRLSAVQALGGTDTASKMLTEIAILRSDSLMLTVARDMNLANNPDFIGKDAPHGNIDDPAVRQATVHALQSGLRIVLV
PKTEIINISYSSLNPKLAADIVNKVISAYIQRSYETRFASTQRVSRWLSSQLDDLKQQVETSQEQMMDLQRKLGIVGFDP
NHNQISSSLEDLSKAAGEAKIARIIAESRYRVLSGMDPDSVESSIDAAPGAAPQELTQLRTQLATARASYAQMQATLGPN
HPQAKALRAQIDELSKEVTKEQNRLLLQAKENFVVARANEVQTKAALEQQKTDAYKLRDDLIEYTLRQREFESNRTLYEG
LLQRLRTAGVEAGLESLEIDVVDQALPPAKPTLKRRSTVVLTGMVFGLLGGIIIAFIVESLDTGLSSVAEIESLIELPSL
AVIPKARRLSVEQSSTLTPTQKNLSVLSQPKSQFTESFRALRTSLLLATTGHPPKFILLTSATPSEGKTTLSTNLACILA
QGDARVLLIDADLRRPSVHHRFGMSGKTGVTTVLTGAAPLEEAVQTVPEVPNLDILPAGPMPPFPTEMLGSEAMDQLLRQ
CGDLYAYVVIDTPPILSVTDGVILARHADAVVMVVRHGKSSKHVVRRARDLLLRSGAPITGIVLNAVDTNSPEYYGYYGY
SGYSYSSGDSGSWEPQSDSRSKDRRTGETD
>gnl|bykdb|A0A1Q6Y9F5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_2_20CM_57_17] (length=777 residues).
MADENKLVPRENGSNGAVELVSLQSRVPSFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATAR
IEIDRENANILPFQGAESYEYMMDLENYIETQSKILTSETLALLTIRNNALSTRPEFSSPNGPSEAVASGSLANQKRPPE
LAEFLGSLSVKRVPNSRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASTWLADQLGELKIRVQKSEDARI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERMKKESLYQFAKAGNLDAVPEVQNNSALGDLFKKRSDAASQYTDA
LAQYGPNFPKVQRLQAQIKEFDQTIEKEKQNILNVLESDYHEAQQREALLTRALDQQKADTNQMAGKLVEYNILKREAEA
NKTLYEGLMTKLKETAISQGLRSSNIRVVDPAMIPSTPARPAKTRNIALAFLVGLVGGIGLALMREYLDNTVKSPDDVET
LSRLPSLAVVPQFASSNGRSKRHGFFQGLSSNGHDARIELVAQHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALP
REGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLAAGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLADAIAELRAKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLSSVKCRILGV
VLNAVDASAPDYYYSYRYYPYSYGYGPQEALDAPHENESDAIAHRVSRDRDDDSEAL
>gnl|bykdb|A0A1Q6YR79 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_2_20CM_57_17] (length=799 residues).
MDDQNQVELYSRGHRLDRRGPGALDGRVLELPDSYEILEPGEALDLRSYGRILRKRLPTILVVFFILFTGILIATLKQKP
VYRAQVLLEIQKENPDIPTIKEMYELDAVSDAYLRTQYSILASESLARRVIDQLQLETLPEFNSPKWWQFWPRNKKSPAP
QTFAIGPVPETRDRELSQRVLERFQDRLTIDPVNRSRLVTVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEW
LSQQLVGVKAKLEKSEDDLQSYARRNGLVFLETDKGASQNVANERLQQLQEQLTRAQSERYEKEALYRLVQTGEFGALPG
VFENKLIQDLSERLAELKREHAQLSTTFSPDYPRVKEIQSQVDEIESSLREERQRAADRIANDYSAAVRREDLVHQAVDG
QQKQVSLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAGVSAGLKASNIRLVDSAEPPAKPFKPRTLLNLSVAVFLGLA
LGICAALFQERMDDTLKGDDDVERLLGLPSLALIPVVPASNGDHLGIHRFLPRDKSLSLAGNGNGSGKDRRPSWHLIDRD
GTQHAALGEAFRSLRTSVLLSTPDRPPSSLLITSTQPADGKTTVACNLAISLAQLGHRVLLVDADLRSPSLHKLFGIDRT
LGLVSYLTGQQDWRAAVHPSGSRGLDLLVSGPVPPNPSELLSSQSMGALIRSASAEYGFVILDSSPMLALADSRILAPLV
NGVLLVVRSGATPREQLLHAQAGIRGVGGNLIGVVLNSVDIRTNGYYSYGPYGPNAGSPPQETFVPANFQMPPQQKASD
>gnl|bykdb|A0A1Q7CB82 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_2_20CM_2_57_6] (length=777 residues).
MADENKLVPRENGSSGAVEVVSLSSRVPSFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATTR
VEIDRENANILPFQGTDSYDYMMDLENYIETQSKILTSETLALQTIRNNALSTRPEFSSPNGPSEAVASGSLANQKRPPE
LAEFLGSLSVKRVPNSRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLADQLGELKIRVQRSEDARI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERMKKESLYQFAKAGNLDAVPEVQNNSALGDLLKKRSDAASQYNDA
LAQYGPNFPKVQRLQAQLKEFDQTIEKEKQKILDVLESDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYNILKREAEA
NKTLYEGLMTKLKETAISQGLRSSNIRVVDPAMIPSTPARPAKTRNVALAFLVGLVGGMGLALMREYLDNTVKSPDDVET
LSGLPSLAVVPQFAGSNGNGKRHGLLQGLSSNGHDKRIELVAQHLPKSQMSEAFRALRTSILLSQAGHPPQVILVTSALP
REGKTTAAGNLAVTLAQLGDSTVLVDADLRKPGIGRLLNLAGGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLVDAIAELRTKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLNSVKCRILGV
VLNAVDSGAPDYYYSYRYYPYSYGYGPQEAVEAPHEEDSDAIAHRVSRDRDDDSEAL
>gnl|bykdb|A0A1Q7N5R7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_3_65_5] (length=800 residues).
MPDHTSLRRTPPPPLTAADLSRAGTAVEKFSPNGDEGPDWHRYLTVVWRYRWWILAATALGTIGGAAASRFLPPRYVAQA
TIWIQTSGGNGPERGPIGANQLLVASAWTDLLKSYVVLDAVARERRLYLQARPRDMAVMATFAVADQYRPGRYHLKVDRT
GQHFSLQDEDGTELERGDVGAAIGRTDSLGFRWTPAAADLAPGAEIVFGVTTLRDASRGLSDGLRVSPDLSGNFLRIALT
GPSATGVTGVVNAVADRFVAVATDLKRAKLTELGRLLREQLQAAEAGMHRAESALEAFRVRTITLPGDPGVAAAGAPPRG
SPLGEFFSLRIEQDQMRRDADALEHVLISMRDPGALADALAPIGAVQRSADLTQALHELTTKRAEQRALAYRYTPDHPTL
QRVTSEIETLERTTIPALAKALATELESREAVLGTQITAGGRELRGIPQRAIEEARLRRDATIAENLFTSVQQRYSEARL
AEASSTADVRVLDAAVAPRRPVKDSASRLIALGFLAGLGFGVVGAVLVDRLDRRVRYPDQVTNGMGLRILGALPHVKNRK
AGPDDEQVLQVIETMRSVRLSLLHAYGTAGPMVITITSPAVGDGKSFVSTNLALACAQAGQRTMLVDGDTRRGALHRVLG
GVRKPGLTDFLAGRVPLEAVKQALPYPLLHFIGAGSRLRESPELLGSPAMVDLLVRLRADYQVILVDSPPLGAGVDPYTL
GTLTGAMMLVLRTGTTNLELARTRLAMLEHLPIRLLGVLLNDVQPGEMYGYYSYTYAGGYAAVDEDNSTRVARRRMQGVL
>gnl|bykdb|A0A1Q7NJH5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_3_55_6] (length=806 residues).
MKEPTELIEKSNGSRDVGGPWDRSLAPYTRYDSYADDSNGYSRLRDYWRSIRKHVWLVIGIVVVVTGLTAVYMARQPDVY
ESASRVQVDSETANNPAIGALKGNPIFLNYPSQDPTYFNTQIQILTSAGLLGRVAKTLDLEHNQAFLHPQSAQNLSFWES
LKGLIGFKKSQSKTKEQEEYVLRPNSALSNDDIAEANHLQPYVEMLQSQVSVKPLSDTRIIEIRFKHQDSEIAGKINNAI
ADTFVVSNLERKNETTNNAGDFLQRRIADLQSEIRSDEEQLINYAKNHQILSLDASQNTVVDRLAGLNKQLLEAENDRKA
AEAAYRAVLAPGALEAQAEATSNKSSAATEAKLAELKQRRAQLLLEYTEKYPEVKDVEQQIAMLEKQVDQVRTHTESVVK
TNLETSYRQALQKEEALRQAFAKQRAETLTQNEAAVNYRIIQQQVETNKSLLDGLLQRSKENEVILAGTPNNVHVVDHAA
IPKTPIGPKRMQAIVLAALFALIAGIALAHYLDYMDDSVRTSEDVENFLRLPALTVIPTIGNSARRRLLSAMPGSKRNGH
QVGPELLLNSSQRSALAESYRQLRTLVLLSSAGGAPKTLLVTSSQPGEGKTTTVVNTAMILAQTGAKVVIVDGDMRRPRL
HSIFNVDNDKGLSGILASKMSEREMLGWVQQHEESSLYLLPSGRLPPNPAELLGSDQIRTLMSVLGNTFTHIVIDSPPVA
SFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQLLSDVGAKIFGVVLNNVTVSKHDYYYYNQYRDYYHSAADTQPAEIS
PSTVDS
>gnl|bykdb|A0A1Q7RBU1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_60_7] (length=742 residues).
MSKYFELMNQLGRDSAAVQLTRAAPNLPNRYPQRLIDAPEQMSTAGLWRIIRNRKWTIAVFALVVVAIVVTASLLMKPQY
EAVGRVVFHRENDSGVLGFKSVHPSLLEDPEDRAAIDTQIGILQTDALAMQVINDLHLDKNPKFAGRAEQPVNEDRLVES
FHKNLTISKVKGTRLIEIQFRNTDPRLAADVVNELARAYVDQYYKSLFQVSTQISEFLANQLKELQAKVEESQQKLVDYQ
KENGIFGLDDKQNIVTAKLDDLNRELTAAEAERVQKEVNYRLASSGRPELIAKLEPDNLITKLRAQQADLENQMAQASVQ
LGPAHPKMGELSNQLAQAQRSVDAEVRRIGEHITYEYKSAVGRERMLRSALEAQKQAADKLNANAIQNNILKHEFETNRK
LYEDLLQKQKEMAISASLKSSNIWIVDPARPPKLPAEPKILRNLALSLLFGIFGGVLLAFGLTKMNEKISTLEQALALSP
LPSLGVVPLLEAKSKSRARAQLNGVNGDLKPEMVSFLQPLSLAAESYRALLTSILLSQSTPPAVILVTSALPREGKTTVS
TNLAIAIARLRKRVLLVDADLRRPSIHRAMGLKTTNAGLGALLRKSTAFEEAVMGCTDVPNLFILPAGPVNLPDDTELLV
SGFKDLVERWRDQFDHIIIDTPPVLPMTDAVHMSVEADSVILVIRSGQIARDEFLCAQDLLLKVNAHLLGFVLNGAGLSS
SDFQYYYGYYGQDQSKRLGKGT
>gnl|bykdb|A0A1Q7RLS4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_68_5] (length=711 residues).
MEEKREIHLLDYWRTIWRGRWTILSIFVVVFTLVAIGTFTQKPVYRASVTVEITPQSRKVSPVAEVAETGMAQYGWYAEE
RYFNTQYEIIKSRDVARRVFDRLDLYNHPLFKKSVDSIGAFSEMIVVAPVKETGIVEISMEGLNPEEVASWVNTISEVYV
ERNLDQVVEATSKAVKALLSEIAPLKEKLEDTQRTSFEFAEKANLYVPENQQKITNDRLSTLQSELTEAQVKKGEIEGLL
KQIDANRQNGGAYENIPQISGDTVVRDLYREKAGLEREYERLLVTYKDKHVRVLEKQKEIEETTQKIASEVDRIINGLRS
QYDLLKDREAKLIKATDETRTESLQVNRKASGYEMVRGEATETKRIYDLISARVKEIDLSSSLLSNNLRILDKAPVPKVP
VRPRTVLNLAIGMLLGILLGVGAIFFLDYMDNTVRTSDDVEQYLRLNLLAIVPKEADGTHSAFKEAYQTLRTSLLFSRKS
RGANTVLITSAGPQEGKSCTTVNVARTLATAGEKVIIVDCDLRRPAIHTRLNLGRDGGVTNYILSSEGDDWRSYIKNTDM
PNLYAMTCGPIPPNPADVFGHERFLSLLKELRAEFDWVFIDSPPVVSLADSMILASLADMVAFVIRHNENDKELIRRCVT
NVRRINPNVIGAVLNSVDLERSHYKDYYYVGYYYYGESSSSKKGRKRRSSSIAAVTTPDTEDQDRVTRIVG
>gnl|bykdb|A0A1Q7VA32 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_4_57_11] (length=799 residues).
MDDQNQVELYSRGHRLDRRGPGALDGRVLELPDSYEILEPGEALDLRSYGRILRKRLPTILVVFFILFTGILIATLKQKP
VYRAQVLLEIQKENPDIPTIKEMYELDAVSDAYLRTQYSILASESLARRVIDQLQLETLPEFNSPKWWQFWPRNKKSPAP
QTFAIGPVPETRDRELSQRVLERFQDRLTIDPVNRSRLVTVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEW
LSQQLVGVKAKLEKSEDDLQSYARRNGLVFLETDKGASQNVANERLQQLQEQLTRAQSERYEKEALYRLVQTGEFGALPG
VFENKLIQDLSERLAELKREHAQLSTTFSPDYPRVKEIQSQVDEIESSLREERQRAADRIANDYSAAVRREDLVHQAVDG
QQKQVSLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAGVSAGLKASNIRLVDSAEPPAKPFKPRTLLNLSVAVFLGLA
LGICAALFQERMDDTLKGDDDVERLLGLPSLALIPVVPASNGDHLGIHRFLPRDKSLSLAGNGNGSGKDRRPSWHLIDRD
GTQHAALGEAFRSLRTSVLLSTPDRPPSSLLITSTQPADGKTTVACNLAISLAQLGHRVLLVDADLRSPSLHKLFGIDRT
LGLVSYLTGQQDWRAAVHPSGSRGLDLLVSGPVPPNPSELLSSQSMGALIRSASAEYGFVILDSSPMLALADSRILAPLV
NGVLLVVRSGATPREQLLHAQAGIRGVGGNLIGVVLNSVDIRTNGYYSYGPYGPNAGSPPQETFVPANFQMPPQQKASD
>gnl|bykdb|A0A1Q7Y6W9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_3_53_8] (length=814 residues).
MKESRELITRVKEANELEVAGETFSPSPSAYKGYDSAAEDEVHLLDYWRSIRKRLWLVISITVLMTTLAAIYMARKPDIY
TAQARVQVDLENINPALGTNRNGVNINYRISDPAYFNTQLQILNSPGLLRRVVKTLDLEHNQAFVHPQSQSNRSTWQSIL
QMIGLSRSSTQEQNQQASQDIPLTTNVASAVASEDLAEAKRLQPYVSMLQGGLKVDPVKETRLLIKETRLIDISFTHQDP
QVAAKIINALADTFVLSNQEKRNESNNTTGGYLQRRIADLQGEIRSDEERLINYANQHQILSLDPGQNTVVERLAGLNRQ
LLEAENQRKLAQAVYEASLQPGASEARAEDANKQIQQYEANLVELRRKRAELLVENTEEHPDVQQVEQQIAEIERQLKEA
KSHAANILTTNLKTNYLQAKAQEDSLRDAFNKQRSETLVQNEAAVNYNIIKQGIETNKQLLDGLLQQERTNDVVGEGTPN
NIHIVDYALVPDGPVGPNRTRVVMLALVLSFGFGIGFALFLDYLDDTVRTADDVEKVLRLPALGVIPSIEGKTRRKLLPS
VGSLQIRNGKGGINQPELIFSTDGRSSLAEAYRQLRTSVLLSTAGRAPKSLLVTSSQPAEGKTTTATNIAISLAQTGASV
LIIDADMRRPRLHTIFETENRKGLSTYLSSDMSDAELLDMIEQHGASGLHYLTSGPVPPNPAELLGSEQMRKLLSCIEKT
FTHVIIDSPPIASFTDGVLISTIVDGVLLVVHGGKSSRHVVRRARQVLQDVGAKIFGIVLNNVNISSHDHYYYQRYYQQS
YYDSENKVAPEAQG
>gnl|bykdb|A0A1Q7YFI6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_3_53_8] (length=811 residues).
MEKETQLVKASVEPRVVELQANGNGAGLPYGSYAYGSSEPQEESGFSRLQAYWQSVRKHLWLIIGIVVLITMIAAVYMAR
QADIYEAKSRVQVDLEVNNPGIGAMKNTSYILEQQYQDPTYFNTQIQILSSPGLLSRVVKTLDLEHNQAFLNPQAAQSRS
TWENLKRMFGFGRPANNQQSVPQNMMPLVDSSLAPATIEGDIAEVNRLAPYVGMLQGGLSIKEITDTRLIEIHYTHPDPQ
VAAKIVNSIADTYIISNLEQKTKNTNSAADFLQRRIAEIQSEIRNGEERLINYAKNNQILSLDGSQNTVVERLAGLNRQL
LEAENERKLAEAAYRAAQAPGAAEALARENRNKQAEEQLLELRKKRAELLVENTEDWPEVKEIDRQIAILEAQVNQSHSE
DVSTLKTNLETRYHQALAREESLRQAFDQQRAQTLTQNEAAVNYRIIQQEVETNKQLLDGLLQTAKGNDVVMSGTPNNVH
VLDYAPIPKSPVGPRRMQGVALGFLFSLVIGIALARYLDYLDDTLHSAAEVDEMLRLPTLAVIPAVGNASRRFLPKMTAL
QKSDNGDHGSLLEPDTRSPMAEAYRQLRTSVLLSSAGGAPQALLVTSGVPSEGKTTTALNMAQIMAQTGATVLLIDADMR
RPMLHTLMNLDNARGLSTILSTDMSAAEMLSLIEQQAGSGLYLLSSGPVPPNPSELIGSEQMQRLLATMRTSFTHIVIDS
PPIASFTDGVLMSTMVDGVLLVVQGGKSSRIVVQRAKQYLQDVGAKIFGVVLNNVKLERQDYYHRYYYKNHYYSKHRDEE
EISSDVSTINQ
>gnl|bykdb|A0A1Q7YKQ8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_3_53_8] (length=796 residues).
MVSQDNRLLPLPQERGLDRPLSSLPHSKSYGYGAAAESTHLRDYLNVVLKRKWLILTLMLVVTSLVAIQMYRLPPIYQAE
ATIQIEPKHDSILKAGNNVVINTGGGDDAQYWNTQIKLLESQQLARQVALTLDLQNNSAFLGNQSQHGLFTALRRIFSSE
RTTNASPATRTNLPVISPERVTEQQLTPEQLTRLEPYEDALAGNLTVEPVMTTNLVMLKFTHSDPVLAQKIVNTFADTFA
YNNFERETQGTAKATELLAQKIAELQLEIRRQDEERVNYIKLKNLPPSKSPGADLAADRLAQLSKQLLEAENNRKNLQSL
YEAAAHQSNPMAVPDVADSKRIQQLREKLDQLKQKRSELLVIYTVEWPEVKRVDEQIKTIEEALTKAPGEVLATMKSKYD
AAVTTENSLRASYNQQHSEFSQQTQDQIQLTMIEQEIETNRQYLTTLLQRQRELENEQTGRMQTNNVSVSQYSREPRAPV
GPPRLRNILIAFLLSLGAGIGLAFLLDYLDDTLKSVEDVDRYLHLPALALIPSTRSEQRLRLKGGAQAEHGESTALALVA
DARSSIAEAYRHLRTSILLSSAGQPPKTILVTSSQPSEGKTTTAVNTAVMMAQTGADVLIVDCDLRRPRLHAQFNIPNAR
GVTNYLSGEAGLDELIRSYDKLPNLKLMTSGPVPPNPAELLGSDEMRKLLSELSERFTHVIIDSPPAISFTDASILSTLV
DGVILVVHGGKSSRAVIRRAKQQLLDVGAHIFGVVLNNVKLESTDYYYYAGYYSSYYNSDDEPDVEAASAGESRTS
>gnl|bykdb|A0A1Q7ZJT1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_68_7] (length=718 residues).
MPDSLNPLEEKREIHLLDYWRTIWRGRWTILSIFVVVFTLVAIGTFTQKPVYRASVTVEITPQSRKVSPVAEVAETGMAQ
YGWYAEERYFNTQYEIIKSRDVARRVFDRLDLYNHPLFKKSVDSIGEFSQMIVVAPVKETGIVEISMEGLNPEEVASWVN
TISEVYVERNLDQVVEATSRAVKALLSEIAPLKEKLEDTQRTSFEFAEKANLYVPENQQKITNDRLSTLQSELTEAQVKK
GEIEGLLKQIDANRQNGGAYENIPQISGDTVVRDLYREKAGLEREYERLLVTYKDKHVRVLEKQKEIEETTQKIASEVDR
IINGLRSQYDLLKDREAKLIKATDETRTESLQVNRKASGYEMVRGEATETKRIYDLISARVKEIDLSSSLLSNNLRILDK
APVPKVPVRPRTVLNLAIGMLLGILLGVGAIFFLDYMDNTVRTSDDVEQYLRLNLLAIVPKEADGTHSAFKEAYQTLRTS
LLFSRKSRGANTVLITSAGPQEGKSCTTVNVARTLATAGEKVIIVDCDLRRPAIHTRLNLGRDGGVTNYILSSEGDDWRS
YIKNTDMPNLYAMTCGPIPPNPADVFGHERFLSLLKELRAEFDWVFIDSPPVVSLADSMILASLADMVAFVIRHNENDKE
LIRRCVTNVRRINPNVIGAVLNSVDLERSHYKDYYYVGYYYYGESSSSKKGRKRRSSSIAAVTTPDTEDQDRVTRIVG
>gnl|bykdb|A0A1Q8B793 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_60_10] (length=780 residues).
MEENGSKLAAHDNGANGAVEIIQAPLRMPVFDLSPHEPHLYDYLLILRKHQWLILTFLLTVVTIVSIATFRMKSVYVAPA
RIEVDRENANFLPFQPADPYAYLLDQENYIETQSKILTSETLALQTIRSVGLAGHPDFSEGGKPSEAVTTGSLANQNRPP
ELAAFLGSLTVKRVPNSTLLDVAFESTDPRLAARVVNAHIENFIEHNFRSRYEATTQASSWLAGQLNELKIRVEKSEDAR
IAYERQNQIWTIDDKQSITTQRLGEINKELTEAQSDRMKKEALYQLAQSGSLDALPAVRDSELLQDIYKKRNDAYTQYTS
ALNQFGPNFPRVQRLQEQLKEFDGLIDAEKKNIVTSIENEYRAARQRELLLLKALDQQKAEANQMAERLVQYNILKREAE
ANKALYEGLLTKLKEAGISAGLRSSNIRVVDPAMIPSSPARPAKMRNISLAFLVGLVGGIGLALLREYMDNTVKTPDDVE
MLARLPSLAVVPAFIDTNGRNGRRRFLRGLAAATNGREARVELVSHHLPKSQMSEAFRALRTALLLSQADHPPQVILVTS
ALPREGKTTAAANLAVTLAQLGDKTLLIDADLRKPGVGRALSLGEGKYAGLSSYLAGVSSLDLVTVPHPAIENLAAIPTG
PLPPNPADLLSSHRITDAIAELRAKYKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGQTPKEAFTRSRDLLTSVKCRL
IGVVLNAVDSTAPDYYYSYRCYPYSYGYGEPQAGELPASTEQDAISRRRPPEHEDDTQAL
>gnl|bykdb|A0A1V6HR88 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium ADurb.Bin051] (length=742 residues).
MKVFTARWRLIALTTLLAIAGGVLAYLVTPKEYRATTTILIERRLSIPVQSAVEAAWENYYSMEFYPTQYRLLQSRGLAE
RTVQNLRLDQDPAFNPARASLAGSDEGGSAAADQSALARLAGRLLGGLEVKPVGQTQMVDISYRSTDPALAARIANGVAE
TYIDWGIESRSNLAGKTSVFLGAQIETLKQEIQDKENQALAYSKRADIVTLDTGGNVVLSRLQALNADYTRAVSERIGKG
AALKELEVATPQIAAEILPDPVVAQLRGEVVEMEREYASRLATFKPEWPAMVELKGRIDQARGNLIPAAREALAKAREAA
RAEYQGAQRREAALAAEINSLKVENREVNSASIEYNNLRLEIDTRRQLLDEMLRKQSETDVSSRLQATRESNVRIVDRAL
VPGGPFRPSLRRNVTFAGGAGLVLGFGLVLLLHYMDRTLKSSEEVERLFGVPVLAVIPDVGAGGKGYGLRGRYGYGYGYG
YGYGEKPAKARARKPGKGGGNGEPTQIELLPHLRPRMPVAEAYRALRTALLLSTASELKVIVITSSIPGEGKTSTASNLA
IVLAQLGKNVLLIDGDLRKSRLHELFGMSNRAGLVSYLTGQVPPEQIVLRTDIPNLYAIPAGPSPPNPSELLSSERMRDL
VRQLRLRFDYVVIDSAPTLAVTDATILGSIADGVVLTACAGRVQRQEAKACRDRLQVAEVKVLGAVFNRFRVGGGPYRKG
YAAYQTYAGYGEERSGGEVAAR
>gnl|bykdb|A0A239HDF6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella rosea] (length=731 residues).
MPGSIPQAADASLADALLTLRKRRWVLIVAFVLGAAFGLYRAFFQPRIFEAYGRIQVRTGSADQYKLTSPVGLGQDTMTQ
MMTETAILQSDTLLLTVAKDLDLCNNPAFLGRKTAPEPRRDLNDPQVRQGTLLVLSSNLKIAMQPRTNILRLSYSSLDGK
LSAEIVNTVISEYIQRSYETRFASTQRVSKWLSKQLEDLKADVEASQEKMINLQRRLGILGFDPTHNQISTSLDDLAKAS
GQAKLARIIAESRYRMLSGMEPDAIEGSIDAGPGLPPSGLNALRTQLSTARSTYAEQEATLGPNHPQAKSTKAQIDELAR
QVAAEQNRLLLQSKENYLIAQANEEKTNAALDAQKADAYKLRDDLVEYTLRQREFESNRTLYEGLLQRLRTAGIQAGLES
LEIDIVDQAVPPASPMLRPKSTLVLTTLAVAMILGVLIAFLLDTLDTGIRSVTELEAITEMPSLAVIPRLRKPAGAAVPD
TSPLPVISQPKSQFTESFRALRTALLLSTAGREPKLLMFTSAAPGEGKTTTSINLAAILAQRGARVLLIDADLRRPAVHV
RLGLEGRLGLSTYLSGSSTLEESLQHLDELPSLDILTSGPVPPFPTELVSSTAMRELLRYAGEIYTHVVIDSPPILSVTD
GVELGGMVDAVILVLRHGKSNKHVVRRARDLLVRSNCPLKGIVLNAVDLSAPEYESYYGYSGDGYANLDNGWSASFRGKN
GRKNRTKGDQA
>gnl|bykdb|A0A239MKT6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella rosea] (length=764 residues).
MAFDNNDASIASDLNDAEQGSSDLTLESVWEFLRRRKIWIALGIVLGFLSGLAVYLHTPPLYTATAIVELNKDSSSGLGL
QELSGLSDSLSGGMELNTDMLTHQRILQNDNTALSVISSLNLMQEPPYNEIPKGKLHDVYERERSLPLKDAPYTRDRVLA
IFHKGLQVEVLKSTRLLAVSYTDTDRNRASKIANYVVQAYLQDNTENRYQATSMASTWLTTQLEDLKRKIEENHRQVAAF
QQKSGIVSEGMSAPAPSAGGGARGNIGAMAPSVDSTAFQRLSALNEELTRAEVARIQREALYHIIQTNDVDLVLNSASSL
GAGLAGGNEMRVLGTLREQASAIKIRMASESVKFGSQYPAVLELQNQLNSIDAQVHEQMVRLNSETRSSYLLAKADEDGI
RKRATDQRQQVLELGNSLTALTFLQQEENTSRGLYQDLYTRLQEASISAGVRSTDMVIVDPARPPSLNSSPNASRLLATG
TAAGLLLGLLIGIALHLRDRFLYTIEDFQAAWSAPVIGVVPHFVENGQSKNVPASPDKQEDAAWLIRAPKSKSAESYRQI
RTAILFSRIDDPPKVILFTSGISGEGKSTTAYNMAVAFALQTKRVLLIDADMRRPTIRERVNLQQGRGLSDLLSLNLELD
EVLQQHPNQDNLFIIEAGTIPPMPAELLGSKRFLAILEKARKEFDYVLIDGPPVLLVTDPLLIAPHADAIVAVFRSGRST
KQVVRATASMLRQYSGRLLGYVVNDVESNQTAYGYGYGYDAYYQ
>gnl|bykdb|A0A257VBK0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 37-65-4] (length=717 residues).
MADSDPPQVQAEFSAAQDVDLLHWVQILWDQRFWIAGVTAAVVILVALYTFLATPIYSATATVYVQTYSRQPMSGFNPTG
ASSWMEEQKFYNSQQQIMTSSVVMQDVVDKLKLQSHEAFKDVKDPAAMLRGMTKVDNIRDSALFRITVMAPYKADVAIWA
NAIAEAYQDRMLKDALDFIAKANEVMLAEAKKMQDQYARQQTTMTTSLAASGSYFPQNQKEILDTKIASINERLTQVGVK
ESEVAAIASQLEAWRTSGGDPLSIPAVAQDPSVQDLAKQYNELNRDLGKLQAKFTPKHPEVLKKQEEIRGLKERISQQAE
TVLGSYRNQLSALRGERANLAQEVDGARREGLQFVEGLSRGEGLNTSSAAIKKYMDLLYDKMSELNVSSSLMSSNVRMVE
PAQPPMAPVKPNKRMNLLMGLLFGLMLSVGSIVAWQYLDTSVKSVEDLETRMGVALLTMVPKFEPETQKVSAEAFQTLRT
AMVFATDNHQNNAILVTSASPKEGKTSVSANLAKTLAAGGDRVLLMDCDLRRPSIHRILKAPAGVRGLTNYLAERTAQIE
DFVVPGPQPNLFVLYSGPTPPNPPELFSMKRFRDLIERFKGEYSWVIMDSPPCLSISDAFILGGMADRTILVARYKKTRK
PLLERILVTLARAHVQVAGVVLNEVETHSSYYYDYYYYNHYYYATGTEPKRLPWILGKSGGWKDVFKGKKNRREYPE
>gnl|bykdb|A0A2G6PYV5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=757 residues).
MQDNQPFDQQADFNIFHYIGLLRKHFFLTLSLLILGLGLAYLAWLVKPPLYKSSVLIKMNHLSMDVIGFTEKLQWNPYRE
EYFKTEFRIIKSLPVAEEVARTLGVKYFREQEQEDAQPKNLLDLGTVNEPREKTQKTKEDQAKEITKIASNLIGGVEIKE
VKDTNLVRISYTDTNPERAMILANTWVKAYIAHSLNMTYDKNLEAYNFLEEKSNEYRQRIMELYSQLGEQQKNSEDLIVG
RAKSAVEEQALVKLNEEIAVANRSFIEKRNNLQALQASTPSQAIEVNQNVAIKDLSSQISRKKLEYEANLSKYKPQLPKM
VALNAEIKSMEKRLANEQKKLYNRLIQSISKDVQDRKNELAYLEAQRKKQNQKIVLADLKTKEQNASLDSKIQVLEQNSL
VIDKRKEYLELALGLKEIGRTDKVIVEHARLPHSPYAPSLKRHLFSGFIIAAGLAGLLIFLIEITDRKIHNTEVLEMVTV
LPTLATIPKVSGFNKGKITKNKVKQKAMATKLRQEIGLLTHLKPNDAFSESYRHLRTNIQLSKTTDNKVLLLSSALSGEG
KTVSSLNLAISFAQLEKKTLIIDCDLRRPKLHKIFNLPNAKGLVTSLVKGKSPIDFIQSTKIPHLFLLSSGPLPPNPAEL
VASQKMREVLTELKANFDFIIIDTAPLLAVTDASILGNIVDSLIFVTKASATSRDEVARALHMLSQNKIKPLGTLFNDYD
FTKGKKYYGYKYGYRYKYGYGYGYVPYSYNTPDDPTG
>gnl|bykdb|A0A2N9LQU7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacteres bacterium SbA2] (length=749 residues).
MQNIPEQQLARVTARGRISGPVPLPPALRNPDVSLGEIWLKIWKRRVAASLFASGIFLAVILYTFLKKPVYESVAQIRVD
SSQQGSLGLEDLVSQKLADSDSEGGRLQTELTILQCPPVSMQVIKNLDLGHREEFAGKTLMASVTAIDPVKMDPLSREKL
LLKFHDAEKLEVLPKTRVIEIRFQNVNPKLASDVVNGIVDAYLQRNFDVKYQGAVQVSEWLSKQMEELKLNAARAEQRLA
EFQKQNNILGTDENNNIVIDRLRHLNSQLADAEGDRIIKEARYRLASTGNPELVAAVVPSTTLQALRMQEADLKSQYAQL
DAKFGSGFPRVQELQAQLARLDQNIADELTNVGQRLHDEFLAAQNSESLLRDQFEHQRQEAFNLNASAVQFATLKHEVES
SQELSDTLQLKLKEAGLMAGLASADISIVSRGMVAARPAFPKKSLMLPLGFLISVFGGLVFVFVLESFDDSLRTSEEVEA
ASSIPALATIPLITRRSLRKDMRGRNHQPGLGGLGTMAVQRPASLLAESYRVLCNSLLLTAADRPPQLLVVTSAFPSEGK
SVSSCNLAITLAQRGSRVLLVDADLRRSTLLRQLGLEAGTSAGLSSMISGNDASEAVRKPFPQLPTLEVIAAGPQTPWPA
ELLASKKMGDLLEQWRTEYDHVVVDTTPLLFFADTMPLAAKADGVLLVVLAGRSRRKAMIRTLDLLARAKAHVLGMIVNG
VALEPEYVNSYVTYGYSKGYGDIDAKRSA
>gnl|bykdb|A0A2N9M9N1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacteres bacterium SbA2] (length=759 residues).
MAENDKLIPVSAVSSDRLGYSGYPVTDLDPAGSEAYSFQSYWEILRKRRSTVFAAAFLVTLLVTVVVYRMKPIYRATARM
EVQAETPALQTLNELGPSGATDAAFLQTQVDLLQNNNLSWQTMQELGLANGNTELGVGGDLWPVSTSRSTVATPANLIRS
FKKHLHIELLTESRLVEVSFESVDSNLAARVANTLVKNYVEANFRSKYETTRQASAWMEQQLDELKAKVEKAQQALVDYE
REYSITNLGDKENVVQQRLAQLSTDLTAAQVERANKQSVYDSARHNNAEAAVLAEDALLGQLESKNAELHTEYAAATSQY
GPNFYKVKQLGNQINEVEELIDRERKRIMERIESDYRTAVRREQLLSQDVSAQRTEVEKLNQLLIKYTILKGDFETNQQL
YDELLKRLKDATVSVSLRATSVRLADAALVPATPIRPDKRVDIAVGLLVGLILGVTLAFIREGLDRTVKTAEDIENQIAI
PTLAVIPLGTRSRGRYGRYFARGALKPPGNGSPGLAIMNAPGSEMAESFRVLRTSILLSSSPQPPQVLLVTSAHPSEGKT
FASVNLALALAQRGGRVLLVDGDLRKPTVLRALGMGNGESEANGLSSYLAGGQGIDSALMSFTALPNLSVLPSGPVPANP
AELVSSPAMGRLVSELRQRFEHIVLDSPPLLLVTDGVLLSTLADGVVLVVESGSTSRGALHRVRQILDRAGAKTLGAVLN
KLDDRVDGYYTSRYKYYGYYYSQEPSASKTPDLYSAGDR
>gnl|bykdb|A0A2N9MK30 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Candidatus Sulfopaludibacter sp. SbA3] (length=740 residues).
MNTSLQELTIVEERGPRSLPVAAGFGPAQPASWDLEPEEQTLPLSHYLWVLRRHRWKILSFIGVSAIATLIVSARLTPMY
EATVTVDVDRKVPTAVVGQDSTQTGLNDADQFLATQIKLIQSDAVLRPVADQYHLRDLERKARAGSDQGLLIDAPVLLKQ
LKVTRPVNTYLLLISYRSPDRRLAADVANAIARSFVEHTYDIRFRSSASLSTFMEKQLEELRAKMERSDTALAQFEKELN
VINPEEKTNILSARLLQLNTDYTNAETERVKKEAAYKSVSTGSLESAQASTQGDALKTIAERLEQAQEKFAEVKTHYGPN
HPEFHKAQTQLDQVQAQFDATRGSVMRRVEVEFREGVNREEMLKKAVTETKAEFDRLNARSFEYESLKHEAEADKKLYEE
LITKIREAEINAGFQSNTVRIADNARPGLSPVFPNVPLNVGLALLFAAILAVGAAVLSDTLDNTIRNTEQVARIVKAEVI
GGLPQVKSWKSRPALVAAGGAASTPVLLRHPDDDRLLAGFGEAVRTLRNSILLSSFDRQIKSLMVTSATPGEGKSTVCVH
LAMAHAQQNHRTLLIDCDLRRPSVHRRLGLTSETGLSAVLLHGLAWRDCVMQAPGVPNLDVLPAGPTSRRASDLIGRALP
QILEEAAGDYDLVMVDSPPALGFPEPLQMATAVDGVALIALAGQTDRKALASVVSMLQRLRANVVGVALNEVTKDIGDSY
YYHGYYGKYARYYNHKTETA
>gnl|bykdb|A0A2P6WFK7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=750 residues).
MRPAACQESHMPEIEQDSLATMRESGLKRFGNDSVTERELSVTEISRTIFKHKLLILLTALTVFGIITLRTLTMTPVYES
AVRLQVDPSRSSSLGLDEMISQKLGGSDDINSVLQTEVKVIQSDTVAMRVIDSLELAKRPAFAGKYAASAKLTNPSAMPP
ADRQRLVSAFKQSLSVRVLPNTQIVEVLFRCTDPKLATDVANAVVEKYMQHTLQTRYEGTVQVSNWLSKQMDDLQTRATQ
SQQRLSEFQMKNNMIGADENDNITVDRLKLLNQQLTEAEADRIVKEARHRLAATRNPELLGTVDPNLQTLRTQEADLKAQ
LAQVSAKYGNGYPKLRELQTQLSKLNAAIADEVANVGRRMETEYQSAAKTEAALRNQFNKQKEEAFKLNEHAVQYLVLKH
DVENSRDLYDTLQLKLKMAGVTAGLSSGYISIIDRAEIPATPVEPRIKRNLALGLFGGVIAGLLLAFGVEALDDTLSNSE
ELETCLALPVLCTIPTHQQQPPATSNSREAPKAVPLAPILLGSPRSQAAEAFRGLRTSLLLSSPDHEPKIITVVSSVPAE
GKTTVSVNLASAFAQRGESVLLIDADLRRSTTHTHFGLPYSRYGTSTVLTRGMDERAIVTPLKSLPSLKLMPAGPHPPNP
AELLGSKRMIELLESLSGEYERIIIDTPPVLSVADSLALSNIADAVVLVVRSRIARKRAVLRVRNLLRRSNANLVGIVFN
GVDMLLEQYYYAKGSYYGKSMGNYYLSEDE
>gnl|bykdb|A0A2U3JZ71 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Candidatus Sulfopaludibacter sp. SbA4] (length=749 residues).
MVGDKEMVENNLTPALPAPLEALPGRNLPVPMEVYRTSNLMPEVEAAPSSVPLSHYLWILRRNWWKMLLFVSCAVAATLM
VSARLIPVYESTSTIDIDRQMPSAIIGQESTRTVANDSDQFLATQAKLIQSDSVLRPVAQQYRLLDTEAEGSDATLSRVP
GAEDAPVLLKNLKVSRPPNTYLLLISYRSTDPRLAADVANGVARSYLEHTYNIRFKSSASLSAFMEKQLEELKAKMERSS
GALVQFERELNVISPEEKTSILSARLLQLNTEYTNAQADRVRKEAAYKSVAGGSLEAAQVSTQGEALKRLSERLDEEQQK
FAEIKAHYGPNHPEYRKASLQLAELERQLQSGKENIGQRVEVEYREALNRESMLRKTVSETKAEFDALNARSFEYQSLKR
EAEADKTLYEELVRKIREASINSGFQNSAIRIADLARPAFKAVFPNIKLNVLLAFLLSTLLAIGTAICADLLNNAVRDPE
QVARTLSTEVIGTLPSVKEWHGRITAASEPGTDLIPHDPSRGTSLNSFQEAIRTLRNSILLTDFDRRIRSLMITSSGPAE
GKSTTAAHLALAHAQQGRKTLLIDGDLRRPSIHRRFEVPSTRGLSNVLTSGIPWRTVLVRPDGHPNLDILPAGPPSRRAA
DLVGAELTTLLEDACGDYDLVVLDSPPLLGFPEPLQMAASVDGVLMVALAGQTNRKALGSAVNTLKRLRANTVGVVLNDV
RADSSDNYYYYHYHPKYYKHYSVEAENEI
>gnl|bykdb|A0A2U3KC61 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Candidatus Sulfotelmatobacter kueseliae] (length=755 residues).
MPLQPKRNNSDALEALEPIDPLPVKGPQSVYPHFAQPQNSILHYWQILRKRKWAVLATFAIVFALSVIKTLRETRLYQAT
SKVAIFEENPNVLGFKDVENNLPDFDYQATLETQAAILRSDVLALKVIKAMHLDPNPQAEDAMQPDPAREAGLLGAFRGG
LSVQIIPNSRLVQISYTHPNPRLAEAIVNKLVDTFKEENTNAKYESVNETSEWLKAKLDDLRRKVQTSEEILVRYQKDHS
ILGVDEKQNIVTAKLNELNNELTVAQTDRIQKESNYNLAMAGDPAEFAKPSREGTSSMLEKLREKEADLNTQYAQATTQF
GSGYPKVVELKNQLKQVRTEIVAEETRMQHGVRDEYLAAVQRENLLTTAFNQQTQQANQLNESAIEYSVLKRDAEANRQL
YQDLLQRFSEASVSETLKSSNIRVVDFARTPTSPITPNVPRNIELGLLLGLACGIGLAFVLESLDTSIRNMEELSAISTL
PALGTIPLQLSSNGYLRKRLKTVSAETEKPESPALVAYARPKSEAAEAYRALRTSILLSSFGAPPKVILVTSAMPQEGKT
TVSANSALVLAQRGSRVLLVDADLRRPSIAKLFGFQSRGGLSTLISGSDKVEDVVIPCPEVPNLWVLPAGPIPPQPAELL
GSAVMKDHIAHWRNVFDHVIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTKAALRRACDLLLQVNARVMGIVLNALNR
HSIEEYYQYGGRYANHYYHEESPEDKPTAAASKVS
>gnl|bykdb|A0A2V2R0I6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MADEHKLVRRESGSNVPVEIVPPANRLPAWELSPREPHLYDYLLVLRKHQWLILSFMLAVVTIVAIATFRMQPVYTATAR
IEIDRENSNILPFQGPEAYDFYSDSESYIETQSKILTSETLALQTIRNSGLSARPEFSTPTGPSEAVAIGTLANQKRPPE
LGEFLGSLSVKRVPNSRLMDVSFESTDPQLGARIVNAHINNFIEQNFRSRFEATSQASSWLTDQLSELKVKVQKSEDARI
AYERQNQIWTLDDKQNIATQRLGDVNRELTQAQSERMKREALFEFAKAGNLDAVPQMQNNSFLNELIRKRNELNAEYNDA
VSQYGPNFPRVQRLQAQLKDLDATIEKEKQNILNGLEADYREARQHENLLMRELEDQKAQANAMAEKLVEYNILKREAEA
NKTLYDGLMNKLKEVGIAESLKSSNIRVVDPAMIPSYPSRPAKARNLALAFLVGLVGGVGLALLREYLDNTVKSPDDVEN
LARLPSLAVVPHFTGSNGNGKRRALLQTVAANGHEKRIELVAQHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALP
REGKTTAAANLAVTLAQLGDSTVVVDADLRKPGVGRLLNLSNNKYAGLSSYLAGASSLDLVTVPHPAIPNLAAIPTGPLP
PNPADLLSSHKLSDAIAELRTKYKFVVIDSPPVMAATDAVIVSVQTDGVLLVVRSGETPKEAFTRTRDLLSSVKCRLLGV
VLNAVDSSAPDYYYSYRYYPYSYGYGPQEAMGGPHDEDSEPPEERPFRDGDEDSQVL
>gnl|bykdb|A0A2V2R525 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=781 residues).
MKEDQITKHSSIHDLDSPYNVFPFPPVIQTGERQDQSQASLAFYVQIIRKHFLMIIALTALCTLTTAVYMARKPDVYGAA
VRVQIDVESNPASGINGKPVVINNSASAPDYFETQLEILKGSGLLRRVVKTLDLEHNKAFFRPQMGQRTTWQRLLDMVGM
GRDSGDSSQPVDDGVLMTSSVAPATDKEDLAEIKRLNPFVGAIQSGLEVEQVGKTRLVEIRYTHRDPHVAAKVVNAIADT
FVQANLEKMTETNSGAGAFLKKRIYELQEQIKNGEERLINYAKDNQIISLEPSQNTVVERLNSLNRSLLTAENDRTLAEA
AYRAALEPGAAEALAASNQSTAAAKLSDLRQRLAQLKAEYTDKWPEIKVVQEQIAEIEKQDVENKTNSKSLAVKGLETKF
REAQRREQEIRDAFEKARSETITQNSAAVNYRILQQEIQTNQELLNGLWQRYKENDVILAGTPNNIRVADYANTPERPIG
PQRTRGVGLAFAFSLAFGIGLALLRELSNNTVRTMSDVTRSIRLPTIAVVPTVKSWPASKLLPSRKLFLQPRNGNKNGRP
LIMYDDAHSRLAEVYRKLRTTVLLSRPGKTPKTLLVTSSMPAEGKTTTAVNMATILAQTGASVLIIDADMRQPTLHEIFQ
LDNSHGLSTLLAGKNNQAEMLSLIHQHEETGLYVLPAGPPPIKPAELLSSGQMRRLLEITSPSFTHVVIDSTPVVSFTDS
VLIANLVDGVILVVQGGKSPKEIVQLSRKELMDVGANIFGVVLNNVDVTAQDGYYYYRPTA
>gnl|bykdb|A0A2V7U3M2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=734 residues).
MEGTSPVTPTPPTSSESEAQETHLWEYIYIVLRRRRLVLAVFVAVTALATLRALLTRPVYEASAQILIERDTPNVLTFKE
VAQVDAARDDYYQTQYKLLQSRLLARRVIETMNLLQDPEFGGPRSPEEMEAVKAAAPGASPVMERAIDSFLRKLRVLPVK
NSRLVLVAYESYVPEMAAAAANWLSQLYIKQTLEFRYETSSEAAQWLGQQIEEQKAKVEAADLALQKVKEQEGIVNIEER
RTLLEQKLKELGTALTTLRTDRLEKEALYNQMRNAANPEELPDVMRSPLVQALRIELATLERSQAQLLERYMDQHPEVVK
VRNQIQETRKKIAAESQRVIRAAENDYKAAAAQEASVSSALEAAKAEALDLSRRSVQYDNAKREADAGKEVLNSLLSRHK
QTDVAQELKNSNIRIVDAASVPRSPVRPQKTRDIAMGVALGLFLGIGLAFFLDYLDNTIKTPEDVRKQLGAPLLAVIPEI
SVPGDIVIIQGGVESPLADGYRLLRTSLTYSWPESSPRILLVTSTSAGEGKTVTSVNLALILASLGGKVLLIDCDLRRPQ
SNTLLHAKRSPGLSDLLVGRARPSEAIQRPAGTTLSLLAAGTRAPSPADLMTLQTMRDFLEGLRGFYDWIVLDTPPVGPV
AEALILAPLTDGVVVVVGAEMVPRNGVRHTLERVHETGARLLGVVLNRAQVEKHSYYYGRYYGHYYGRYYGAPAPRPAVA
RGKVAHIREKRSAR
>gnl|bykdb|A0A2V7UGP8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MDVLSQKEINLVDYWNVLKRRRWVVFTAVVVLVITVTLGSFLIPPSYQAICTLQIEREQPNVLTFQQVQPVGYDYMSYND
FYQTQYRLLASHNVARKAMLKLDLRNDPVVNRLVNRVRHKGPFTRLAEIVRHSPLDEIPEDPDKPYIQFVLSGLDINPLK
NTHLVEISFVSVDPELSSRIANAVANSYMEFNQSARYDTSAQASEFIGTQTTELKKQVSDLEAKLNQYGKENEIIGLDDK
ENITNQKLGQLNQDVLEAQVESSRKEARYRGLLTTPPGSIKEVTQSNLIQQLRQKTAELEREYTQKSKQFKPDWPDMVRL
QAEWDSARKTMAEESQKIFDDTLKTAKMEYEEASAHEKTVRGALEGQKSEAIKQKQYGVEYSNLKAAVDSKREILNKLMQ
RETETGSLSQLKNAGTGNVWVVDAAEIPDRIFRPNKKMNILLSLFVGLALGVGMAFFLEYLDNSIKSTSDVEKYVQLPTL
GTIPMVVSSALAGESAGGRRLRREPVSPAVDLVTLRDPASPASEAYKTLRTSLLLSTADAPPKIIVVTSSEPQEGKTVTT
LNTAISLTQSGKKVLLVDGDMRRPRLHKALGSGNGHGLSSYLSGNAELDPIIQETEIPNLFLVSSGPVPPNPSELLASEH
FDFLLAALKSSARFDHVLIDSPPLLSVADPVIMASKAGATILVVQCGRTSRPAVIRGRQKLTQAKANILGVVLNDVDVRH
GEYYSYHYGYRYRAYRYESGPDRSEATGPAPPPAV
>gnl|bykdb|A0A2V7UHT0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=741 residues).
MWPRRTVLSKELSSVTPIPPAGSEGEPQEAHLWEYIYVVLRRRRLVLAIFLGVAALATLRALLTRPVYEASAQILIERDT
PNVLTFKEVAQVDAARDDYYQTQYKLLQSRALARRVIESMNLLQDAEYGGPRSPEEIEAVKAAAPGASQLMEGAIDAFLR
RLRVLPVRNSRLVTVTYESYRPDMAAAAANRLSQLYIQQTLEFRYQTSSEAAQWLGQQIEEQKTKVEEADRALQKVKEQE
GIVNIEERRTLLDQKLKELGTALTTLRTERLEKEALYRQMRGASNPEELPEVMRNPLVQSVRIELASLERAQAQLLERYM
DQHPEVVKVRNQIQETRKKIAAESQRVIRAAENDYKAAAAQEASVSSALEAAKEEALDLSRRSVQYDNAKREADAGKEVL
NSLLSRHKQTDVAQELKNSNIRIVDGASVPRGPVRPQKTRDIAMGLALGLFLGIGLAFFLDYLDNTIKTPEDVRKQLGAP
LLAVIPEIGSPTDVVIKSGAETPLADGYRLLRTSLTYSWPDSSSRILLVTSTSPGEGKTVTSVNLALILASMGGKVLLID
CDLRRPQSHTLLRGKKSPGLSDLLVGKARPSEAIQRPSGTTLSLLAAGTRAPSPADLMTLQTMRDFLEGLRGFYDWIVLD
TPPVGPVAEALILGPLTDGVVVVVGAEMVPRNGVRHTLERVKETGARLLGVVLNRAQVEKHSYYYGRYYGHYYGRYYGSP
PAQTAPARGKVANIREKRNAR
>gnl|bykdb|A0A2V7V2I1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=725 residues).
MSTTAPAGQAGVPEETHLWEYLHVVLRRRRLVLAVFLTVAAAATVRTLLTRPVYEADVQILIERENPNVLTFKEVARVDS
ERDDYYQTQYKLLQSRALVRKVIEEMDLFQDPEFGGPQPAEQRAALKASAPGSSRVMEAAIDQFLSRVKVQPVRNSRLVL
VGFEAYRPELAAQAANKLSQLYIQQTMEFRYQTSADAGLWLGSQIEEQRHKVEQAELALQKLKEKDGIVNIEERRTLVEQ
RLRELGTSLTALKTQRIEKEALYRQMKEAPNSEELPEVMRNPLIGSLRVELASLQRQSVQLQERYLDQHPEVVKNRNQIT
ETREKIASEAQRVIRAAENDYRAAVAQEHGVADALEMAKREALELSRRGVQYDSLKRELDASKEVLNSLMARHKQTDVAQ
ELKASNIRIVDAAAVPGSPVRPNRPSDIAMGLFLGLALGVMAAFFLEYLDNSIKTPEEVRLHLGVPLLGVIPEHGQDSGS
PVLSNSHQQGPFMEGYRVLRMALSYSWPGQDSRVLVLTSTAPGEGKTLTSVNLALTLATMDGQVLLLDADLRKPQAHELL
GLKKSPGLSDILVGLADTAECVERVKGTNLSLLPSGSHAPSPAELMSPQLLRGFLHGLRAAYSWVLIDTPPVGAVADALI
LSSACDGVLIVAQAERVPRKAVLHTLERVKDTGARILGVVLNRVPMEQNAYYYSHYYSHYYGHYYDDQHPKRQDEPAPMT
KQATR
>gnl|bykdb|A0A2V7V2Z1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=761 residues).
MAYSFGYRLRSSSRCPAPTWPPGPSRSERRRGSPAVSPSASSGYEGEPQEAHLWEYIYVILRRRRLVLAVFLGVAALATF
RSLLTRPVYEASAQILIERDTPSVLTFKEVAQVDAARDDYYQTQYKLLQSRALVRRVIESMSLLQDPEFGGPRSAEEIEA
VKAASPGASAVMERAIDEFLGKLKVVPIKSSRLVMVSYESFRPEMAAAAANGLSKLYIEQTLEFRYQTSSEAAQWLGQQI
EEQKGKVEQAERALQQVKEQEGIVNIEERRTLLDQKLKELGTSLTTLRTERLEREALYNQMRGAANPEELPEVMRSPLVQ
SLRIELAGLERQQAQLLERYMDQHPEVVKVRNQIQETRKKIAAESQRVIRAAENDYKAYAAQEASVASALEAAKAEALDL
SRRSVQYDTAKREAEAGKEVLNSLLSRHKQTDVAQELKNSNIRIVDPASVPRGPVRPRTTRDILYGVFLGLALGIGLAFF
LDYLDNTIKTPEDVRKQLAAPLLAVIPEIANPAEVIIKSGVESPLADGYRLLRTSLSYSWPEAASRILLVTSTSAGEGKT
VTSVNLALILASLGGRVLLVDCDLRRPQSHVLLRGRKSPGVSDLLVGQARPSEAIQRPAGTTLSLLASGTRAPSPADLMT
LQTMRDFLDGLRGFYDWIVLDTPPVGPVAEALILAPLTDGVVVVVGAEMVPRNGLRQTLERVRETGTRLLGVVLNRAQVE
KHSYYYGRYYGHYYGHYYSSAPSRPVAGSKVARIGDKRSAR
>gnl|bykdb|A0A2V7VMF7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=1207 residues).
MDVGQPAGFPGYDMDTFRTGVGYEVGPSMRASMGYERQRVPGAPDRPVIEAEADSVFLKVTDDRGPAGSGQVEVAYRDQR
SPRAAAAGQRFRGLNYAATLRRAVGVNTLVELGGGRATDVSGFEANAFYVSSFARGGLTVALPWELSLHAGRGGLGLEPL
PTGRERDRAPARRRPLWLVRGSEPVVRPPPLPARGLPARPARLQHPRLRSRDPRIHRPARDRPVPRQGHRGEGHAVKSLA
LLLAALVLPGARMVAQEAPRPPATPAPEYVVGPGDILQITVYGNEELSRAPTVQSNGTIGLPLLGDVAVTGLSASEIQRK
LTALLARDFLVNPQVEVKVKEYQSQFVSVVGEVNNPGRKALRGRTRLFDVLIEAGGFTPRASGEVVITRREGTFDNGGHS
LRLQFSGASPAPKDLVNLEVPLQNGDLITASAKYYVTVEGEVVRPGRYPLEEETTISTAVIAAGGLTRFAKNDVRIRRVS
PETGKTEILEADLKAIRNGKETDLLLXXXEDGDAPMSTAPPVFDPPSERELDLRYYAGLVWRSRVFIVALGLVGLGLGFV
VALLQTPQYRAGAMIQIEPPAPTFMTVTDALAGMGNYWQNADFYNTQFRVLKSKTLGSRVVERLKLDDRPPFKDNPEAGA
LFVTHVGVEPIPESRLVTVAVTHQDAKEAALWANTLAEVYVEQTLASRVEAAKKAYDWLQERLGETQKGMREAQDKLAKT
YQGQDGFVPEGSGGSAAASSIGKLNEDYVAAQARRIGIEAALKQFAEMRKARKNLDTIPQVATDPVVAGLNAQIATFTVE
LSRLKEKYKEGHPEVQKVNKQVVQIQKAKEERAAQIADGLQAEFAQLQKRESELRDAIDAQKADAARQSQKKTEVEVLKK
EAQSAASLYDVLLQKLNESDIAASIRTNNASVVERASPPLAPVWPNKRKMAGVGILVGVALGLGLVLLRDFLSNTVRDPE
EIERYLHLDLLSAVPRYEADAEHLVTEAYQNLRTALLFARKDDAGQVVLITGTAPQEGKTTTLVNLAKLLAGSGERTIVI
DCDLRRAQIHQRLEISRAPGFTDYFVRHEDLDSLIQSTRVPNLFALTAGPLPPNPPAMLARKNVADLFSHLRRQFEWILV
DSPPLASVTDALLLARHADLAVMVVQHNNVDKKLVKRSVVALRKATPNLLGAILNAVDLKTRSYHYYYYQDGEAGKAEAR
PEAAVKG
>gnl|bykdb|A0A2V7VYF3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=758 residues).
MSKRIGHDETAEDTRPQAESYWNDDRDADNAAPEEAHLLEHLRVLYKRRWTAVTTFVLVVLAMMLRTLNGIPVYEARVQL
LIDVEAPKVLNFKDVFDQGHSPYDYEFTETQQKLLTSRSLARKTLDALRMWQHPYFGGPTPNTTSSSSTRGAIGFTNGIL
ALVRGAFQSKAETIGREKRAPAESAAESQAIDAFLGGLVINPVKNSRLVDVVYRSPDPVFATTIVNELAHQYIQQNVELR
FHASKDASDWLGQQLAEQRKKVEVSELAIQRFREDNDAVSLEDRQNIVVQKLADLNGAVTSAKNERITKEAGYNRLRTMA
DDRSALDAFPAILSNSFVQQLKSELADAQHKQAQFSETLGDKHPDMIKARSAVDTALAKLNTEIDKVVESVHNEYLTALA
REQDLVAALNAQKNEALGQNRKAIAYGALQRDAASNRQMFEALLQRTKETGLSEELRATNVRIVDAAEVPRSPAGPNTRT
DFLLAVLVGGVVAVGFVFGLEYLDNRIKSPDEITAHLRMPCLGLVPAAPDKYATGGAPLINNGVPAHFSEAFRTIRTNVL
FSSVEEGSRTIVVTSTGPGEGKTVVSSNLALALAQANQRVLLVDADMRRPQIHSYFSHPQEPGLSNFIVGNSEVGDVVRP
SGVPELWLLPSGLIPPNPAELLGSMKFKEFLATLKERFDWVIIDSPPVMAVTDACILAHGAEMTNRKAARRALKQLALAQ
AGLMGAVLNRVDVEHHGHYYSGYYRAAYARYYGAPAHD
>gnl|bykdb|A0A2V7W309 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MDLNTQQEVHLSQYWNVIRKRWKVAAAIVLVVMIGTFLASYFSKPLYQSWIQIEVEEESQNVTIEDLFGIASSDQEFLQT
QYELLKSRGLAMRVIEDHKLLNDRDFYGPGVEGKTKAEIDQITQAMAGGLLGGVNIAPKHGTNLIVITYTGSSPKLAQKI
AEAWGDSFMRMTIAKKLDSVRQATEFLSQQIATVQANLEESRQDLLSYGKSKGIISVDEGSNVTLQKLGKLNTDVTSAQG
DMYDKQARYNSIQSTAPETVAQQDATVIHLNEELSRLQRDFNAKRAQYTEAHPVMQDLAQQIEKTKLARAAAVREAYSRA
LEEARAQVSAASSREGSVRSAYEQQRTEAQRLNVDAAKYFDLRMAVDSKQTLLAALQKQLNETQVTARLRGSASSNVHWV
DHAETPGSRINLSMKKNLQTAFPLGLFLGFAAIFFLEYMDRSIKTPEELERVTKFASLGVIPAAGTISRQYGYNYSYGRA
SGPQLRAVDAPPEEKPSPGIELLPHLDARSPVSEAYRAFRTSLLLASANSPKIIVITSSFAREGKTTTSVNLATVLAQMG
KPVLLIDADLRRPRLQKVFPGKLNLGIVNYLAANIPFEDTVQPTQVPNLSVVLSGPIPPNPSELLASDRMKHLIQELREK
YAFVIFDSPPVLAVTDAIVLAASADGVVLTVHGGYTPRELVQRSAERLRLSNIPVLGALLNNLDLQQYGYTYRKSYYDYY
DSNQDNAERRGQRADGRR
>gnl|bykdb|A0A2V7X2F7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=730 residues).
MASPSQPPPSEPAGEDHLWDYLAVVLRHRKFALAIFLTATAVATIRTLLTRPVYMATAQILIEREKSNVLSFKDVTEVDA
AKDDYYQTQYRLLQSRSLARRVVESLNLLQDPEFGGPRSPEEVKGALAAPPGSSPVMEGAIDGVLGRLRINAGKGTRLVG
VGSEAFRPDLAMNVANKLSQLYIEQTLEYRYQTSSEAGVWLGGQIDQQRQKVEQATQELQKLKEREGIVNIEERRTLLAQ
KLQQLGTALTETRTVRLEKEALYRQMRGADVPEDLPEVRKDSVVQQLRMDLSTLEQKQTQLLEQYLDQHPEVIKVRRQIE
DTRKRLSAEGQRVIRSAENDYKAAAAQEASLAAALESTKEEIQELGARSGHYDSVKREVEASRAVLNSLTERHKETDVAQ
ELKASNIRIVDPAVMPNGPVRPNRQRDILTGALLGLVLAFGAAFFLEYLDNTLKTPDDVRNHLGAPLLGVVPETGQSPAD
LLIQKGGSTQSTFAEAYRVIRTSLNYSWPNTVPRIIVVTSTAPGEGKTLTSVNLSLTLASSEGKVLLIDADLRRPQAHTL
LRGRRTPGLSDVLVGKAKPSEAIQVFAGGHSLLPAGTTVPSPADLVTGQAMRGFLEGLRGVYNWIVIDTPPVGAVSEPLI
LGPLADGVIVVVGAEMVPRKAVATTIERIKESGARLLGVVLNRARVQQHGYYYGRYYGHYYGHYYGHYGQQTEAPNRGKV
ASIAAKRGRR
>gnl|bykdb|A0A2V7XDY0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=696 residues).
MPSPVPAPAGGSSESPIDFRYYGNLLWKNRILLATAAVLGLALGLVIAFAQTPEYRASVMVQIDPPTPTFMSVQEALGGG
YWQNADFYNTQFRVLRSSALGEKVLDRLKLKDPAEHRDAGGEFMSHVNVEPIPESRLVLIHVTHRYPKEAALWANTLADV
YIEDTISTRVEAARKAYEWLQERLGATQKSMREAQDRLFKSYQSQDLFVPEGSTSAVTSSITKLTADLIEAQARRIGLEA
ALKQIAQLKAANQPLDAVPQFAADPTIMILNTQVSAANNELTRLRQQYKEGHPEIQKLLLQLDQAQKTKERQGTQIIAAL
RADYEQLQKRESELRGAIDTEKAQAASQSRKAAELDAIKKEAESAKGLYDVLLQKLNETDIAASIRSNNVSVVERASAPT
SPIRPNKKRIAAVAGFLGLLLGVGLVIARDYLDNTIKDPEEIERYLHIDLLAAVPQYDEANVHFVTEAYQNLRTALIFGR
KDERGQIVLVTGTVPQEGKTTTIVNLGKLLASSGEKAVLVDFDLRRGQLHSRLGLTREPGVTNFFVNHEDLDALVRPTRV
PNLFALTTGPLPPNPPAILTRPNMQDFLDRLRGHFSWILIDSPPLASVTDAQLLARYADLTTFVVQYNTADKKLIRRNLS
ALRKVTDTVLGVVLNAVNVKAKGYYYYYYPHDVETSKAPNKPSESKPAEDIAVGNR
>gnl|bykdb|A0A2V7YW66 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=782 residues).
MSPLSPVPFEEEPEGAAEPASELNFGEYLGIARRHWKLAAVCCLLGLAGAAVHYAITPKAFQATATIQIERRNLTPLGNG
GQNPWLENYWNMEFYPTQYELLQSRGLAERVVKSLDLMEDPAFNPGAAARKDGGRGPTAEDDDAVLGSLAEQVRGGLSVA
PVRSTQLVQLAYTAASPEFAAKAANAFSEAFIDMGVEDRYATAGKASTFLGTQIETLKKEVQDKETQLQAFSRRTDIVTL
DPATNVILKRLEVLNGSLMEAKRVRIEKEAKYHETITGPKENVADSLSGGMVTELRKEVLNLQRDYDTKLKTYKPDFPEM
VTLKAEIEKSQQHINDVVKELTEKARNAAAASYQTALRQEQSLDGELTTLKGQAIDQNSAAVGFTNLKVEIQTRRDLLNE
LMHKQSETEVAVRLQDTRQSNIRIIDKALVPGGPFRPSLRQDVTYGLLLGLLAGLGLAVLIELMDRTVKSPEEVERRLGL
PPLAVIHDVTEMGKAYGYAGGYGYGYGYGEPGAGDKPRPVRPARSAAEKRGDRKERKERKRAAAAAGAPQIELVPHERPR
TLISEAYRSLRTGLLLSSARELKTVAVTSAMAGEGKTATAVNLAIVLAQLGRQVLIVDCDLRKPRLHQVLRVSNRHGLVN
QLTATGEEAIFPTEVPNLWITPSGPIPPNPSELLSSDRMRDWLRTMRSRFDFVVLDTPPALAVTDATIVGLLVDGVVLTL
RSGKVTREEARLCRDRLRQAGVKILGAVLNRYRSLQTGLGKRYKYYEAYGAEESEPKAGSAA
>gnl|bykdb|A0A2V7YYV7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=478 residues).
MELGRYLRVARHRLWMIIACPILAALSAGIVSFALPPVYEAHAALLVLPSNLGTSDPNVIPLTPDQILRTYALLLTQRKL
LDEVIADLRLKTRPDDLAKRIKATPQPNTTILDIAVDDTNPALARNIANDLVDKLIGELKDIQTSHLQVPNSRLSDVLVP
VSPAVVPDRPVSPTKALNISIAFGAGLLLAVGLAYLLERLDQSIKTNEDLTERLGLLPVGHIGYVLAGKGNRGELITLDA
HSHASEAYRALRTSLLFSAIDRELKEIVVTSAEVGEGKSRTAANLAIVLAQAGHWTLLIDADFRRPAQHRMFARIRNVGL
SNLILQDAAESEAIATVESVPNLCVLTSGPTPPNPSELLGSGRMRELMARLRTSFSYVIVDTPPVNAVTDASILSASANG
TILVVEHGQTSFPALERAKQMLDRVGAHTIGVVMNKVRASSGSYAYDYGYYAASPDGHARPGRRPSSKSEAPTSSSGT
>gnl|bykdb|A0A2V7Z0J5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=480 residues).
MELNRYLRVVRHRLWMIVACPLLAAVTAGVVSFALPPVYEAKVDLAVKPAQLLPSTDPNAPSISATTILATYALFMTEPP
LLNKVIADLGLKTTSDELVKQVKVTPDATTALVLHINVQDTNRARSRDVANTLVSEFIKEVNQIQQAETQSTNARSGDTF
VVLSPAVLPKNPVSPNKALNVAVAFVAGLLLALGLALLFDYLDQSIKSDAELTDRVGLISLGHVPFLVAGKGKRGELVTL
DAQSHAAEAYRALRTGILFSGVERSVKQLIVTSAEMGEGKSRTAANLAVVLAQAGYKTLLMDADFRRPAQHRIFARVRNI
GLSNVIIQDAAEEETITAVDAVPNLWLLTSGSIPPNPSELLGSGRMRELIGHLLANFNYVIIDTPPVNAVTDAAILAAYA
NGTILVVEQGRTTFPAVGRAKQLLDRVGAHTLGAVMNKVRASGSSYAYEYGYYATPQADPSAPDVEPLARVKPSRSARNA
>gnl|bykdb|A0A2V7Z0V0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=774 residues).
MSPLTPVPLDDEPEVAPEPESELNLTEYLGMLRRHWRLAAVCCALGLAGAGIHYAITPKAYQASTIIQIERRNLTPLGNT
QNPWLENYWNMEFYPTQYELLQSRGLAERVVKSLDLMEDPAFNPGAAREGAKGGTAEADEAVLGALADQLRGGLAVDPVR
NTQLVQLSFRASSPEFAAKAANAFAESYIDMGVEDRFATAGKASTFLSSQIEKLKEEIQDKETQLQAFSRRSDIVTMDPA
ANVTLKRLEALNTQYIEAKKMRIEREAQYHETQSGPRESMSDSLTTGVVSDQRGQILKLEREYETKLKTYKPDFPDMVTL
KADIEKARQHLNEVLGEQVDKAKSNSLAAYQTAQRQEQELEGELNALKRDVINQSSAAVEYTNLKVEIQTRRDLLDELMR
KQSETEVAVRLQDTRQSNIRIIDKATVPGGPFQPSLRKDGSYGLLLGLLFGVGCAVLIEVLDRTVKAPEEIERKLGLPTL
AVIQDLSESGKAYGYSAYGYGETAADDKPRARPGKAPAGGWREKKKAPAAALPPSQIELVPHERPRTLISESYRSLRTAL
MLSSARELKAIAVTSAVAGEGKTATASNLAVVLAQLGRQVLLVDCDLRKPRLHQVFRVSNRFGLVNQLTATAESETVFLP
TEVPNLWLTPSGPIPPNPSELLSSDRMRDWLKAVRARFDFVVLDTPPALAVTDATIVGMLADGVVLTLRSGKVTREEARL
CRDRLRQSGIKILGAVLNRYRSLQTGLGKRYRYYEAYGAEESEPRAAGKAGSAA
>gnl|bykdb|A0A2V7Z3M4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=472 residues).
MELNRYLRVVRHRLWMIVACPLLAAVTAGIVSFAVPPVYEAKVDLAVRPAQLLPSTDPNAPSVSSATILATYALFMTEPP
LLNKVISDLRLNTTSDDLARQIKVTPDTLALVLHINVQDTNRARARDVANTLVAEFVSEVKQIQQAETQSPNTRTADDFV
VLSPAVLPSKPVSPNKVLNVAIALMAGLLLALGVAFLLDYLDQSIKSDQELTERLGLVPHGHIAFVPAGKGKRGELVALD
AQSHASEAYKALRTGILFSGINHRLXXXGSGEGKSRTAANLSVVLAQAGHQTLLIDADFRRPSQHRMFGRVRNVGLSNVI
LGATTEEATVIAVDSVPNLWLLTSGPTPPNPSELLGSGRMKDLMSRLSDAFVYVIIDTPPVNVVTDAAILSAQASGTVLV
VEQGRTTFPVVNRAKQILDRVGAHTLGVVMNKVRASADAYAYDYGYYSPAASGAPNPLVDKTSNADHRAASN
>gnl|bykdb|A0A2V8AJG9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=773 residues).
MSEQFSSNPGPAAAGRLEMAPGLDSIDAGAAPPISAAAPNGRGPAYGYGSNVIGDGEVHLLDYVKVLYKRRWTAITAFLV
VFLSVTIYTFTATPIYEAKVQILIEKENTNVVTFKEAFEQNQIADDYYQTQYKILQSRALARRTIDGLKLWEHPLLKPND
DNLTVGKIAAAPAAFVSSWFRTAAPVGMPGSDESKQQSRVIDRFLKDLTVSPIRNSRLVDVKFESPSAALSAQVANGLAK
AYIEQNLEFKFMSSKEASDWLGERLSEQRKQVEASEQALQRYREQTDSVSLEDKQNIVVQKLADLNAAVTRAKTERIQKE
AAHNQLRGLQHDRNALDTFPAILSNTFIQQQKGEIAELQRQQAQLSEKLGPRHPDMLKVSNAIQLAESKLQGEIAKVVQS
VKNEYQAALIQEQTLTGALDQQKRDALALSRKGIDYGALQRDNATNRQVFESLLQRAKETGVSTELKTSNIRVVDAAEVP
RRPASPNVPTNLLLAFFGGGTLALGLAFFFEYLDNRIKTPDEVKAHLGLPFLGMVPALFGDDVKDPLMNNGVPANFAEAF
RAIRTNVLFSSAEEGSKTIVITSTAPGEGKTTVASNIGIALAQASQRVLIVDADMRKPRVHSVFGQTQEPGLSNVLVGNA
KASEAIRGTAVSGLWTMTAGMLPPNPSELLGSKRFKDFISTLGQHFDWVIIDTPPVMAVTDSCIAAHRTHGTIFVVGAEM
TSRFATRRAVEQLRQAKCDVIGAILNRVDLKHHGYYYSQYYRKQYGEYYSRTA
>gnl|bykdb|A0A2V8DRT9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=770 residues).
MADQFQLDPGDLDNQKKNLAPRPRRAVRAASGKPAAAEHALEEVHLSDYVKIMYRRRWPAGTAFMLVVLVVLVYTFTATP
IYKARVQLLIEDEKSNVVSFKEVIEQDKATNDYYQTQYRILQSRSLARRTLDRMGAWDTFDSAKAPKKMSIRTAVASVVA
PVFHLFVARKAIEPEQTGETTTQSRILNDFLSNLTISPIRNSRLVEIEFASPYPYVAANVANSLSKAYIELNLEYKFTAS
RDASDWLGERMGEQRKTVDASERALQVYREQHDAVSLEERQNIVVQKLADLNAAVTRAKTERIQKESAYEQIKAVQSDRE
ALDTIPAILSNVFIQQQKTELAELQRQESQLSEKLGQRHPDMLKAKLNVQNAEARIQAEINKVVHALSNDYQAALAQEQS
LMHALDQQKNDALALNRKGIEYGALQRDAASNRQIFESLLQRTKETGISGELKVSNIRIVDAAELPQVPASPDKPLNVLL
AILGGSIMAVGLAFFFEYCDNRIKSPAEIKAHLGLPFIGMIPKMAVADGESAPLLDKGATPNFAEAMRTVRTNVLFSSTA
DGGQSIVVTSSGPGEGKTVVSSNLALALAQTGQRVLLIDADMRRPRVHQVFAERQEPGLSNILVGDTKTGDAVRPTSCST
LWILPAGHLPPNPAELLGSKRFEDFIETLKDHFAFVIIDSPPIMAVSDSAIVAHMADGVLFVIGSEMTSRGVARTAVEQL
INANGHMIGAVLNRVDLTHNAYYYSQYYRREYGHYYIKGANTKSADAKSA
>gnl|bykdb|A0A2V8ERZ5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=761 residues).
MLPSSPPDAPAPSTTAVTAGSPSHAGSSHGQGSAPHYAPEQDVHLLDRLAVIYRYRRICAATFVLVSAALIIQGYSTVQM
YQAQARLLIEDERSTAVPGLQNDANQYYEDPEPYYQTQYKILKGRDLTRRVVRKLRLDTVPEFNGTKPAPPTASTLLQEA
KDKIIGIAKPNAPAEAPKVDETADESGLVSAFIGRVSVDPVRGSHLVDVSFVSEDPKFAAEAVNALIEEYVNQNLELKLQ
STQGMLDWLDKELDNQQKRVEGSEKGLAEYREKENALSLDDKQNIVLSRLNQLNDAVTRARTERVQKESLYNQVKAIANG
TAPDAIPAIATNAGVASAKAKLSDLQREKAKLLERYQDKHPQVINAVAALQDAQRQLDLEIARAVQSVKNEYETAVLQEQ
TLARNLDGAKSEAQDLNRKGIGYGVMEREAKSNREVYQSLLTREKELRVSANSRTNNVRLVDRAETPRGPITAGGRRTVL
MSLMIGLVLAVAVALGLDYMNDTIKTPEDVTRRLKLPFLGLVPVVRGDKHPLLASSHVPHDFGESFRSLRTSLLSKYQGD
ATKIITVTSAQPLEGKTTTAANIAMALAYGGARVLLIDADMRRPGLHRPLRLTNDRGLSQVLTGQARVRDVIQRTVDPNL
LAITAGRSPLNPSELLSSERMKTLLTNLAHGPFNWIIIDTPPVLAVTDAVILAPMVTGVTFVVGAEMTRRRLAERAIETV
MQAHPRFAAVVLNKVNFAKNKYYYSRYYGHQYKNYYAEATP
>gnl|bykdb|A0A2V8EXP2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=783 residues).
MSTQFRDSTDSLQHRLTMASADAENAGAARAADSGPAAAAPPPTAYGYGSNVVGDDQVHLLDYVKVLHKRRVAALTAFLL
VFVSTAVYTFTAKPIYESKVQILIEKENANVVTFKEVFEQNQVADDYYQTQYKILQGRALARRTLDALRLWDHPQFNPKG
EAAFSLGALVTAPLRWLSAWATPPPAIEPGGVSAGETSAQARAIDRLLGGLTVTPIRNSRLVDVKFSSLSPMLSSQVANA
LARAYIDQNLEFKFLSSKEASDWLGERLAEQRQKVEVSEQAVQRYREQTESVAFEDRQNIVVQKLADLNAAVTRAKTERI
QKEATYNQMKALQTERAGLDTFPAILSNQFIQQQKGELAELQRQQAQLSEKLGPRHPDMVKIGLAINAAEERIQGEIAKV
VQAVRNEYLSAQTQEQSLINVLDQQKREALALNRKGIDYSALQRDALSNRQIFESLLQRTKETGISGELKTSNIRVIDVA
ETPRRPASPNVVANLLLALFGGLTLAVGIAFFFEYLDNRIKTPDEIKAHLGLPFLGLVPALFAKDLHDPLISKGVPANFS
EAFRAVRTNVLFSSADEGPKVIVVTSAGPGEGKTLVASNLAVAMAQAAQRVLLMDADMRRPRVHSLFGIAQEPGLSNVLV
GNAKPSDAVRITSVPGLWAMPAGMIPPNPAELLGSKRFKEFLGTLGQHFDCVIVDTPPVMAVTDSSIAAHVATGLIFVIG
AEMTTRHTAQRAVEQLSHARPKFLGAILNRVDLQHQGYYYSHYYRREYAGYYTQDSSKLPAAS
>gnl|bykdb|A0A2V8F6S9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=754 residues).
MADSTPSGSRPASSASNSNGGVAPPLTYGTDGDVHILDRLAVLYRYRRIAITVFVLTTAALMIQGYSTTPMFEARAQIEI
DAERATALPGITTPDNTYYEDPEPYYKTQYRIIKGRELTRRVVKKLNLQDRAEFNGTERPRPTPFSMLREAEQRIVRLVR
PAKEEPTEAPKVDEAPDESGLVSGFISRVTVAPITGSKLVDVTFQSSEPKFAATAANALVDEYVDSNLEIKQAGTQNMIE
WLDKELAKQLQKVQESERAMANYRERQNALSLDDKQNLVGARLNKLNDDAMMARSRKLQKELLYNQVKAMAAGQPLDSVP
AIAQNPTVVGAKNKVQELQRTLTELSARYGEKHPSIQKARTDLAEGQKQYEFEVARAATTIKNDYESAVLEEQTIARGLE
SAKADAQNLSRLGVDYNVMQRDAQTNRTIYDTLLARQKELTVSSNSRQNNVRVIDHAELPRGPMAPTGRRTWLLSLAVGL
AIAVAVAYGLDYMNDTIKTPEDVTRRLKLPFLGLVPSVRGDKHPLLASSRVPHDFGESFRALRTSLVSKYPGAGTKVLLV
TSAQPLEGKTTTAANVAMALAYGGSRVLLIDADMRRPGLHRPLRSTNERGLSQVLIGQARVRDVIQRTVDPNLLAITAGK
TPPNPSELLSSERMKTLLTNLSHGPFDWIIIDTPPVLAVTDAVILAPWVSGVTFVIGAEMTRRRLAERAVETVMQTRPKY
AAVVLNKVDFARNKYYYSRYYGHQYKNYYAEAAV
>gnl|bykdb|A0A2V8F956 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=707 residues).
MAITTFLLVVGSVTVYTFTATPIFEAKTRLLIEAENRNVVSFKAVLDEDQTRADYYQTQYNLLQSRALALRTIDQLKLWE
TPPFRNDKRFSLKRMMLGAPALVGQYAVSGISRTGDAASDFSGTGGSAARTTESANPGPDETASQSDAIDAFENALTIAP
VRNSRLVDLKFDLPDGALAATIVNALAKNYISQSLEFKFMASKDASDWLGQQLLEQRKQVEGAEKKLQQYREQNDSISMK
DRENIVVQKLTELTGAVTQAKTERFQREALYRQVESLRGNPAMLDTFPAILANTFIQQQKTELAQLQSQSAQLGDKLGPN
HPDMVKIRSAIRLTQAKLDGEIGKVVQGVKNEYLAALAKENSLTGALNAQKGDAVQSSRQIFDSLMQRAKETGVSAELKT
SNIRVVDRAQTPTEPVSPQKGLNLLLALFGGSLLACGLVFFFEHIDSRIKTPDEVTAHLQLPHLGLLPALNEKQFANTYP
LISKTAPPNFSEAIRDLRTNVLFSSAEKGSRSVVVTSTGPGEGKSLVAANLAISLAHATQRVLVLDADLRKPQVHDIFEV
AQEPGLSNLLAGQAKASESVRKTAIPGLWVLTSGRIPPNPAELLGSQRFKDFLVSVKEHFDWVIVDTPPVMAVTDARLVA
HHATGVLFVVGAEMTSWHAAKRALDHLDHVQARFVGAVLNRVDLDRNAYYYSNDYRREYTQYYAKSS
>gnl|bykdb|A0A2V8G155 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=746 residues).
MSDTKEGLRMMGAPAPGDYALNDAALPPASPHVVNSLMVVYRRRWTVVTAFVLATAGATVYTFSQPRLYEARTRLLIETE
NPNVVNFKAVIDEDQTKAEYYQTQYNIIQSRAIARRALDELKLWNTPPFGGTAPADSPFSLRRVIALVHTTNAGPPPPPP
DETALQSRAVDAFLARLDVTPVRNSRLVDIKYRLGDPALAQKIVNAVAHAYIEQTMEFKFTASKQAGDWLEERLAEQRKV
VEQAEARLQAYREEHDAIVPAEDRQNIVVQRLADLNTALTRAKTERIQKQAAYDQIRNARDVPGSVDTFPLILTNGFIQQ
QKSQLSELQREYAQLSEKLGDKHPEIIKVKSAIQISQAKLSGEISKVVDSVKTDYLAAVAQERSLTAALEQQKTEALVMN
RKAIEYGVLERDAKSSRQIYESLMQRAKETGVSAELKTSNISVIDRAETPRTPVEPRVQYMLTLGGCGAFLFALCLAFFF
EHFDNRIKTPEEIQTHLRLASLGLVPAVRLKGSMSPSLYKRAPGNFAEALRTIRTNVLFALPEEAARCILVTSTAPGEGK
SVIASNLAMSLAHSGARVLLVDGDMRKPRGHELLGGPQEPGLSNVIVGETKLADAVRRTPIPSLWLLAAGKTPPNPAELL
GSERFRDLLLSLQTRFDWIIIDSAPIMAVADASVMAHRATGVLFVVGSEMTSRHAAQKAVEQLTHCRARIIGAVLNRVAL
DRNRYYYSHYYSREYQAYYRSERTAS
>gnl|bykdb|A0A2V8GFD4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=775 residues).
MSDNEQHQHHEIRIDMPADSAFASARDAVEKDGVERLPPGSGEMVDGTLSGFDYLRILYKRRWLCLAVFVLTLGSVVMYT
FTATPIYEARTQILIETENPNVVSFQEVVDQNKTTLDYYQTQYRILQSRAIARRSIADPFLATNAQLSGGGRQMFDLQSL
FNSVVAYVNGKMTGEAYSKSTAVDETPLERRRVDAFLGALSIVPVRNSRLVDIVYSSPDPKFATAAANAIAKAYIEQNLE
YRFTASKEASDWLAARMAEQRSAVEASERALQQYREQYDAISLEDRQNIVVQRLEDLNGAVTKAHTERLQKQALFEQLQA
ARGDAAALDRFPTVLSNGFIQQLKGEIAALQRQHAEMADNLGERHPTMIKLKASLQSADAKLQAEIAKIAESVRTEYLAA
AAQERSLQAALDQQKHEAQELNRRAIDYGVLQRDAATNRQIFDALLQRSKETGISGELRTSNVRVVDAAEEPPWPAYPRK
RTNVTYGLLAAVLLAGMFGFVIEALDTCLKTPDDIKVQLGLPFLGLVPQLRRREFAKPSPMINHHVPGMFPEALRAIRTN
VLFSFAEGSAKTLVITSTAPEEGKTMVAANLAIALAMTSQRVLLVDADMRRPKIHQLFALDQEAGLSNVLIGSAKANDAV
KKTTVPKLWVLPAGRVPPNPPELLGSPRFAELMAAFRENFDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTRGAA
KTALEQLDAAGARYIGAVMNRAEIRRHPHYYSRYYRTKYTTSYAVSPGSQPSSAR
>gnl|bykdb|A0A2V8GTX0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MFTPGGLSTTGPAAGSPPPVPVHQPQARKTAGLFSPDPNIHLFDRLAIIIKHWKACAAIAVLVIAGMMYQTFTTVPLYRA
QARIQIDEEQTTAQVDFKQPELVYSDPEPYYQTQYKILQGRDLALRAVKRVKLEDVPEFNGKGAKPPLLTQVISDLKAKI
AAPFRGQTAAPPPRPAGPVNENQQADAFLGRVQVVPVRGSRLVDVYFVSADPEFAARAVNVLAEEYVNENLDFRLQNTDK
TLQWLTEEVAKQQSVVQASERMLAEYRENQNAISLEDRQNIIVSRLNQVNDAASHARTNRIQKEALYNQVAATKDREGLS
QIASNPFVQQLKTRIVELQRDRVRLEERYGEKHPDVQRVNGQIQDAQRQLDAEIERSVAAIKADYQAALDEEKQLSADLE
GQKAQATDLNRKSIDYSVLQREAESNRQVYESLLQREKELRVVSNSRANNVRLLDRSEVPESPFTPNTRRAWLMAILFGL
GFGIAAAFAIDYLDDTVKTPEDVTWRLHLNFLGLVPKVHGERHPLLSGPVPHDFGEAFRALRTALVASSGTDATRLVAIT
STQPLEGKTTTAVNVALALAIGGARVLLIDADMRRPSLHKAMRLPNDRGLAELLSGKARMREVVQRCGDPNLLVIPAGHT
PSNPSELLASDRMRAFLHQLTTGPFDWVIIDTPPVLAVTDAVVLAPLVHSVSFVVGAEMTRWRLAERAIETLQAGHPRSI
AAILNRVDFDRNRYYYSRYYGHQYKSYYAEAPAAS
>gnl|bykdb|A0A2V8HDM7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=746 residues).
MSDTKEGLRVVGAPAPGDYALNDAALPPASPHVVNSLMVVYRRRWTVVTAFVLATAGATVYTFSQPRLYEARTRLLIETE
NPNVVNFKAVIDEDQTKAEYYQTQYNIIQSRAIGRRALDELKLWNTPPFGGTAPADSPFSLRRVIALVHTTNAGPPPPPP
DETALQSRAVDAFLARLDVTPVRNSRLVDIKYRLDDPALAQKIVNAVAHAYIEQTMEFKFTASKQAGDWLEERLAEQRKV
VEQAEARLQAYREEHDAIVPAEDRQNIVVQKLADLNTALTRAKTERIQKQSAYDQIRNARDVPGSVDTFPLILTNSFIQQ
QKSQLSELQREYAQLSEKLGDKHPEIIKVKSAVQISQAKLSGEISKVVDSVKTDYLAAVAQERSLTAALEQQKTEALVMN
RKAIEYGVLERDAKSSRQIYESLMQRAKETGVSAELKTSNISVIDRAETPRTPVEPRVQYMLTLGGCGAFLFALCLAFFF
EHFDNRIKTPEEIQTHLRLASLGLVPAVRLKGSISPSLYKRAPGNFAEALRTIRTNVLFALPEEAARCILVTSTAPGEGK
SVIASNLAMSLAHSGARVLLVDGDMRKPRGHELLGGPQEPGLSNVIVGETKLADAVRRTPIPSLWLLAAGKTPPNPAELL
GSERFRDLLLSLQTRFDWIIIDSAPIMAVADASVMAHRATGVLFVVGSEMTSRHAAQKAVEQLTHCRARIIGAVLNRVAL
DRNRYYYSHYYSREYQAYYRSERTAS
>gnl|bykdb|A0A2V8HSS5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=775 residues).
MSDNEQHQHHEIRIDMPADSAFASARDAVEKDGVERLPPGSGEVVDGTLSGFDYLRILYKRRWLCLAVFVLTLGSVVMYT
FTATPIYEARTQILIETENPNVVSFQEVVDQNKTTLDYYQTQYRILQSRAIARRSIADPFLATNAQLSGGGRQMFDLQSL
FNSVVAYVNGKMTGEAYSKSTAVDETPLERRRVDAFLGALSIVPVRNSRLVDIVYSSPDPKFATAAANAIAKAYIEQNLE
YRFTASKEASDWLAARMAEQRSAVEASERALQQYREQYDAISLEDRQNIVVQRLEDLNGAVTKAHTERLQKQALFEQLQA
ARGDAAALDRFPTVLSNGFIQQLKGEIAALQRQQAEMADNLGERHPTMIKLKASLQSADAKLQAEIAKIAESVRTEYLAA
AAQERSLQAALDQQKHEAQELNRRAIDYGVLQRDAATNRQIFDALLQRSKETGISGELRTSNVRVVDAAEEPPWPAYPRK
RTNVTYGLLAAVLLAGMFGFVIEALDTCLKTPDDIKVQLGLPFLGLVPQLRRREFAKPSPMINHHVPGMFPEALRAIRTN
VLFSFAEGSAKTLVITSTAPEEGKTMVAANLAIALAMTSQRVLLVDADMRRPKIHQLFALDQEAGLSNVLIGSAKANDAV
KKTTVPKLWVLPAGRVPPNPPELLGSPRFAELMAAFRENFDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTRGAA
KTALEQLDAAGARYIGAVMNRAEIRRHPHYYSRYYRTKYTTSYAVSPGSQPSSAR
>gnl|bykdb|A0A2V8IVN9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=769 residues).
MSDIRNFDPSVKLRFEEAANPEDAVLRAPGEAAGGGYASYPDIVGGSGEGGEPHLLDYVRVLYKRRWIAGTAFTVVMLLV
TVYTFTVTPIYQATTKLLIESDSPNVVSFKEVINEEQTKADYYQTQYNILQSRSLARRTLETLKLWESGEFVTNKRGIVQ
TLAGGVASLFGKKAPEPGIPDAGETSSQSRAVDAFLKRLTVSPVRNSRIVDVKFEAKDPDVAERVVNALAKGYIDQNLEF
KFMSTKEASDWLGERLGEERKQVEAAEARLQQYREQNDAISLKDRENIVVQKLSDLNSAVTQAKTERLQKEALYSQLNSL
RSGRGAALDTFPAILSNTFIQQQKSELLQLQSQYTQLSEKFGDKHPDIIKVKSAIQLAQARLDGEIGKVVQSVKNEYLGS
LAKENSFIAALNQQKGEALTMNRKAIDYGVLDRDVQSSKQIYESLLQRAKETGVSTELKTSNIRVVDPAERPRKPSSPQY
ALNLLLGLLGGTMLGVGLAFFFEYLDSHIKTPDEIRAHLGMPALGMLPAVQEKEFGGSYPMVGAHVTTNFNEAFRAVRTN
IIFSSAEEGSRILVVTSTGPGEGKTTFASNLAVSLAQTGQRVLLIDGDMRKPKLQEAFGMTQEPGLSNLLVGTAKASESV
RRSKTAGLWLLPAGKIPPNPAELLGSQRFRELLASLKDHFDWVIVDSPPVMAVIDAAVVAHRATGVVFIIGAEMTSRHTA
KAAIRQLENAHAKFVGAVLNRVELEKHHYYYSQYYRKEYARYYAKTGSA
>gnl|bykdb|A0A2V8IYW3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=764 residues).
MIPGHKYTPQDVLDAVNRRKWLLICPVLVFGIAAFLITRSLPNLYQSETTILVVPQRVPESYIRSTVTNRIEDRLRSIRE
QVLSRSMLEPIILEFDLYPEQRKQVPMEDVVARMRTEVDVDPPVKDDTFKISYVSGDPVVAMKVVARLASMFIDGNVRDR
RVVAEGTNQFLESQLEDAKLRLIDREKKLEEYRRRYIGELPSQLQSNLQVIQTTQIQLQSLSESLNRDRDRRLVLERGLA
DMRADPATAAATADPSDRTPDPLDAARTELATLGRRLLPTHPDVIAAKRRVAQLEAERVAMPKASDAPASAAAPQVADNV
VVRRMRETQTEIDKLDRQIAGKEADSVRLRGTIAEYQRRVETAPTRESEMAELTRDYETLKKGYESLLAKKEDSNIAANL
EKQQVGEQFKVLDPARVPERPFSPKRLQLNLTAIGIGLMLGMAVSALLEYRDTSLRTESQLLEALKIPVLAVLPVMESID
EKRRRMLRLAFTFTGGFLLVAARITETGVLMPETAEIGVFVPLKNPIGVSEELFDPALTGKVAAPGMLPVATEQYRRLAA
ILHHAQADTGMRVVMVTSAISGEGKSLTITNLALTLTRSYERRVLLIDADLRRPTLHTIFKLESPCGVNEYVHSHGAKPL
ELLPVAPRLFLLPAGRPDSDPIGALTSETMQRIVKEGREQFDWVLIDTPPIGLLPDAGLLGGIADGALLVVRAGHSPFDL
IKRAVDTLGRERILGVVFNGADTSRRYGDDYYGYYAKSGYGKSR
>gnl|bykdb|A0A2V8J0X9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=757 residues).
MFDTQEVRAQLPAEVSPSALIALPSSTSQSTHVLDRLNAVFKHRRLSGTAFVLVVTAMMVQTYSTIPVYEAWSRVQIQDE
RTTQVGTLNASDPAFWQESGPYYQTQYSILQSRGLGRRVVRKLDLQNSPLFNGSAPPPRDPLSLARQGRAAASAWLRGLI
VKPPPAAAAPPAPDEPAHEAGLISAFLGGLSIRPEPNSRLVKIVYSHSDPKFAALAANTVADEYTQQNIDLRLQNTEKTL
QWLGEELKRQEQQLAASEGALTEYRERNNALSLEDRQNIVVSRLNQLNDKVTTSRNERLSKEAIYNQLRRADPSSDAIDN
FPIVGTNSAVVDAKNALATLTAQKANYAGRYGPEHPRMMEVKDQIENAKRRLVAERTKVLESLKNDYNAAFAQERSFSSQ
LEEQKGASMDLDRKSGDYKLLQRKADSDRQVYQSLLSQQKELAVVANSRANNVQVLDRADVPPFPVSPNPRRDWMTAILA
GLSIALGLAFGMEYLDDSVKTPEDITKRLRLPLLGLVPAVRGERVPVLTETVPHDFGEAFRSLRTSLVFTSGAQSTRIIA
VTSSQPLEGKTTTACNLAMALAFGGSRVLLIDADMRRPGLHKTVGLRNETGLSHLLVGQARVREAVQRTSEPNLVVITAG
RTPPNPSELLSSERMSNFLANLATGPFDWVIIDTPPVLAVTDAVIIAPKVSGVVFVIGSEMTRRVHAERALETLQSGRPR
SIGVVLNRVDFDRNKYYYSRYYGYQYKSYYGQNQGAA
>gnl|bykdb|A0A2V8JK38 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=977 residues).
MEAPNSIQATVPLTATAGPISVTTPAGTGTSSAPFKSATRFENTDPALTYTSGWDRTSTLRPWSVGTAAVASTAGQQVTF
TFSGTDLTWIGFRGPQAGIARVSLDGVFIQQLDMYSVAEEVQAEVFKATGLASGNHTLLIEVTGTSNPASTGSYVAVDAF
DIAPQVPATVNITSPPSGSTVSGTDKAKTPGRRAGKDKLVRINHRKYPEIVENLPRNLATQEEDETHLLAYWRVIVTRRW
TVVAVFATIVLLTLIWTLKQKPMYAATITIQIERETPSLVNLRDYYQADSDTYVDYMLQSYFRILKSRSLARRVVTELHE
ELEKEFAAPQRGFLAAQAGNLKKISSVEKTEQASDDEGDQLRSLIDQYLDRITVKPLRQSWLVEVTFQAKDPKLAAQVIN
AHGRHFVEQNIENRFQTTQQVSELLSQQIVNLKGGLEKAEERLQKYGQDNDILFTEDGRNTVTEKLRQLQEEYTRAQAER
IQKQSYERMVRTGSADALPQITGSSLISQFVGRLSDLKRQDAELTVTFAPDYPSRRRIRSQIEEIQKQIEGERGRIVKTF
EVEYSAATERERLLSVALEQQRDAVNKMNREIIQYNILKREADSSKDIYNGLLTRLKEAGISGGLRASNIRVVDQAEVPK
GAVTPNHKLNLAWGIFFGLIFGVGSAVFQEYIDRSIKSPDDVTRHLGLLALGTVPRLHNLSLWRGYKYKYGYGYGFRFGR
KKEQNEPANAEKSDNRSIELAPHDEPSSVIAESYRSVRTSFFLSSGSAPTRSVVITSAVPGEGKTVTAVNTAVIVAQTGA
RVILIDADMRRPRMHKIFKCANANGLSSVLEGHCSLENAVSETNIKNLFLLPSGPVRPNPGELILSPRFKEVLKSLKKDF
DLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSRYIAYRAVQHLAEAQVRIAGVVLNDLDLRHLAGYSARYRDGYVY
DRYYGHITHDENVENRS
>gnl|bykdb|A0A2V8JQV5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=793 residues).
MDMEFSEHDLTNKGNGEPSQDPVRKVSKSGKPQQSPAYSGPMTSPAGVFDYWRVFLNRKGTVLIAAVLGTAIGLLISFPR
TPIYQARTTLEIQGLNDNLLNTREVNPSAPSVISTAFEEIQTQIKILKSDSLIGQAMKRFGLTHSADPLTRLTRWRIALG
IAKTSAASAREAAISLAAATLQVEALQQAHIIQITADSTDPKIAAEFLNTLTDEFINQKLRSRLQTNERTAEWLQLQLQE
LKVNLEKSEQELQDFGRATGLMFTSEKDSSVAEEKLHHLEADLSEALADRVEKQSKYEIAKSAPVESLPQILDDGTLRDL
QSKLTELRSQTAELRVSLTPAHYRVQRLEAQMGELETAFERERANILRGIANQYEDAKRREELLAQEYDAQTRVVSDQAD
KVAHYARLKREADSNRQLYEAMLQKVKEYNIASAVTANNVNIVDPARPPGGAYKPDVYMYAMLGLATGVFLGLMLIVRQE
QADRSIHAPAEAPVYLNVPELGVVLSAEADSSLGVPPESSPVRSLRNAIEFGKRIAGSDRSTPYGKDRPKPKIELMAWEK
PFSLFAECFRTTAASVLFSEHGGTVPQILVVTSANPQDGKSTMASNLAVALAETQRRVLVIDSDLRRPDLHRIFHAENRW
GLIDILQGDIEIRDYPLDMLARQTEVPNVHLLTSGTASRSVVHLLHSTRLPELLQRLRKDYDLILIDAPPVLQMADARVL
GRLADGVVFVIRSGRTTRDMALSACRRFREDRTRVIGTVLNMWDPRDASQKRYYYSNTYYEHYVHKETEEVKS
>gnl|bykdb|A0A2V8JTQ2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=745 residues).
MSESFELMNQRARDFDPVQLPRVALSSGPNPANHYLPRVGAPDEVFAAGMWRIIRDRKWTIAAFALVVVGIVVTASLLME
PQYKAVGRVVVVFHRDNDSGVLGFRGADTSLLDDPEDRTAIDTQIRILQTDALAMQVIKNLQLDKNPKFTARGGRAANQD
ALLQSFHKGLEISKVKGTRLIEIQFRSTDPQLAADVVNGLAKEYVDQYYRSQFQVSTQFSDFLANQLKELQARVEDSQRK
LVDYQKENGLFGLDDKQNIVTTKLTDLNRELTAAEVDRVQKDVNYQLARSGQPDLVARLEPDNLLTRLRAQQADLENQIA
QASVQLGPAHPKMAELSKQLAQVRRSVDAEVKGIGERITYEYQTAAERERMLRDALEAQKQVVDHLNASAVQSDILKREF
ETNRKLYEDLLQKQKEVGISASLKSSNIWIVDPARPPKLPAEPNILRNLALSLLFGICGGVWLSFGLAKIEEKTINTVEQ
AQSLSSLPALGVLPLLEAKSQNGAHRELAGGSGHVDHALVSLLQPMSLAAESYKTVLTSLLLSQPTPPRVIQVTSALPGG
GKTTVSTNLAILLARLRRRVLLVDADLRRSQIHLAMRLSGNTGLGPLLRNTVTFEEAVVSWANVPNLFILPAGPVFLPGD
TELLMWSFQDWVKRWREQFDHIIIDTPPVLSVADAVRISVEADSVILVIRSGQTARDAFLRAQDLLSKVNARLTGFVLNG
ANLDSSDFRYYHNYSQDQTKLFVDE
>gnl|bykdb|A0A2V8K4L4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=798 residues).
MRNHDDSSNLPVPFTPPPGNQLSTPLQARFMPEPQEEASREGVVAYWRMVMRHKWIVVLVAFLGTVAGILFTLPQTPIYQ
SSTSLEVQGLNENFLNLENLNPTSSPSGYLDPSYEILTQVKVFQSRSLLQQTTERLLKEKKTGYGTSTDRLAAWRKVLHI
APKQALDRNNAIAAAAGGINVKASGTTRIIEITSDSTDPQLAADFANTLVDEFIQKNLDDRWKTTERTGEWLTKQLDDLK
IKLERSEDTLQSYALAVGLQFTASSKGKDGDQENVASASVRLVQEELLKARADRMIAQSKYELLASSPPEALPQVLDDSS
LREYESKLVDLKRQRAELSPSFTPDHPRMQKLEAQITELETALEAARQKVVTRLRNDYAAAESHEKLLNDEFAKQLDTVS
SQAANEVHYNILKREVDTNRQLYESMLSKVKESSIASAMRASNFRIVDLAKPAGAPYKPNLMNNAMLGSMAGIFLGVVLV
LLKEQADRSIQQPGDSSLYLGISELGVIPSDRPTMLRRGQRPSALIPSVSGNNSNAGNPVELVTWQRQGSLIAESFRAVL
TSIMFSEQRPRVVVISSANPSEGKTTVSTNLSIALSEISQRVLLIDADMRRPRLHRLFDLKNDKGLSELLLSKHALKTSE
VVGAVRESWIPGLHILTSGPWAANASTLLYSARLPEIIEITRQSFDTVIIDSPPMLHIADARLLAKHSDSVLLVLRAGKT
TRTAGSMAIQKFVADGSTILGTILTDWNPDQNGYGYDYKYYSSHAAYYTDSGVTNDLEAVVGDSKESSGKQAVGSRDL
>gnl|bykdb|A0A2V8KP55 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=756 residues).
EEDETHLLAYWRVIVTRRWTVVAVFATIVLLTLIWTLKQKPMYAATITIQIERETPSLVNLRDYYQADSDTYVDYMLQSY
FRILKSRSLARRVVTELHEELEKEFAAPQRGFLAAQAGNLKKISSVEKTEQASDDEGDQLRSLIDQYLDRITVKPLRQSW
LVEVTFQAKDPKLAAQVINVHGRQFVEQNIENRFQTTQQVSELLSQQIVNLKGGLEKAEERLQKYGQDNDILFTEDGRNT
VTEKLRQLQEEYTRAQAERIQKQSYERMVRTGSADALPQITGSSLISQFVGRLSDLKRQDAELTVTFAPDYPSRRRIRSQ
IEEIQKQIEGERGRIVKTFEVEYSAATERERLLSVALEQQRDAVNKMNREIIQYNILKREADSSKDIYNGLLTRLKEAGI
SGGLRASNIRVVDQAEVPKGAVTPNHKLNLAWGIFFGLIFGVGSAVFQEYIDRSIKSPDDVTRHLGLLALGTVPRLHNLS
LWRGYKYKYGYGYGFRFGRKKEQNEPANAEKSDNRSIELAPHDEPSSVIAESYRSVRTSFFLSSGSAPTRSVVITSAVPG
EGKTVTAVNTAVIVAQTGARVILIDADMRRPRMHKIFKCANANGLSSVLEGHCSLENAVSETNIKNLFLLPSGPVRPNPG
ELILSPRFKEVLKSLKKDFDLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSRYIAYRAVQHLAEAQVRIAGVVLND
LDLRHLAGYSARYRDGYVYDRYYGHITHDENVENRS
>gnl|bykdb|A0A2V8LCT5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=814 residues).
MNEATKLVRRDDQPREIDRRTGDTTSYRTAYGYNMDAGENEVHLLDYWRAIRKRLWLVIGVAALLTTLALVYVARKPDIY
EAKSQVQVDLENNPMYAGKTAPMIVSPVNDPAYFNTQLQILTSQGLLRRVVKTLDLEHNQAFLRPQTAQPHSTWKTILQM
LGVGGREKKETKQQNNVLPLTTSVAPATSSEDLVEAKRLAPYVGMLLGGLRVDPVRENRAGYYKETRLIDIDYQHGDPEI
AAKVVNCVAETFVRSNLEKKNETNTSTSEFLSKRVTELQSQIRSDEEKLVVYAKSNQILSLDASQNTVVERLAGLNKQLL
EAENDRKMAEAEFNAAKAPGAASALAEAGKDIELSESKLAELKQKRAELLVTATEEAPEVKEVDQQIDVIQKHLVETRSR
STATLLTNLETKYRQAAEREDSLRKSFNQQKGETLSQNEAAINYRILQQQIETNRGLLDNLLQRSKENDVVLAGRPNNIS
VVDYAIVPDFPVGPGRMRTVMLAFVLSLGLGIALALFLEYLDDTVHSTEDVEKFLRLPALAVIPAMGAASAPRRLLSSAT
ALQKRNGNNGGNPELLLNITGRSALAEAYRQLRTSVLLSTAGRAPKTLLVTSSLPGEGKTTTAVNTAISLAQTGANVLII
DADMRRPRLRSIFDLSEREGLSSILSSEMKPDQMLGAIVKDPTTGLNVLTSGPVPPNPAELLGSEQMRKLIAVLSIPFTH
IVIDSPPVSSFTDGVLIASIVDGVLLVVHGGKSSRGVVRRSRQMLLDVGAKIVGVVLNNVSVRSHDYYYYYQRYYHQSYY
HADEAEEAKSVAAS
>gnl|bykdb|A0A2V8LLF9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=798 residues).
MTHDEHLVPARTGRDFDSTLADLTQSKPYGKYARYGTTQSETNVKEYFFIILKRKWLIMSLLLVVTSLATIQAYREPSIY
QASTMIRIEGRPQSVLSTGNLIISGQPDPNFWGTQLRLLQNPLLARQVIVSLDLQHNSRFLSGQAQTSIVASLKRIFSRE
NAPASSPSTNATVEPISEEDLRSRQFTAEELTQLEPYEDAIAAGETVEAVEKTSLVTIHFQHTDPELAQKIANTLADVFV
QNNLDRITAGTSKAEIDLTNQIAKVQDKIKKEEQDRFSFAKAHNLPIDNTPGTNLEAMRLQTYSAQLLAAEDNRRSQEAI
YDAARDANDPFNAPEIQSDQRIQKLRDKIGDLEDKRNSLLEIYTPEWPEVKKIEAQLEPLKKQLIAAPKEVLAGLKSRRD
SAIAHEKSLVGAYSRQHGTTIQQTKDQIDMAIITQALTTDQQYLNTLTQRLRELTATSGSGTASEVSIANYSRLPHEPVG
PARLRTIILALVMSLLVGIGLAFLLDFLDDTLKSVDDVDRYLHLPALALIPTARNEKTKLIAGDAAAPAATTALTMVNDV
RSPIAESYRHLRTSLLLSSAGMQPRTILVTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDCDLRRPRLHSQFNLPNSRGL
TNCLSGDGKDLDALLHVYDKQPNLKLLTSGPIPPNPAELLGSDEMRKLLILLSERFTHIIVDSPPAISFTDASILSTFVD
GVILVVHGGRSSRAVVRRAKQKLMDVGAHIFGVVLNNVKIETKSDYYYAGYYGGYYDAGYYNSDEETAKDGDARAASV
>gnl|bykdb|A0A2V8M3M6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=804 residues).
MKEPAELIEKSNGSRDVGGVMERSLAPYTRYDSYADESNGYHRLRDYWRSVRKHFWLIIAILILVTGITAIYMARQPDVY
ESLSKVQVDSETANNPAIGALKGNPIFLNNPSQDPTYFNTQIQILTSAGLLGRVARTLDLEHNQAFLHPQSAQDLSFGES
LKGLIGLRKSQSKTKEQEGYVLRPNSALSNDDIAEANHLQPYVEMLQSQVSVKQLSDTRIIEIRFKHQDSEIAEKINNTI
ADTFVVSNLERKTETTNSAGDFLQRRIDDLQSEIRSDEEQLINYAKNHQILSLDASQNTVVDRLAGLNKQLLEAENERKA
AEAAYRAVLAPGALEAQAEATSNKSSATPEAKLAELKQHRAQLLLEYTEKYPEVKDVDQQIAMLEKQVDQSRRHTESVVK
TNLETSYRQALQKEEALRQAFDKQRAETLTQNEAAVNYRIIQQQIETNKSLLDGLLQRSKENEVILAGTPNNVHVVDHAA
IPKNPIGPKRMQAIVLAALFALIVGIALARYLDYMDDSVRTSDDVENFLRLPALTVIPTVGNSARRRLLSAMPGSKRNGH
QGGPELLLNGSQRSALAESYRQLRTLVLLSSAGGAPKTLLVTSSQPGEGKTTTVVNTAMILAQTGAKVVIVDGDMRRPRL
HSIFDVDNDKGLSGILASKMSEAEMLNCVQQHEESSLYLLPSGRLPPNPAELLGSDQIRSLMSVLENTFTHIVIDSPPVA
SFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQLLSDVGAKIFGVVLNNVTVSKHDYYYYNQYREYYHSDIQPTEISPS
TADS
>gnl|bykdb|A0A2V8MHG6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=799 residues).
MKEPTELIEKSNGSRDVGGVLERSLTPYTRYDSYEDESNGYSRLRDYWRSVRKHLWLVMGIVVLVSGVTAMYMARQRDIY
ESLARVQVDSETANNPAIGALKGNSIFLNNPSQDPTYFNTQIQILTSAGLLGRVAKTLDLEHNEGFLHPQSATRPSVWES
LKGLVGLSKSQSKPREPEGYVLRPSSALSNDDIAQTNHLQPYVEMLQSQLSVKQLSDTRIIEIRFKHQDPEIAEKINNTI
ADTFVVSNLERKTETTNSAGDFLQRRIADLQSEIRSDEEQLINYAKNHQILSLDASQNTVVDRLAGLNKQLLEAENERKA
AEAAYRATLAPGALEAQAEATNNSSATTEAKLAELKQHRAQLLQEYTEKYPEVRDLDQQIAMLEKQAEQSRAHTESVVKT
NLETRYRQALQKEEALRQAFEKQRAETLTQNEAAVNYRIIQQQIETNKSLLDGLLQRSKENEVILAGTPNNVHVVDHAAI
PKTPIGPKRMQAIALAALFALILGIALARYLDYMDDSVRTSEDVENFLRLPALTVIPTIGNSARRRLLSAMPGSKRNGHQ
GGPELLLYGSQRSALAESYRQLRTLVLLSSAGGAPKTLLVTSSQPGEGKTTTVVNTAMILAQTGAKVVIVDGDMRRPRLH
SIFDVDNDKGLSGILASKMTEGEMLGCVQQHEESSLYLLPSGRLPPNPAELLGSDQIRSLMSVLENTFTHIVIDSPPVAS
FTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQLLSDVGAKIFGVVLNNVTVSKHDYCYNQYRAYYQSAETEPHKISTS
>gnl|bykdb|A0A2V8MKV0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=793 residues).
MTQDERLIPARAGRELDRSLADFATAKPYERYGAAGVETSLRDYLFVILKRKWLILSVALVITSMAAIQQYRQPSIYDGI
AQLKIEEKPPNILSSSQIVITQRDPNFWGTQIKMLQNPSLARQVILTLDLPHNPNFLGGRANSGLFNSLKYLFSRTKIAP
APAPAASSGEQTITQDELIDKVNNLTPEEVVRLEPYEDAITANEEVDTVEKTNLVSIRYHHSDPALAQKVANTLVDVFAN
NNKESLESGTRKSAAQLGSQIGTYDELVKKERDDRIAYAKQYGLPLTPTENNVPIQREQTYNKQLLDAQNEYRKLKADYD
EAKASTELLSNPEVQKNESVLKLRDKLSELQAQRAALRQTYTDEWPDIKKLDAQIKPLEQALEAAKRQILVSMESRYKAA
EATERSLAQAYSQAHGVTAAQLDHELELAAMTQKLTSDEQYLNTLNQKERELKATGSDKGTNVSVVSYSRLPHEPTGPPR
TRNILLALALALLAGIGLAFLLDFLDDTVKSLDDVDRYIHLPTLALIPAARSEKRLREGEAPTAGASTALAMVEDVRSHV
AESYRHLRTSLLLSSAGQAPKTILVTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDCDLRRPRLHSNFNISNVRGLTNFL
SGELPLDEVIQPFEKLPNLKLLPSGPIPPNPAELLGSEQMRRLLTLLGEKFAHIIVDSPPAVSFTDASILSTFVDGVILV
IHSGRSSRAVVRRAKQQLLDVGAHIFGIVLNNVKLDTHGYYYGGYYGRYYYKYGYYYSDYSDDDGKKAQTASG
>gnl|bykdb|A0A2V8MM59 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=796 residues).
MNEGTKLARVETEPQDLDRRLDDHGPRPYAYGYGTNGFDGEVNLLDYWRAVRKRLWLVIGVAALITAMAVIYAARKPDVY
EAASQVRVDLENNPMYEGKTTQLIYSPVNDPAYFNTQLQILTSQGLLRRVVKTLDLEHNKGFLSPQSSQPHSTWQTIMQM
SGFANPDPKAGKQSKELPLTTSFAPATSSEDLVEAKRLAPFVGALQGGLKVEPVRESRAGYYKETRLIDITYQHGDPEVA
ARVANCVAETFVHSNLEKTNQTNTSTSEFLSKRVAELQDKIRSDEEKLVSYAKSNQILSLDANQNTVVERLSGLNKQLLE
AENDRKLAEAEYNAAKAPGAANALAEAGAKDIADSESKLSDLKQKRAQLLVDATEEAPEVKEIQQQIAELQKHLGETRSR
STSVLLTNLETRYRQTLAREQALRKSFDQQRAETLTQNEAAINYRITQQEIDTNKGLLDSLLQRSKENDVVLAGRPNNIS
IVDYAIQPDGPVGPARMRSVMLALVLSLALGVGLALFLEYLDDSVHSTDDVERLLGLPALAVIPSMSGGSTRRRLLSPGT
SLQKRNGNGTGSPELLLHVTGRSPLAESYRQLRTSVLLSTAGRAPKTLLVTSSLPGEGKTTTAVNTAISLAQTGASVVII
DADMRRPRLRSIFDLAEQTGLSSILSSAMTEAEMLGSVHQDEASGLHVLSSGPIPPNPAELLGSDQMRKLIAVLSAQFTH
IVIDSPPVSSFTDGVLIASMVDGVLLVVYGGKSSRGVVRRSRQLLIDVGAKIFGVVLNNVNVRSHDYYYYYQRYYH
>gnl|bykdb|A0A2V8NC68 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=808 residues).
MKESSRPTETTALVHGNGNSGEPLMQPSFRQDYRYMGEDSFQTSGGGYARLREYWCSIRKHIWLVMGIILLITMLATIYM
ARQPDVFEARARVQVDLEINNPALGSIKGNSIVLNTPYQDPTYFNTQLQILSSAGLLSRVVKTLDLEHNQAFLNPQSFNK
RSTWDSIKRMFGLSDKKEREQEQKLDDAPLVDRIAPATAREDLKEVNQLAPYIESLQGGLSVKEVNETRIIELRYRHLDP
EVATKIVNTIADTFIQSNLEKKTETSSSAGDFLQKRIADLQSEIRSGEEQLINYAKNHQILSLDASQNTVVDRLVGLNRQ
LLEAENDRKMAEASYRAALRPDAASAMVEAKSSSDADAKLNELKRKRAQLLLEYTEKYPEVKDLDEEIALLEKQTKEGKT
HATSVAITNLETSYRQAMAREQALRADFEKQRGETLTQNEAAVNYRILQQEIDTNKSLLDGLLQRAKENDVVLAGTPNNI
HVLDYSPQPKVPVGPHRMQGILLASLFSLVFGVALARYLDYLDDSVRTVEDIERTLRLPSLAVIPAIGSLSKRRLLRNVS
ALQKRNGNHPAELLLSHTDGQSPLAEAYRQLRTSVLLSSAGGAPQTLLVTSSQPAEGKTTTVVNTATILAQTGATVVVID
ADMRRPRLHSIFGLKNESGLSTILANKMSEAEMLSLVEQHEESGLYMLSSGPIPPNPAELLGSDQMRRLIAALENTFTHV
IIDSPPVASFTDGVLLSSIADGVLLVVHGGRASRAVVRRARQLLQDVGAKIFGVVLNNVNVRSSDYYYYHHYYSHYYSKV
EADVDTAA
>gnl|bykdb|A0A2V8NCZ3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=776 residues).
MKDQDDSSNLPVPFKSARGSQLPTPVPARFTAEDDSSREGVVAYWRMVMRHKWIVILVAFLGATAGILITLPQTPIYQST
TLVEVQGLNENFLNMQNLNPTSVTGGWGYEIMTQVRVLQSRSLMEKVTERLLNDKKTPYGTSSDRLAAWRKVFHLSSKPA
IDRDRAIRMAGEDIKVKGSNTTRIIEITADSADPRLAADFANTLVDEFIEKNLDDRWKTTERTGEWLTKQMDDLKIRLEK
SEDTLQSYAVAVGLQFTGAASKDGEQENVVSTSVRLLQEELLKARAERMVTQSRFELIQSSPPEALPQVLDDPSLREYES
KLVDLRRQGAELGSSFTPAHPRMQKLEAQIAEMETALEDARQKVVTRLNNDYAAAQSHEKLLNDEFAKQLNTMSSQTAKE
IHYNILKREVETNRQLYESMLARVKESSIASAMRASNFRIVDLAKPANLPYKPSPVNNAILGLMAGIFVGVVLVLLREQA
DRSIQQPGDSALYLGVSELGVIPSDRQGRGQGTAAVIPIGNGNTKNPVELVTWQRQGSLIAESFRTVLTSIMFSEQRPRV
LVISSANPSEGKTTVSTNLSIALSEISQRVLLIDADMRRPRLHRLFDMKNDKGLSELLREKHSTKTSEVLEAARETWIPG
LHVLTSGPWAANASTLLYSARLPEIIEIARQNFDTVIIDSPPMLHIADARLLAKHCDSVLLAVRAGKTTRTAAVMAIQKF
VADGSTLLGTILTDWNPDQNGYGYDYKYYSSHAAYYTDAAIANDLEAVSNSKDASG
>gnl|bykdb|A0A2V8NJ55 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=785 residues).
MMSQDNRLLPLTSTSLDRPLSDLAQSKKYYGVSATSETHLRDYLAIILKRKWLILSLVVVVTSLVTIQMYRQPPIYEAET
TIQIEQKKNILQTKELILNTGTDPYYWNTQLKLLENPELARQVAITLDLQNNPTFFEGQASSGFFASIRRIFFGDKPAPA
HVDKVPVVVNPTIKNEQLSPEQLERLEPYEDALRASLTVEPVEKTNLVTIRFRHSNPVIAMKVADTFAQVFIYNDLQRTT
SGTQTATEKLANQIAELQLKIKADEEKLLNYKEKNDIPISTAQGVDITNVRVGSYSSQLIEAENKRKQAQATYDAARNSS
DPWSIPEIQDDKSVQRLRDRISDLEEKRASLLRTYTEEWPAVQATNDEIKQVKSELDKKPAEIINSLKLRYETALATEQK
IKTDYEHERGAAQAQGKAALDIGGLTQELETYRQLFQTLSQKQNEIDLAGNDQGNNVTVATPARLPRGPVGPARSRNIIV
AFLLSLGVGIGLAFLLDYLDDTVKSIEDVDRYIHLPALALIPGQRSERSLLKSKNPPPNTGKESTALALIEDVRSPIAEA
YRHLRTSLLLSSAGQPPKTILVTSSQPSEGKTTTAVNTAVMLAQTGAEVLIIDCDLRRPRIHTHFNISNVKGLTNCLSGD
LNTDELIQAYEKLPNLKIMTSGPVPPNPAELLGSDEMRKLLNSVSERFTHVIIDSPPSISFTDASILSTMVDGVMLVVHG
GKSSRAVVRRAKQQLLDVGAHIYGVVLNNVKPEGSNSYYYYGYYSSYYESSEEDEEMAAEGARAE
>gnl|bykdb|A0A2V8NW86 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=818 residues).
MDKHELPPTSHELVPRKSTEAYPGHGEAGSYLHGRRDEFEHGGFVEDWRILCRQKDILAWITFLGALAGVLLTIWQSPVY
RARTALEIQNINEDFLNIKQVNPVSEGDSSTVLTEIATQVRLLQSESLIKRVLTKLRDRFAEDPKVKTSRFSLWRKAVLP
ELKLSDESGAVQAAAESLKARASGLTRVVEASYDSTDPRFAAAFLNTLVQELMESNMEARMKSSEYTSQWLSRQLEDMRI
KLEHSEDALQSYARSTGLIFTSEKTNISEEKLRQLQGELSKTQADRITAQSRWQGTTTSPPDALPDVLNDSSLRSLQEKL
TELRRQKAELITIYTEKHNKVKQVEAQIASLEAALQKERTAIVDRIRNDYETALRREKLLSAEYRNQSRLVTDQDEKSIQ
YGILKREVDSNRGIYEAMLQRVKEANIASAVRATNVRIIDAAEPPKRPYKPSLPVNAAVGLLSGLCIGVAFLVTRGRADR
TLRAPGEAQLWLNVPELQVIPTAVEESGRCLDTERCDKTTTLLPSRQQRDPGLPKRTSEHADSLSVELVTWYRKASLIAE
SYRSLLTSILFSGSNGLPERTSKQADSLSVELVTWYRKASLIAESYRSLLTSILFSGSNGDCPRVLVLTSAGPKEGKTTV
ATNLGIALAETKRKVLIIDGDLRKPRMHELFDLPNGHGLSSLLRDPQRAVAKLSRIVQETKIPGLFVLTSGPLTKNAADL
LHSADLSGLVAKIKLEFDFVIIDTPPMLQMADARVLGRMADAIILVTRAGQTTRDAAEAATWRFTEDNTRVLGTVLNGWD
PKETSYYGYRYPFCRYHY
>gnl|bykdb|A0A2V8P7N1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=722 residues).
KVQVDSETANNPAIGALKGNPIFLNNSSQDPTYFNTQIQILTSAGLLGRVARTLDLEHNQAFLHPQSAQDLSFGESLKGL
IGLRKSQSKTKEQEGYVLRPNSALSNDDIAEANHLQPYVEMLQSQVSVKQLSDTRIIEIRFKHQDSEIAEKINNTIADTF
VVSNLERKTETTNSAGDFLQRRIDDLQSEIRSDEEQLINYAKNHQILSLDASQNTVVDRLAGLNKQLLEAENERKAAEAA
YRAVLAPGALEAQAEATSNKSSATPEAKLAELKQHRAQLLLEYTEKYPEVKDVDQQIAMLEKQVDQSRRHTESMVKTNLE
TSYRQALQKEEALRQAFDKQRAETLTQNEAAVNYRIIQQQIETNKSLLDGLLQRSKENEVILAGTPNNVHVVDHAAIPKN
PIGPKRMQAIVLAALFALIVGIALARYLDYMDDSVRTSDDVENFLRLPALTVIPTVGNSARRRLLSAMPGSKRNGHQGGP
ELLLNGSQRSALAESYRQLRTLVLLSSAGGAPKTLLVTSSQPGEGKTTTVVNTAMILAQTGAKVIIVDGDMRRPRLHSIF
DVDNDKGLSGILASKMSEAEMLNCVQQHEESSLYLLPSGRLPPNPAELLGSDQIRSLMSVLENTFTHIVIDSPPVASFTD
GVLLSSVADGVLLVVHGGAASRHIVRRSKQLLSDVGAKIFGVVLNNVTVSKHDYYYYNQYREYYHSTADIQPTEISPSTA
DS
>gnl|bykdb|A0A2V8PFE8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=817 residues).
MNQATKLVKREDEPGEIDRRFDGSANYRGPVYGYGPESSEGEVHLLDYWRAIRKRLWLVLGVAALITALSTVYVARKPDV
YEAKSQVQVDLENNPMYAGKSVPMIYSPVNDPAYFNTQLQILTSPGLLRRVVKTLDLEHNQAFLRPQSLRQPSTWKTILQ
MWGVSGPEKKDPSTQPKELPLTSTVAAATSNDDLAEAKRLAPYVGALQGGLKVEPVRESRAGYYKETRLIDIVFQHGDPE
VSAKITNAVADTFVRANLEKKNETNTSTGEFLSKRVAELQQQIRADEEKLVSYAKNNQILSLDASQNTVVERLAGLNKQL
LEAENDRKMAEAEYNAAKAPGAATALAEGAKDINESESKLADLKQKRAQLLVDATEEAPEVKEVDQQIAELQKHLHESRA
RNTNTLLTNLETKYRQSLAREESLRKSFNQQKGETVTQNEAAINYRILQQEIETNKGLLDNLLQRSKENDVVLAGRPNNI
SIVDYAITPDFPVGPARMRSVMLAFVLALALGVGLALFLEYLDDSIHSTDDVEKFLRLPALAVIPSMSGGVARRRRLLSS
ATALQKRNGNTSGTPELLLNVNGRSALAESYRQLRTSVLLSTAGRAPKTLLITSSLPGEGKTTTAVNTAITLAQTGASVV
IIDADMRRPRLRSIFDLPEREGLSSILSSEIKPEDMLHAIHRDEATGLNVLASGPIPPNPAELLGSEQMRKLIAVLSGAF
THIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVRRSRQLLTDVGAKIFGVVLNNVSARSHDYYYYYQRYYHQS
YYSHDVESDGADERASA
>gnl|bykdb|A0A2V8PJY0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=806 residues).
MKEPTELIEKSNGSRDVGGPWDRSLAPYTRYDSYADDSNGYSRLRDYWRSIRKHVWLVIGIVVLLTGLTAVYMARQPDVY
ESASRVQVDSETANNPAIGALKGNPIFLNNPSQDPTYFNTQIQILTSAGLLGRVAKTLDLEHNQAFLHPQSAQNLSFWES
LKGLIGFKKSQSKTKEQEEYVLRPNSALSNDDIAEANHLQPYVEMLQSQVSVKPLSDTRIIEIRFKHQDSEIAGKINNAI
ADTFVVSNLERKNETTNNAGDFLQRRIADLQSEIRSDEEQLINYAKNHQILSLDASQNTVVDRLAGLNKQLLEAENDRKA
AEAAYRAVLAPGALEAQAEATSNKSSAATEAKLAELKQRRAQLLLEYTEKYPEVKDVEQQIAMLEKQVDQVRTHTESVVK
TNLETSYRQALQKEEALRQAFAKQRAETLTQNEAAVNYRIIQQQVETNKSLLDGLLQRSKENEVILAGTPNNVHVVDHAA
IPKTPIGPKRMQAIVLAALFALIAGIALAHYLDYMDDSVRTSEDVENFLRLPALTVIPTIGNSARRRLLSAMPGSKRNGH
QVGPELLLNSSQRSALAESYRQLRTLVLLSSAGGAPKTLLVTSSQPGEGKTTTVVNTAMILAQTGAKVVIVDGDMRRPRL
HSIFNVDNDKGLSGILASKMSEREMLGWVQQHEESSLYLLPSGRLPPNPAELLGSDQIRTLMSVLENTFTHIVIDSPPVA
SFTDGVLLSSVADGVLLVVHGGAASRHIVRRSRQLLSDVGAKIFGVVLNNVTVSKHDYYYYNQYRDYYHSAADTQPAEIS
PSMVDS
>gnl|bykdb|A0A2V8PWS6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=817 residues).
MNQGTKLVKREDEPGEMDRRFDDAANYRGGVYGYGPEGSEGEVHLLDYWRAIRKRLWLVLGVAALITALSTIYVARKADV
YEASSRAQVDLENNPMYAGKSVPMIYSPVNDPAYFNTQLQILTSPGLLRRVVKTLELEHDQAFLRPQTLRQRSTWKTILQ
MWGVSGPEKKDPSTQPKELPLTSTVAAMTSNDDLAEAKRLAPFVGALQGGLKVEPVRESRAGYYKETRLIDIAFQHGDPE
IAARITNAVAETFVRANLEKKNETNTSTGEFLSKRVAELQQQIRADEEKLVSYAKSNQILSLDASQNTVVERLAGLNKQL
LEAENDRKMAEAEYNAAKTPGAATALAEAGAKDINESESKLADLKQKRAQLLVDATEEAPEVKEVDQQIVELQKHLNESR
ARNTNTLLTNLETKYRQALAREDSLRKSFNQQKGETVTQNEAAINYRILQQEIETNKGLLDNLLQRSKENDVVLAGRPNN
ISVVDYAITPDFPVGPARMRSVMLAFVLALALGVGLALFLEYLDDSIHSTDDVEKFLRLPALAVIPSMSGGVARRRLLSS
ATALQKRNGNPGGNPELLLNVNGRSALAESYRQLRTSVLLSTAGRAPKTLLITSSLPGEGKTTTAVNTAITLAQTGASVV
IIDADMRRPRLRSIFDLPEREGLSSILSSETKPEDMLHAIHRDEATGLNVLASGPIPPNPAELLGSEQMRKLIAVLSGSF
THIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVRRSRQLLTDVGAKIFGVVLNNVSARSHDYYYYYQRYYHQN
YYSHDVESEPGERAASA
>gnl|bykdb|A0A2V8PYY8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=793 residues).
MTQDERLIPARAGRELDRSLADFATAKPYDRYGATAVETSLRDYLFVILKRKWLILGVVLVITSMAAVQQYRQPSIYDGI
AQLKIEEKPPNILSSSQLVIVQRDPNFWGTQIKMLQNAQLARQVILTLDLQHNPNFLGGRANGGLFNSLKYLFSRTKNAP
SPAPATGSSETTMSEDELKNKISNLTPEELVRLEPYEDAIIANEDVGIVEKTNLVTITYHHNDPALAQKVANTLVDVFAN
NNLERLESGTKKSAEQLANQIATYERKVKEERDARVAYAKQYNLPLTPTENNVAAQSEQAYNKQLHDAENERRKLKADYE
EAKGAADLISNPEVQKNESVMKIRDKLTELQSQRAALLQTYTTEWPDVKKLDAQIKPLEQALEAAKRQILASMESRYKAA
EATEKSLAQAYSQAHGVSTAQIQHELELAAMTQNLTSDEQYLNTLNQKERELKATGTDKGTNVSVVSYSRLPHEPVGPQR
TRNILVALALAFLAGIGLAFLLDFLDDTVKSLDDVDRYIHLPTLALIPAARSEKRLREGDAPAAGASTALAMVEDVRSHV
AESYRHLRTSLLLSSAGQAPKTILVTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDCDLRRPRLHSNFNISNVRGLTNHL
SGELPLDEVIQPFDKQPNLKLLPSGPIPPNPAELLGSEQMRQLLTSLGERFAHIIVDSPPAVSFTDASILSTFVDGVILV
IHSGRSSRAVVRRAKQQLLDVGAHIFGIVLNNVKLDTHGYYYGGYYGRYYYKYGYYYSDYSDDDSKKTQAASG
>gnl|bykdb|A0A2V8Q7I0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=775 residues).
MPAVDRGLEKPQTDQIRSYGPAANEPTQLRDYLFVVLKRKWLILSLCLVVTSLVAVQMFRQPSIFQAETTIRIERKQNVL
VSKDFVLNSQPDANFWGTQITLLQSPALARQVALTLDLQHNPTFFGGQSQGGIFASIKRMFAGDKAKPKISAPGPTGLDV
VRAAQLRDQPLSPEELAALEPYEDTIIANEDIDGIVHTNLFTIKYKHHDPEMAQKIANTLAEVFASNNIDSQTVNSKDAG
DLLEREISEMQGKVRTKTERLFNYAREYSLPLTEDVMLNTEAQRLADLTKQLFESENKRKNAEAVYKSASTATDKFSIPE
VQKSGRVTALRDRISALREKRETLKVTYTDKWPEVLKLDAAIKPLEAELDRAADEIIARLKSEYQESYAHENSVRAMYNS
QHGTATQQTRNQIEMAQYKQELETDKQYLNTLMARKRDVQTSNTDRANEVSIENYSRIPRSPIGPARLRNVMIAFVLSLV
AGIGLAFLLDFLDDTVKSVDDIDRYVHLPALALIPASRGDRGRLKGVVPATAGGPSETTALAMIDDVRSPIAESYRHLRT
SLLLSSAGQPPKTILVTSSQPSEGKTTTAINTAFMLAQTGVDVLIIDCDLRRPRLHAQFEISNARGLTTWLSGEKDLDGI
IQTCPRVPHLKILTSGPVPPNPAELLGSEEMRRLLGQLGERYAHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRA
VVRRAKQQLLDVGAHIFGVVLNNVRLETQDYYYSGYYSSYYSDAESGGDSARESA
>gnl|bykdb|A0A2V8QMP4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=790 residues).
MMQDNRLLPLTPETLDRPLRDLAQPSPVAVSSNEPVNLRDYLAVVLKRKWLILSLMVVITSLVAIQMYRLPSIYEAQATI
QIEQKKGGVLQTAGAGNLIIRGSDPNYWNTQLQKLKTQKLARQVILRLDLQNSPAFFGTNRGTGVIAGLRHIIARGKPTP
TPQPAAGGVPVLSDAELSADQIAPEQAQALEPYEDAMRAGLNIDAVEKTNLVEIHFQHTDPEIAASVANTLATIFRDNDI
QEETTGSQKAEDVLANEIIDLQARIQANEQKRINYRKENDLPLGTKQGQDLNALQLSTYSSQMQTAEAAYTSAEQTKNTS
GIWAIPQVQSNPTVVKLRDKIGELEEQKAALLVNYTPEWPAVQKIEKQLKSLHEQLDKMPDEIIAGLENRYEAAVKNERS
ATGSYFAARAKANDQSVADTKLADLDQQIATDRQNLNLYMQRANELKVTAPDRASGNVTMVEEARTPREPIGPPRVRNII
IALLLSIAVGIGLAFLLDYLDDTLKSIEDVDRHLHLPTLALIPAPRESRRLLARSGHEAEPATTTALALIEDVRSPVAEA
YRHLRTSLLLSSAGQPPKTVLVTSSQPSEGKTTTVVNIATMLAQTGADVLILDCDLRRPRVHAHFGLPNSRGVTNYLSGE
AQVSELVQTYDKLPNLKVITSGPVPPNAAELLGSEEMRRLLYVLSENFTHIVIDSPPAISFTDASILSTMVDGVMLVVHG
GRSSRAVVRRAKQQLQDVGAHIFGIVLNNVKLEGTDYYYYSGYYSGYYSDEEAAPEGAAAAAEAGGGRGV
>gnl|bykdb|A0A2V8R4S3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=797 residues).
MMQDNRLLPLTPETLDRPLRDLAQPSPVAVSSNEPVNLRDYLAVVLKRKWLILSLMVVITSLVAIQMYRLPSIYEAQATI
QIEQKKGGVLQTAGAGNLIIRGSDPNYWNTQLQKLKTQKLARQVILRLDLQNSPAFFGTNRGTGVIAGLRHIIARGKPTP
TPQPAAGGVPVLSDAELSADQIAPEQAQALEPYEDAMRAGLNIDAVEKTNLVEIHFQHTDPEIAASVANTLATIFRDNDI
QEETTGSQKAEDVLANEIIDLQARIQANEQKRINYRKENDLPLGTKQGQDLNALQLSTYSSQMQTAEAARKQAEADYKSA
VETRNTSGIWAVPQVQSNPSVLKLREKMGELEEQKAALLVNYTPEWPAVQKIEKQLKSLHEQLDKMPDEIIAGLENRYEA
AIKNERSATGSYFAARAKANDQSVADTKLADLDQQIATDRQNLNLYMQRANELKVTAPDRASGNVTMVEEARTPREPIGP
PRVRNIIIALLLSIAVGIGLAFLLDYLDDTLKSIEDVDRHLHLPTLALIPAPRESRRLLARGSHEPEAGTTTALALIEDV
RSPVAEAYRHLRTSLLLSSAGQPPKTVLVTSSQPSEGKTTTVVNIATMLAQTGADVLILDCDLRRPRVHAHFGLPNSRGV
TNYLSGEAQVSELVQTYDKLPNLKVITSGPVPPNAAELLGSEEMRRLLYVLSENFTHIVIDSPPAISFTDASILSTMVDG
VMLVVHGGRSSRAVVRRAKQQLQDVGAHIFGIVLNNVKLEGTDYYYYSGYYSGYYSDEEAAPEGAAAAAEAGGGRGV
>gnl|bykdb|A0A2V8R8U7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=791 residues).
MIQDERLVPAGRGLDNSLADLTQAKPFGRYDRYNSAPAETNVREYLYVILKRKWLILSLVLVVTSLVTIQAYRQPSIYEG
GTTIRIESKPAPVLATGQVIINAPADANFWGTQLKLLQNPQLARQVVLSLELQKNPSFLGGQAQSSVFASLKRIFSGERI
ATPPAQNPAAEQTVTMDEMKDRQLTPEELATLEPYEDAIIANETIEPIIGTSLVTIRYQHTDPALAQRIANTLADVFVQN
NRERLDIGTSKAVESLAQEIAKYQDKVNKEQDARFAFAKAKDLPLGPESGPNIEAVRDATYSSQLLAAENERRTFLAIYE
AAKNAPDPFANPEVQKDERILRLRGKISDLKDKLTFLRQKYTDEWPDVKQASAQIDELEKELKKAPQEVLASMKSRADAA
EAHERSLEKAYSVQHGKTVSQTRNVIDLAIKTQELTTDAQYLNTLMQKRRELAAGGADRGTDVSVSNYSRTPQLVGPQRM
RNIMIAFVLALVAGIGLAFLIDYLDDTVKSLDDIDRYIHLPALALIPSVRSEKRLRGAEPLKPSDTTALAMVTDVRSPIA
ESYRHLRTSLLLSSAGTPPKTILVTSSQPSEGKTTTAINTAFMLAQTGADVLIIDCDLRRPRLHSHFNLSNTRGLTNCLS
GESEVADLLQTYDKLPKLKLLTSGPIPPNPAELLGSEEMRKLLVSLSEKFTHIIVDSPPAISFTDSSILSTFVDGVILVV
HGGRSSRAVVRRAKQQLLDVGAHIFGVVLNNVKLESTDYYYNTYYSSYYRTDESDVQGGADAGQNSRAASS
>gnl|bykdb|A0A2V8RQV0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=839 residues).
MEQEQRLTTLPHLGELRHSKHEYAGSYSGAYSDEVIEGRRTVQQYFNIVYKRLPLILALTILVTAAAAFYMYRQASVYQA
STQLVIEPRKPKVTSKDSININFGNDANYYNTQLELLKNPELMKKVVISLGLYRNKTLFGGQNAGILAGIKSLFSRSKAQ
TEEANALPVISDTEQLNSKGELAKLSPEEEALANQHVGNLIGRLQIVPQERTNLVNVTIQNEDPALAGKVTDEIAAIFIE
EDKERETQGERKAIEDLTKSIEELKLTIQDQESQLMAQMRESDLPLLEKGQDLAAQRLGAMSEAYMKAMETRRQLEATLN
AAESANARGEAVNIPSIGENKIFQDTMRLNTERKAKLQDQIRDIEKQIQQTEVEKSELLVKYTEAYPEVGKKDAKIASLR
ETKEKTEKEVSKIIDTDQKKIEKEAVSGALVSLRAQLNAARTQEAQAQAAYEQESGTANVQGQAQTKMITLKREIETNRN
LLDTYTQRLKEQELSRANDAPENIKIAANAGPAILVGPPRGRNIFVAFLFSLAAGIGLAFLMDYLDDSVRTSEDIGRHLG
LPTLGLIPHHGIAERRRLMAAGNGAALSPHAAALITLEERNSPMAEAYRHLRTSLLFSSAGKPPQSILVTSSQPSEGKTT
TAINTAITLAQSDVDVVIVDCDLRRPRVHSYFDLDNTQGLTNYLSGERNTENLIKSSRELPRLKVITSGPIPPNPTELLS
SNEMKNLMQFLRGKFKHIIVDSPPAISFTDAAILSTVVDGTILVAMANRSSMHLMRRFKQRANAIGARIYGVVLNGIKSG
SIEYEYYGTGYYDYYGKAKDDTSTPIMETNGNGHAEESE
>gnl|bykdb|A0A2V8RTL7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=832 residues).
MKEIRELVPTKPNDTVVELERPFETHVIPGTGRYPAYRDVYGPEGFQIVDYWRAIRKRLWLVVGIAVLITTLAAIYMARK
PNIYLASSVVQVDLEQTNPDLITNDRQRVLSNPDPSYFNTQLQLLNSDTLLRRVVKEHNLDANKDFQAAKNAHGTSAWRS
MMKAVGLASDKSSNSPDANTQKSEETNSSLVSADEIAEALRLSPYVDLIKEDLIVEPVRESRATVKDTRLIEISYRNTNP
ELAAFVVNAIGETFVNANQEKRSGTSRKTSDFLQKRINDLQTDIRGDEIKLVELKQSEGILKTDGDQTIVIDRLSGLNKQ
LLEAENARKLAEAKYFAIKDSPESLNALAEQDSQRYITERENSVLQLRTDVRKKINDLNAEKARKLEDYKETAPEIIEID
KQIASLEDSLEKLLEKNNKDIQAYKERSATILLENYKTQYQQAKDQETKIRSAYDVQYNEAQGQNSGAVMIKLLEQTIET
NRGFLDNLRKQQSGNDVASQGSDNNISVASFGIPPEAPVAPRRLMTVVAALLLSSLFGMGLALFLEYLDDTINTTEEVEN
LLQLPALTAIPTIDSIPKRKLLLVGGKGEEVEEDRLNSELLIFADPRSSLSESYRQLRTSILLSTAGHAPKSLLITSSLP
SEGKTTTATNTAISLGQTGAKVLIIDADMRRPRLHSVFNVSNNQGISTVLSSELSTKEILDVINYDERTKVSVMTSGPIP
PNPAELIGSEQMVGLLKTLQSEFTHVVIDSPPITSFTDGVLLASLVDGVILVVHSGKSSRQVVRRARQLLIDVRAKVLGV
VLNNVNLNSQDNYYYYQSYYYRNNYRHTDEGE
>gnl|bykdb|A0A2V8S6K4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=803 residues).
MSQDNRLLPLPTPAGNIDRPLRDLTQPAVQVTGSYSLPEPTHLRDYLNIVLKRKWLILSLVTVVTTLVAIQMYRLPSIYE
AKTTIQIEPKRNALIKTKDIVVNAGADPAYWGTQLKLLENPSLLRQVIMRLGLQNNPSFLGGQSRPSIFTTLRRAFSRNK
AQTNEQPQPADGGLTVANEAAPGDELKLTPEQLKQLEPYEDALAGNLTVDPVERTSLVDIHFKHTDPELARQVADTLAAV
FIENDRARESKGTEDMKVATARQITDLQAQIAELEKKRTDALVQSGSAVNPEAKGANVTVERVAMLSTEWLNAQNEVTKL
QSEYDAAQKAQAASDIFSIPKVQDNKQIQDLQIKLAALNEQRVALLKQYTENWPAVQKVEAQIKQTEDAQQKIAKAIVIG
MGASLDGAKKRAASLQAAYYKERSAAQAQGIQVIGLSNVEQQLTTSKQMLSTLLQRRQELETADIEGQSNNVIIQTPART
PQLVGPPRVRNIIIALLLALGAGIGLAFLLDYLDDTLKSIEDVDRHVHLPTLALIPAPREARRLAFGRTAHVHDHTESTA
LALIEEVRSPVAEAYRHLRTSLLLSSAGQPPKTMLVTSSQPSEGKTTTAVNTAMMLAQTGAEVLILDCDLRRPRVHMHFN
LPNTRGVTNYLSGEINVSELIQTYDKQPNLKVITSGPVPPNAAELLGSEQMRRLLQLLGEQFTHIIIDSPPAISFTDASI
LSTMVDGVVLVVHGGRSSRAVVRRAKQQLLDVGAHIFGIVLNNVKLEGNDYYYGYGYYSNYYAHDADEEETSGPAQARAG
GQP
>gnl|bykdb|A0A2V8SEX6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=826 residues).
MKETREIIQKPLNEPVELERHFEPQIVPAGRYPSYRENVAEGFQLLDYWKAIRKRLWLVAGIAVLVTTLVAIYMARKPDI
FSATARIQVDLEQVNQDLVTSDRQRPISNPDPSYFNTQLQLLDSENLLRQVVKEHSLDTNKEFLTARSEGTGILRAMLRA
VGLASDPKKDTAPNDEFAASANSSLISSDEIAEAVRLAPYVEIIRKNMSVEPVRESRATVKDTRLIEISFRHTNPQLAAF
VVNSIGETFVTANQNKRSGTNRKTSDFLQRRITDLQSEIRSDELELAELQKNIGILKTDGEQTIVLERLAGLNKNLLEAE
NKRKNAEAQYVAIKDSPEAINALAEQDNQRIIQDRKLAIIAYRNDTQKKISDFRSQRAKLLQEYKESAPEIVEIDTQIRS
LEDSLTKLVDENTTEVQKLQERASKLLVDNLRTKYLQTKNEEDKIRAAYDEQYNAAQVQNGGAVRLKLLEQTIETNRGFL
DNIRKQQSSNDVASQGSDNNISVAGFAIPPEHAVSPSRLMTVFAALFLSTLFGMGLALFLEYLDDTIRSTEEIETYLQLP
ALAAIPTIDSIPKRRLLLVGASNEEVEDPGNNSELLISADSRSALAEAYRQLRTSILLSTAGHAPKSLLITSSLPSEGKT
TTATNTAISLAQTGAKVLIIDADMRRPRLHSVFNIENGDGLSTILSTEMTEKEILKVVKQDEGTKLNLLTSGPIPPNPAE
LIGSEQMANLLKLLSQNFTHVVVDSPPITSFTDGVLIASMVDGVILVVHSGKSSRQVVRRARQLLQDVGAKIFGVVLNNV
NLRSQDNYYYYQSYYHRNNYRPSDEQ
>gnl|bykdb|A0A2V8SJH5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=848 residues).
MEQDQRLTPLPKSLDLRASKTEYPATYAGFYDDEVSEGRRSIQQYFNVVKKRLPIILAITLLATVAAALYMYKQPSLYQA
TTEMVIEPRKPKVQSKESININFGNDANYYNTQLELLQSHDLMKEVVIRLGLYKEADVFGEEDRGLLSGVRSMFSSRKAN
SGPDNSLPVVSELPAGTDASDNIQLTPEERARVENYAAMLAGRVTVQPKERTNLVNVSVTTPKAELSARVADKVEEVFID
KDAQRETEGSRRTYEDISKSIEELGKTISEQEADLISYMRSSGLPLQEKGQDLSAARLQSMSETWLKAMEGRRQLEARYT
AAAQAGARGEGMNIPDLSESKIFQDTIRLNTERKAKLQDQIRDIEKKIQDSEVEKAELLVKYTPEYSKVKVVEERIASLK
ATKDRTESEVSTIIDKDQKKIEKDAVNGALVTLRSQLSAAQKQEAQSLAAYEQEASQANVQGQAQTELITKKRAIETNRN
LLDTYTQRQKEQELAIASGRPENIKIAANAVTPGGPIGPARTRNILVAFLVSFGVGIGLAFLLDYLDDSVKTSDDIGRHL
GLPTLALIPHHFGSEKRRLKLIAANGNGLANGNGNGNSATATGLITLAERRSPMAEAYRHLRTSLLFSSAGKPPQSILVT
SSQPSEGKTTTAINTAVTLAQADADVVIVDCDLRRPRLHTYFDLENTQGLTNYLSGERNTEHLIKTCRELPRLKVITSGP
IPPNPAELLSSNEMKNLLQFLRGRYKHVIIDSPPAISFTDAAILATLVDGVVLVAMAGKSSIHLMRRFKHRLGTIGARIY
GVVLNGIKAGSMEYDYYGTGYYEYYGKSETDLSTPVMEEVESIHTTKP
>gnl|bykdb|A0A2V8TCE6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=746 residues).
MTSPREAESEIREFWSILVRRQWAIYTVAGLVLGLTALRLLMVQSTYKAKALVEIQRSSPDVLAFRDIIRTDPSYQGYSA
FYETQYRILQSRAVARRAAERLDLPRHPLLPRKSPGLLQRTLAALRRALPRGEAHAAPAEPMGPFIDLVLAGLSIEPVKD
SNLVEVVYLSPDPRFCAQLANAVADAYIEFALSSQFDTTEQASDFLSRRVGELRDEVEDLEKRLQSYRESRRILPSAGAE
NIALKGVSDIDAIYLQARARRIATESEWTAARGTDPSSLPAVVENPTVQRLQHEVNDLEIQRAELLRTFKPGWPQVEVLT
RKLEGARQQLSSETEAIARRIVSAEQAKYRAALDEEERLGKLLEEQKSEAQRTGRDSIEYATLQAEVERKRAVLNALLQR
QNETAVSSQLRDMNAGNARIVDRAIPPTAPCKPRPGVELPLGLFVGLLLGMGAAFGMESWDNTLRTQEEIERFLGTPTLA
RIPSASLDPQRRGGPAWGTGEIDLMSHHHPSSPLAESFRDLRTALSLSSAGSTPRSLTVASTRPEEGKSTIAINLATVLA
QSGKKVLLVDSDLRRPRLHRAFGLRNGSGLSTFLCGKASLEEAVQMTLVARLWLLASGPVPPNPAELLDSACFDELLKMV
LDSYEMVVLDSAPLLTVADGAILASRTEGTLLVVESDRTTREEALRAREKLRQVSARLLGVVLNNAAESGRSYGRYRYRY
EPSADSGAADARRAPFRRAAGLLRMR
>gnl|bykdb|A0A2V8TLH7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=717 residues).
MSENLPIVEEQREVHLLDYWRTISRGRWTILSVFVVIVTLVAIGTFTQKPVYRARATVEITSQASKVAPVADVSQLGTSN
FGWSAEERYFNTQNEIIKSRDVAQRVFDKLDLYHHPMFRKSSDPVGVFSSMVQVELIKDTGIMQITLDGPEPKEVQTWVN
SVAEAYVDRNLDLSIEATGRAVKALLSEIAPMREKLQDTQRSSFELAEKENLYVPENQQKITNDRLSALQADYTETQVKA
AELESVLKRVDEVRQNGGSYEVIPQISGDAVVQDVYREKAILERDLEKLSVTYKDKHVRVLEKQSEIDKTNQKLASEVDR
IISNLRTQYALLKDRESKLAVAINETRSESLRVNQKASNYELMRTEALDTKRIYDLISARVKEIDLSASLLSNNLRVLDR
APLPQMPIRPRPILNLLIGVMLGLLLGVGTVFFLDYMDNTVRTSEDVERYLKLNILAVVPRDNDATRRAVREAYQTLRTS
LLFSRKARTANAVLVTSAGPQEGKSCTSVNVARTLANAGEKVVIIDCDLRRPTVHQWLKLSKDQGITNYILSTEGDDWRT
YLKTTDQSNLYALTSGPIPPNPADVFGHERFKRLLKELRQEFDWVFVDSPPAVSLADAMILASLCDMVAFVVKHNENDKD
LIRRCVGDLRKINANVIGAVLNNIDLERSDYKDYYYVGYYYYGESSSSKKDRKRRSTTSLETVDDQGVEGKVTRIVG
>gnl|bykdb|A0A2V8TTB0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=745 residues).
MKKFENNLPAVPEVYRAAAPVPVIDAEFEPQAPQVPLAHYLWILRKHGWTIAGFVVAAVLGTLIVSLRLTPVYESTVTVD
IDRQMPTGVLGPESLQNATNDADQFLATQMKLIQSDSVLRPVVDKFRLREVEKDALEQPSERWQGSDEAPVILKYLKITR
PPNTYLLLISYRSPNRQLAADVANAIALSYLAHTYRIRYKATAGLSEFMERQLEELRAKMEKSSAALAQFERELNVINPE
EKTSILSARLLQLNTEYTNAQGDRVKKEAAYNSIQSGSLAAAQVSSQGEALKKLTENLNEAKERFAEVRNHYGINHPEYR
KAQTKVQELETQIADTGASIAQRVEIEYREAVNREAMLEKAVAETKAEFDRLNARSFEYQTLKREAESDKKLYEELVRKI
KEAGINASFQNSSIRVADPARPGLKPVFPLTWLNVLLAFLFATFLGVGAAVLTDVLDNTIRDPDQVARLMNTNVVGSLPT
VKDWRRRLSPISSSGSANGHRNGNGAIPAPPNGAVPAADNTDQALSNYEEAIRTLRTSILLTDFDRSLRSVLLTSASPSE
GKSTVAAHLAATHAGQHKRTLLIDGDLRRPSVHRLYQVPNSVGLSNVLLQQISWRDVVIRMDDPKGLDVLPAGPPTRRAS
DLIGSGVAELIEEATREYDLVVLDAPPLLGFAEPLQMATAVDGVIVVARAGDTSRKALSSVIGTLARLRANLVGVVLNEV
HRKVSAGYYYYYGHYSKYYGRTEDK
>gnl|bykdb|A0A2V8U914 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=705 residues).
MRVLYRRRVTLLSVTLAGVFIAALLSMAQPRLYRSVASLEVQGVNENFLNLRDIDPAATPNASSNDVYVKTQSEILQQDA
LIEQASDKLNLAERPEFQPHSGFWERLREASPRAAQNAAQYAADVARKHLKIEPARDSQIIRVAFDAHDPQLAADFANTL
ARTFIEQSVNGRRRAAQEIQEWLGPRIQELRSKLQTSEAALDEYTRESGLVLAPGDDTLAADKLRGVQDELSKAQSDLIA
KQVQFDLIAKNPAEITTENPGIRDYETKLTDLRRQLADLESILQPESYKVVRVKAQIVQLEAAIARESRRVRQSVQNDYV
AAQRRQTGLASVYARQSALVSKMTAKMTHYNTLKHEVDTNRQFYEAMLQKVNEAGLASAVRQSNIRLVAPAEPAFRPYKP
NLPLNLSIGLFAGLVLAVGSVMLTEQTNSRLRAPGEASFYLNLPELGTIPSAESLEPALQKLIGTENGKQPVERITWDKR
FSKMSEAFRATVASILSAEQNGDHHDVLVITSPLAGEGKTTVSSNLGIALAEVRGRVLLIDGDMRRPRLHKIFGLANSWG
LSDILRERNATEDLPLDALVKKTGVPRLYLLPSGPCTDSIFSLLYSERMARLMQRFRQEFDYVIVDAPPCLEFADARILA
RYAEGVLLVLRANYGDKKTALAAANRLFLDGVPVLGTILNHWNPVVWGDAYGYPSYRGVYDQTAS
>gnl|bykdb|A0A2V8UZY0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=769 residues).
MSKYFELMNRLRRDSPLAVSACDIGPEEPENLEVHGTRAAPRFVRSLPNHPPHPVARASDERASDEMFAAGLWRIIQDRK
WTITAFALVVVAIVLTASYYMKPRYEAVGRVVVVFHRENDSGVLGFKGVDTSLLEDPEDRAAIDTQIGILQTDALAMQVI
KDLHLNKNPKFTGRVEQPDNEDRLVKSFHKSLRISKVKGTRLIEIKFRSTDPRLSADVVNSLAKEYVDHYYRSQFQVNAQ
ISSFLANQLKELQSKVEESQQRLLAYQKQSGLFGLDNKQNLVTAKLDDLNRGLTAAEADRIQKEVNYRLAVSGRPELIAK
LEPDNLITRLRAQLADLENQIAQASVQLGPAHPKMVELSKQLDQARRSVDAEVNRIGKRITYEYQSAVGRERILQDALEA
QKQTADKLYANAVQSEILKHEFETNRKLYEDLLQKQKEVGISASLKSSNIWIVDPARPPKLPVEPDIRRNFALSLLFGIF
GGVLLAFGLAKVNEKTIITLEQARLLSPLPALGVLPLLKTMSRNGAARQLTGVGGDVKPELVSLLQPLSLAAESYRAMLT
PLMLSAATPPGIILVTSAVPGEGKTTVCTNTAILLARLHRRVLLVDADLRRPSIHRAMRLSCNTGLGALLRKSVTFDEAV
IQRAEVPNLYILPAGPVMLPDDTELLVSGFKDLVDHWRDQFDHIIIDTPPVLAMTDAVRMSVEADSVILVIRSGQIARDT
FLRAQDLLRRVNAHVAGFVLNGAQVDSSDFRYYYSYHSQHQTKSLGEGR
>gnl|bykdb|A0A2V8VC99 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=714 residues).
MPETLAPLEEKRDVHLLDYWRIIWRGRWTILTIFVVVVTLVAIGTLTQKPVYRAQATIEISPQSRKVSPVADVAEMGASQ
YGWFAEERYFNTQYEIIKSRDVARRVFDRLDLYNHPLFKETTDPIGTFSSAIEVEPIKDTGIVVIGLEGLNPEEVAAWAN
AIAEVYVDRNRDQAVEATAKAVRALLSEIAPLREKLKDSQQSTFEFAERANLYVPENQQKITNDRLSTLQAGLTETQVKK
GELEGLLKQIDSVRLSHGSYENIQQISGDPVVQELYREKVGLEREYERLLVTYKDKHIRVQEKQKEIDEISRKIASEVDR
IINGLRAQYELLKDREAKLIKVSDDTRAESLQVNRKASSYEMVRGEEAETKRIYDLISIRVKEIDLSSSLMSNNLSILDK
APVPKVPVRPRTVLNMAIGVLFGLLLGVGTVFFMDYMDNTVRTSEDVEQYLRLNLLAIIPKQSDETLSAVKEAYQTLRTS
LLFSRKNRSANTVLITSAGPQEGKSCTTVNVARTLATAGERVMILDCDLRRPAIHTRLNLSRDHGVTNYILSSDGDDWRN
YIKASDLPNLYALTCGPIPPNPADVFGHERFLALLKELRSQFDWVFIDSPPVVSLADSMILASLADMVAFVVRHNENDKE
LIRKCVTNVRKINSNVIGAILNNVDLERSHYKDYYYVGYYYYGTSGGKRGRRRKGSSSIAAVPTTDAEEKRSVG
>gnl|bykdb|A0A2V8VZA0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=767 residues).
MADENKLVPRENGSSGAVEVVSLSNRVPSFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATTR
VEIDRENANILPFQGTDSYDYMMDLENYIETQSKILTSETLALQTIRNNALSTRPEFSSPNGPSEAVASGSLANQKRPPE
LAEFLGSLSVKRVPNSRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLADQLGELKIRVQRSEDARI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERMKKESLYQFAKAGNLDAVPEVQNNSALGDLLKKRSDAASQYNDA
LAQYGPNFPKVQRLQAQLKEFDQTIEKEKQKILDVLESDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYNILKREAEA
NKTLYEGLMTKLKETAISQGLRSSNIRVVDPAMIPSTPARPAKTRNVALAFLVGLVGGMGLALMREYLDNTVKSPDDVET
LSGLPSLAVVPQFAGSNGNGKRHGLLQGLSSNGHDKRIELVAQHLPKSQMSEAFRALRTSILLSQAGHPPQVILVTSALP
REGKTTAAGNLAVTLAQLGDSTVLVDADLRKPGIGRLLNLAGGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLVDAIAELRTKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLNSVKCRILGV
VLNAVDRYYPYSYGYGPQEAVEAPHEEDSDAIAHRVSRDRDDDSEAL
>gnl|bykdb|A0A2V8WIU1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MADENKLVPRENGSSGAVEVVSLSSRVPSFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATTR
VEIDRENANILPFQGTDSYDYMMDLENYIETQSKILTSETLALQTIRNNALSTRPEFSSPNGPSEAVASGSLANQKRPPE
LAEFLGSLSVKRVPNSRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLADQLGELKIRVQRSEDARI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERMKKESLYQFAKAGNLDAVPEVQNNSALGDLLKKRSDAASQYNDA
LAQYGPNFPKVQRLQAQLKEFDQTIEKEKQKILDVLESDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYNILKREAEA
NKTLYEGLMTKLKETAISQGLRSSNIRVVDPAMIPSTPARPAKTRNVALAFLVGLVGGMGLALMREYLDNTVKSPDDVET
LSGLPSLAVVPQFAGSNGNGKRHGLLQGLSSNGHDKRIELVAQHLPKSQMSEAFRALRTSILLSQAGHPPQVILVTSALP
REGKTTAAGNLAVTLAQLGDSTVLVDADLRKPGIGRLLNLAGGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLVDAIAELRTKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLNSVKCRILGV
VLNAVDSGAPDYYYSYRYYPYSYGYGPQEAVEAPHEEDSDAIAHRVSRDRDDDSEAL
>gnl|bykdb|A0A2V8WQK6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=773 residues).
MKPSEFPLDKTDRRRNELSRGAEQRPTVYKYVESPSTEVGASPGYDSLLDYWHILIRHRMTVLRFAVAGLLGAIVVSLVQ
TPIYRVRTSLEIQGPNFPEMKGANDSNGSYASPESYVETQVKILQSESVIEHVIDKLKLQKERPRTGWRGLASRVQRIFA
FSKASNLPEREELIRQIKRNLTVRTSGNSRLLEVLYESPDPQRAADFANTLVSQYVELSQEERWRSAQGTAEWLTSHLGK
MKGELEASEAQLQDYARASGLSLTSEKENPVVNRLKELQDELSKAQADRIAKQAKSEEARSKPADSVPEMLEDPTMREYR
QKLTELQRQYAELSATLTPEHYKVKRVQAQITELRSEMQKERANVLRGLGNEYAAAVRRERLLSKAQAEQEKIAADQSDK
VIHYDTLKRDVDSNRRLYEVMLQRVKEASLATAMRDSNVLVVDRAKPPLLPYRPSLPVNSAIGLFSGVFLGFGFVLLRER
IDRRISAPGDAQVYLDLPELGVLPLDQAAVSWQIPNRLPPHRAASSRPPESALRSSLGDCPELATWKRKPSLLAECTRTT
LISILSPNQNGEGPRIIVLTSACPGDGKTTVACNLSIAMAEIGRKVLLIDGDLRRPRLHKIFGVANTWGLSDLLWADNPL
ETVPISHLVRETEVSSLSLLPGGSCGITPSNLFYSPRMSRLLRRLRSEFDMVMIDAPPVIHLADARVLGRLADGVILVVR
AGQTTTESALFASQRFAEDGTRVLGTVLNSWDPKNSRGYGYGNYREYEKYVGQ
>gnl|bykdb|A0A2V8WX45 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=796 residues).
MEDQKQVELYGRGHRLDRRGPGALDGRVVELPDSYEILESDEGLDLRAYGRILHKRLPTILIVFFILFTTILVVTLKQRS
VYRAQVLLEIQKENPDIPTIKELYELEAVSDAYLRTQYNILASESLSRRVIEQLRLDTLPEFNSPRWWQIWPKTKKPSTA
QTFAIGPVPAGGDRELSQRVLERFQDQLTVDPVNRSRLVTVRFDSRDPELAARVVNTLAADYVDQSLEARWQATQKAAEW
LTQQLVGVKAKLEKSEDELQTYARRNGLVFLETDKGASQNVANERLQQLQEQLTKAQAERYEKEALYRLVQTGEYESLPG
VFENKLIQDLSERLAELKREHAQLSTTFNADYPRVKEIQSQIDEIEGSLQVERKRAADRIANDYSAAVRRENLVQQALGE
QQEQVSLIAEKSVQYNILKREVDTNKQLYEGLLQRLKEAGVSASLKASNIRIVDSAEPPARPVKPRIALNLMVAAFLGLG
LGVCAAFFQERMDNTLKGDDDVERLFGLPSLALIPVVPPSNGDQHGIHRFLQQDKALVLKGNGTGKDARSSWHRIDLDGT
QHGALVEAFRSLRTSVLLSTPDRPPGSLLVTSTQPAEGKTTVACNLAISLAQLGHRVLLVDADLRFPSLHKLFGTSGSLG
LVSYLTGQQDWHAAVRPCGSHGLDVLVCGPVPPNPSELLSSQSMGALVRSAKTEYGFIILDSSPMLALADSRILAPLVDG
VLLVVKSGTTPREQILHAQSGIRSVGGNLIGVVLNSVDIRTNGYYNYGPYGPDARPPLQETFATTDFETPQQKASD
>gnl|bykdb|A0A2V8XAR9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=779 residues).
MADDNKLVPRENGSNGPVELVPLPARLPSWELSPREPHLYDYLLVLRKHQWLILSFMLAVVTIVTISTFRMQPVYNATAR
IEIDRENANILPFPGADSYDYMMDLENYIETQSKILTSETLALQTIRNTGLSARPEFSSPNGPSEAMASGSLANQKRPPE
LGEFLGSLSVKRVPNSRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASTWLADQLSELKIKVQKSEDARI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERMKKESLYEFAKSGNLDAVPQVQSDAGLAELLRKRNDLSSQHSDA
LSQYGPNFPKVQRLQAQLKDLDANIEKEKKKIVDVLESDYREARQRESMLTQALDQQKAAANQMAEKLVEYNILKREAEA
NKALYEGLMTKLKETAISLGLRSSNIRIVDPAMIPSTPSRPAKARNITLAFLVGLVGGIGLALMREYLDNTVKSPDDVET
LARLPSLAVVPQFASSNGSSKRQGLLQGFAANGQDKRIELVAQHLPKSQISEAFRALRTSILLSQADHPPQVILVTSALP
REGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLGSGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLADAIAELRTKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLASVKCHILGV
VLNAVDSSAPDYYYSYRYYPYSEGYGPQEPGETFHSEHSESVAEAVIQHYDDEDDTQAL
>gnl|bykdb|A0A2V8XIF4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=774 residues).
MQASQFSIEKSKRRPNGLSANGKQRPVLYAYLDSPAAEGAATPGYDNLLEYWHLLAQHKMTLLAFGVCGLVAAILFSFIQ
TPTYRVRTSLEIQSTNFVEIKGGDPSGSTASIASPESYVETQVRRLQSESLLERVIDKLKLRKERPATGWRAFESRVQRF
FDLSKTPHLPEKEELIRQIQRNLTVRESGNSRLLEILYESPDPKLAADFTNTLVSEFVELSQEERWKSAQGTAEFLTNHL
DQMKAQLEASETQLQEYARTSGLSITAEKENPAENRLKELLDELSKAEADRIAKQAKFEEAQSKPADSLPEMLEDPTMRE
YRQKLTELQRQYAELSATLTPEHYKVQRVQAQINDLKAEMQRERNNVLRRIGNEYTAAVRRERLLVEVHANQEKVVADQS
SKAIHYDTLRRDVDSNRRLYEVMLQRVKEASLATAMRDSNVLVVDRAKPPLLPYRPSFPMNSAIGLFSGLFLGFGFVILR
DRLDRRITAPGDAQAYLDLPELGVIPFDQGGLAGQIAGRLHSHRPTRTLTSDTAPDSSANWPELATWKRKPSFLAECART
TLTSILLPSQNGDCPGVVVLTSPSSGDGKTTVACNLAIAMAEIGRKVLLIDGDLRRPRLHKVFGAPNNWGLSDVLWGDTP
LETLPISHLVRETEVAGLSLLPGGSCGITPTNLFYSPRMARFLKRMRKEFEMVMIDAPPMIHLADARVLGRHADGVILVM
RAGQTTTESALYASQRFAEDGTRVLGTVLNSWDPKNSHRYGYGSYADYEEYVGQ
>gnl|bykdb|A0A2V8XN17 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=796 residues).
MDDQNQVELYGRGHRLDRRGPGAPDSRVIELPDSYEILESGEALDLRSYGRILRKRLPTILVVFFILFTGILIATLKQKP
VYRAQVLLEIQKENPDIPTIKEMYELDAVSDAYLRTQYSILASESLARQVIDQLQLEALPEFNSPRWWQFWPSKKKSPPP
QTFTIGPVSEARDRELSQRVLERFQDRLTIDPVNRSRLVAVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEW
LSQQLVGVKAKLEKSEDELQSYARRNGLVFLETDKGASQNVANERLQQLQEQLTKAQSERYEKEALYRLVQTGELGALPG
VFENKLIQDLSERLAELKREHAQLSTTFSPDYPRVKEIQSQIDEIEASLRDERQRAADRIANDYSAAVRRENLVQQALDN
QQKQVSLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAGVSAGLKASNIRLVDSAEPPAKPVKPRTLLNLSVALFLGLA
LGICAALFQERMDDTLKGDDDVERLLGLPSLALIPVVASANGNHLGIHRFLPRDKSLVLAGNGSGKNSRSWHLIDRDGAQ
HAALGEAFRSLRTSVLLSTPDRPPSSLLVTSTQPADGKTTVACNLAISLAQLGHRVLLVDADLRSPSLHKLFGIDRSLGL
VSYLTGQQDWRAVVHPSGSRGLDLLLCGPVPPNPSELLSSQSMGALIRSASAEYGFVILDSSPMLALADSRILAPLVNGV
LLVVRSGTTPREQLLHAQSGIRSVGGNLIGVVLNSVDIRTNGYYNYGSYGSNRGDPPQETFVPTNLHLPPQQKASD
>gnl|bykdb|A0A2V8XZK2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MAEENKLVPRENGSNGAVELVPNTPRFASFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATAR
VEIDRENANILPFQGADSYDYMVDSENYIETQAKILTSETLVLQTIRDSGLTARPEFSVGGGPSEAVASGSLANRTRPPE
LAEFLGSLSVRRVPNSRLMDVSFESTNPQLAARIVNAHIATYVEQNFRSKYESTTHASDWLADQLNDFKIKVQRSEDARI
AYERQNQIWTLDDKQNMTTQRLGDINRQFTDAQSERMKKESLYEFAKAGDLDAVPQVQSNAALTDLLKKQRDSSAEYTDA
LAQYGPNFPKVQRLKTELKDIEDSIEKEKRKVLEVLESDYREARQRETLLSEALDQAKVEANQMSEKLVEYNILKREAEA
NKALYEGLMTKMKETAISAGLRSSNIRIVDPAMVPTSPARPAKARNIMLAFLVGLIGGIGLALMREYLDNTVKTPDDIES
LARLPSLAVVPQFTGLNGSKGRGVLPGLSSNGHERRIELVAQHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALPR
EGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLGTGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLPP
NPADLLSSHRLADAIAELRTKFKFIVIDSPPIMAATDAVILSVLADGVLLIVRSGETPKAAFTRTRDLLNSVKSRILGVV
LNAVDSSAPDYYYSYRYYPYSYGYGPQEAGEPAQGDDASESVTEALSRHHDDDSQAL
>gnl|bykdb|A0A2V8Y334 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=792 residues).
MGEQQNVELYSRGPRFERGGRAFLDHRVLDLSDAYEIVEPEEPLDFRAYARILRKRFSTVLIVFFLVFAVTLIATLKEKP
LYRAQVLLEIQKENPDIPTIKDLYELESVSDSYLKTQYSILASESVVRRVIDQLHIDALPEFNSPKWWQFRKKAFKPRNQ
TFALDQESSARDPEVYQRVLERFQDRLTVDPVSRSRLVTVRFDSNSAELSARIVNTLAEDYIDKNLEARWKATQKAADWL
SQQLVGVKAKLEKSEEQLQDYARHNGLVFLETDKGASENVANERLQQLQEELTKAQTERYQKEALYRLVQAGDYGSLPGV
VENKLIQDLSERLADLKRELAQLSTKFNAEYPRVKEIQSQIDEIEGTLKEERQRAADKITNEYFAALRRESLVKEALDGQ
QKQVNLIAEKAVQYNILKREVETNKQLYEGLLQRLKEAGVSASLKASNIRIVDPADPPAKPAKPRIPLNLAVGVLLGLGL
GISTAFLQERLDDTLKGADDVERLFGLPALALIPSVHHLDGDRHGVRKLLDRTNHPGNGHNGTASNPGARWHRIDQSGKP
QPALVEAFRSLRASVLLSTADHPPGSLLVTSTQPGEGKTTIATNLAISLAQLGQRVLLVDADLRFPSLQKLFCIRETLGL
VSYLTGQQDWRAAVCPSGSPGLDVLLCGPVPPNPAELLSSKSMGAFIASAKSEYGFVILDSSPLLTLADSRILASLVDGV
LLVVKSEATPREQVLQSQSSIRSAGASLIGAVLNGVSLHTNGYYGLGIYGSNGNSHSEIISDAEDSWSTLRK
>gnl|bykdb|A0A2V8YF91 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=776 residues).
MTDENKLVSRGNGSNGAIELAPVTPRFVSFDLSPREPHLYDYLLILRKHLWLIVSFMLTVVTIVAIANFRMKPVYVATAR
IEIDRENANLLPFQGADPYDYTVDFDNYIETQAKILTSETLALQTIRNGGLSDRPEFSGPGGPSEAVASGSLTNQIRPQE
LGQFLGSLSVKRVPNSRLMDVSFESTDPRLAARIANAHIATYVEQNYRSKYESTTQASNWLADQLSELKVKVQKSEDARI
AYERQNQIWTLDDKQNITTQRLSDINRQLTEAQSERMKKESLYQFAKSGNLDAVPQVQTNTALTELLKKRSDTSAEYANA
LTQYGPNFPKVLRLQAQLKEIDENIQGEKRGILDALESDYREARQRETLLTDALDQAKAEANQMAERLVEYNILKREAEA
NKALYEGLTTKMKETAISAGLRSSNIRIIDPAMVPTSPARPAKTKNITLAFLVGLVGGIGLALLREYLDNTVKSPDDIEA
LARLPSLAVVPQFSGSSGGNRRGFLPSFSGNGHEKRMELVAQHLPKSQISEAFRALRTSILLSQADHPPQVILVTSALPR
EGKTTVAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLGPGKYAGLSSYLAGASSLDLVSVPHPSIPNLVAIPTGPLPP
NPADLLSSHRLAEGIAELRTKFKFVVMDSPPIMAATDAVIVSVHSDGVLLVVRSGETPKAAFARTRDLLNNVKCRVLGVV
LNAVDPGAPDYYYSYRYYPYSYGYGPQEVTETAQGEASDAAEEAASRRHDDDSQAL
>gnl|bykdb|A0A2V8ZG48 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=792 residues).
MSEQNKVELYARDARFERARLGFLDHRIVDLSDSYEILEPDEPLDLRAYGRILRKRLPTILIVFFLVFTVGLIATLKEKP
IYRAQLLLEIQKENPDIPTIKDLYELESVSDSYLKTQYSILASESVARQVIDQLHLDTLPEFNRPKWWQFGKRLSLPRKQ
TFALDPVRPGQDPEVYQRVLERFQGRLTVDPVSRSRLVNVRFDSNDAQLSARIVNTLAEDYIDQNLDSRWKATQKATDWL
SQQLVGVKAKLEKSEEQLQDYAQRNGLVFLETDKGTSENVANERLQQLQEELTKTQAERYEKEAVYRLVQAGDYGSLPGV
VENKLIQDLSERLAELKRQFADLSTKFNPEYPRVKEIQSQINEIEATLKEERQRVADKIVNEYLAAVRRESLVKQALDEQ
QKQVNLIAEKAVQYNILKREVDTNRQLYEGLLQRLKEAGVSASLKASNIRIVDSAVPPAKPAKPKIPLNLAVATLLGLGL
GISAAFLQERLDDTLKGADDVERLFGLPALALIPAVHHLNGNGPSVRRLLDHSNLLRSRQNGTASNPCACWHRIDQGGKR
HAALVEAFRSLRASVLLSTADHPPGSLLITSTQPGEGKTTVATNLAISLAQLGQRVLLVDADLRFPSLEKLFCIRENLGL
VSYLTGQEDWRTAVCPSGSPGLDLLPCGPVPPNPAELLSSKSMGAFLGSAKSEYAFVILDSSPLLMLADSRILASLVDGV
LLVAKSGATPREQIRQSQSGIRSAGANLIGVVLNNVTLHTNGYYGLGIYGSNGNSHSEAISDPAEPWNRLSK
>gnl|bykdb|A0A2V8ZHL8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=759 residues).
MPPGVKDMPDNEALSLRGAKLPVLESPQSPAFPVLGIDVQDFESFSYLQAYWNIVNKRRWTIATVAFIATLLVAIASFKM
TPIYEATARLDIEADTAQIQSFNDLYRQVPTDEAFIGTQIQVLESDNLAQRTIEQLGLAREPGWVLAAGSGNDGLPAQPQ
NSEDKLLRLFKSRLHVQRVRDSHVVNISFEGPDSSLSAKIANSLASNFIEYNFRQKYDATRQASGWMEQQLDELKAKVEK
SQQALVDYERQNAIVNISDKESVVEQRLADLSRDLTNAQSDRVQKESLYELVKSNESQVAFVAQNDLLQRLEEKFADLKA
QYVDALEQYGPKHPKVERFRSQVDEVQSLIDTERKRIVERLRNDYMAALGREKLLAAAVAKEKADVGALSQLLIQHNLLK
REFDSNQQLYDSLLQRLKDATVSAGLRATNIHVVDPARPPRVPVRPQKLLNIAIGLVVGLILGVTLAFVKEALDTSIKSI
EEAERVVNAPALAVVPLEREIPHRPALSRARNNGNSKPSETALALLKQPSSALAESFRTLLTSVVLSTAPRPPQALLITS
ATAREGKSTTALNLAIALAQRGDSTLIIDADLRRPGIAESLDLIDGEGLAGFLTGAHSIEAALIQFSPVPALRVLPAGPK
PPNPAQLLSSSAMESLLKELRQRFKFLVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTARGAVARARKVLENAGARILG
LVFNKVDVRHNGYYGYYGHYYYSGSGKTERHSASEAVRS
>gnl|bykdb|A0A2V8ZTX6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=742 residues).
HVELAPLPNRFASFDLSPREPHLYDYLLILRKHQWLILSFMLAVVTIVSIATFRMQPVYVAIARIEIDRENANILPFPGG
ESFDYMVDSENYIETQAKILTSETLALQTIRNNGLALRPEFAASGGPSEAVASGNLANQTRPPELAEFLGNLSVKRVPNS
RLMDVSFESTDPRLAARTVNAHIATYVEQNYRSKYEATSQASDWLADQLRDFKIKVQKSEDARIAYERQNQIWTLDDKQN
MTTQRLSDINKQFTDAQAERMRKESLYEFAKAGNLDAVPQVESNTALADLLKKKGETSADYADALTQYGPNFPKVLRLKA
QLKDIDDNIEKEKQKILDVLESEYREARQRETLMGQALDQAKAETNQMAEKMVEYNILKREAEANKALYEGLMTKMKETA
ISGALRSSNTKNIILSFLVGLVGGIGLALLREYLDNTVKTPDDIETLARLPSLAVVPQFAGTNGSKRRSMLQGFSENGHN
KRIELVAQHLPKSQVSEAFRALRTSILLSQAEHPPQVILVTSALPREGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIA
RLLNLGGGKYAGLSSYLAGVSSLDLVSIPHPAIPNLVAIPTGPLPPNPADLLSSHRLADAIVELRSKFKFIVLDSPPIMV
ATDAVILSVQADGVLLVVRSGETPKVAFTRTRDLLTSVKSRILGVVLNAVDSSAPDYYYSYRYYPYSYGYGPQETGESVQ
AEASESVSEVVSRHQDDDSQAL
>gnl|bykdb|A0A2V9AC41 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=894 residues).
MEQVNQPSPYFIKRTARVEQGTIDLNEFAVVDDQVHPLREYWLTIKRHRWLIVMTALAILACAMLYLFTRIPLYTAEATV
LIERKAPQILKVQDTRADSIDSGDYNNEFYKTQYEILRSPALAERVIREEGLQNLPLFGGKADKADSQKGLVANLKDGLK
ERVKGFVPDKPKVNAPPPDPATAGKRLAGSYLSKLHISPVGGTSLVKVRFTTPDPALSARLANAHANSYVRYGVDLRSQT
NEEASEFLKQRLTELKERVEQSETALNSYRKDKGIISVDEKENVVIDRLLDLNRSLTKAEAERIGLEAQMHSIHGRNYDE
VPLVRDSLVIGGLKGELAKSEADYASLAKEFKAGYPPLDNLKVRMEETRRRLQAEIQNEVKRIEVTYTAAKNNETGLRAT
MEDQKKTTLNLKDAAVQYAMLAREVDMNKQLYDGVLQRLKEIGVAAEIRSSNIYLMGKAEPPGGPSYPDKNGILLRGLFL
GLLMGVGLAFLFDQLDNTIKSPEEAERFIQLPTLGVVPDFALLTGTRTGYVSKLVNSAKAELPAPTRDEDRPSVLDHHPL
SLVAEAYRSLRSSLLLSQAGGPPHTMLMTSATRGEGKTTTLVNTAIVFSQLGIRVLVIDADLRRPRCHMLLKMENTAGLA
DVLAGQIGMEEAIRPTQAENLFLISAGTIPPNPAELLGSRKMHELLQQLREQFEFIFIDSSPVMAVSDAVFLSTMVEGTL
MVVNRRTPKPLVRKTRTRLSTPHTKILGVLLNRVDVRAGEYGSYYAHYYEYYPHDLDLSDGPPAAFGNGNGALSHRVNRH
SPATPEPAARKQRSNGLPAGFIDSVGSKLAEAMGPMATLVLDDHILALGESSESFPEAKIEELTKLVSEEILDDSLRVRF
EKQMSKEIQKLGEL
>gnl|bykdb|A0A2V9AEW6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=711 residues).
MTLLGFAVVGLLASIMISLVQTPIYRVRTSLEIQGTNFQEMKGIDSNGNYVSQESYVETQVKLLQSESLIEHVIDKMKLH
KEQPTTAWGIFASRVHRLFAFSRTGRLSEREQMIRQVERNLTVQSSGSSRLLEVLYESPDPKQAADFANTLVSEFTELSQ
EAHWKSAQGTAEWLTNHLDEMKTQLEASEAQLQDYARITGLSFTSEKESLAEARLKEIQDELSKAQADRIANQAKYAEAA
GKSADSLPEILEDPTMRDYRQKLTELQRQYAELSATLTPEHYKVLRVQAQIDELKAQIEKERGNVLGRMRNEYEAALRRE
KLLTEAHDAQQKVVADQSSKAIHYDTLKRDVDSNRRLYETMLQRVKEASLAAAMRDSNVMVIDRARPPKLPYRPSLPMNS
AIGLLGGMFLGLGFVLLRERLDRRISAPGEAQIYLDLPELGVIPLDDTAVSRHGANLLNMRRLTPSVPSGVESDSSDKSP
ELATWKRKPSLIAECVRTTLTSILLPNQDGDPPQVVLLTSPCLGDGKTTVACNLSIAMAEIGRKVLLIDGDLRRPRIHQV
FGMTNRWGLNDVLLSDTPFEEFPMSHLARKTEVAGLSVLPSGNCGVTPTNLFYSPRMSKLLARLRREFDMVLIDAPPMIQ
LADARVLGRLADGVILVVRAGQTTTESARFAIQRFTEDGTRVLGTVLNSWDPRTMRYGYGGYGVYKDYVGQ
>gnl|bykdb|A0A2V9AY68 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=794 residues).
MSEQNKVELYARRPRFERGGSVLLDNRVLDLSDSYEILEPDEPLDLRAYGRILRKRFSTILIVFFLVFAATLIVTLKEKP
VYQAQVLLEIQKENPDIPTIKDLYELESVSDSYLKTQYSILASESVARRVIDQLHLDSLPEFNKPKWWQLQERFFTPHKQ
TLALDPAGRARDPEVYQRALGRFQDRLTVEPVSRSRLVTVSFDSNNARLSASIVNTLAEDYIDENLEARWMATQKATDWL
SQQLVGVKAKLEKSEEQLQDYARHNGLVFLESDKGVSENVANERLQQLQQELTKAQAQRYEKESVYRLVQAGDYESLPGV
VENKLVQDLSERLAELKRELAQLSTKFNPEYPRVKEIQSQIDEIEAALKDERKRAADKITNEYFAALRREGLVKGALDTQ
QNQVNVIAEKAVQYNILKREVETNKQLYEGLLQRLKEAGVSASLKASNIRIVDSAEAPAKPAKPKIPLNLAVASLLGLGL
GISAAFLQERLDDTLKGADDVERLFGLSALALIPSVHQLGGNRNGVRKLLRRTNGLRHGHNGTASNPGVRWHRIDQGGKP
QAALVEAFRSLRASVLLSTADHPPGSLLVTSTQSGEGKTTIATNLAISLAQLGQRVLLVDADLRFPSLQKLFCIRECPGL
VSCLTGQQDWHAAVCPSGSPGLDLLLCGPVPPNPAELLSSKSMGAFLTSAKSEYGFVILDSSPLLTLADSRIIASLVDGV
LLVVKSGATPRQQVMQSQSSIRSAGANLIGVVLNNVTLHTNGYYGLGMYGSNGNGNSHSEMISEAADSWNTLSK
>gnl|bykdb|A0A2V9B240 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=764 residues).
MPHKVKDMPDNQALSLRGPRLPVPESPHLPAFPVLGTDVQEFESFSYLQTYWNIINKRRWTIVTVAFIVTLLVAIASFKM
VSIYEATAHLDIEADTPQIQSLNDLYRQVPTDDAFIGTQIQVLESDNLAQRTIEQLGLARDPAWALAVGLGNDVPPVQLQ
VWEDRLLGPFKRRLHVQRVRDSHVVNISFESPDPGLSAKIANSLANNYIEYNFRQKYDATRQASGWLEQQLDELKAKVEK
SQQALVDYERQNLIVNISDKESVVEQRLADLSRDLTNAEGDRVQKESLYELVRSNESQVAFVAQNEILQRLEEKFADLKA
QYVDALEQYGPKHPKVERLRSQVDEIQSLIDTERKRVVERLRNDYEAALGREKLLAAAVAKEKVGVGALSQLLIQHNLLK
REFDTNQQLYDSLLQRLKDATVSAGLRATNIHVVDLARPPKVPVRPQKLFNIAVSLVVGLILGVTLAFVKEALDSSIKSI
EEAERVVNAPALAVVPLERELPHRPARSLTRNNGNSKSSGAELALLKEPSSALAESFRTLLTSVVLSTAPRPPQALLITS
ATAREGKSTTALNLAIALAQRGDSTLIIDADLRRPGIAESLDLVDGEGLAGYLTGAHSIEAALRQFSPVPTLWVLPAGPK
PPNPAQLLSSSAMESLLKELRQRFKFLVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTARGAVARARRVLENAGARILG
LVLNKVDVRHNGYYGYYGHYYYSSGSGKTKRTPASESVSSHLPG
>gnl|bykdb|A0A2V9BCA0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=780 residues).
MEENGSKLAAHDNGANGAVEIIQAPLRMPVFDLSPHEPHLYDYLLILRKHQWLILTFLLTVVTIVSIATFRMKSVYVAPA
RIEVDRENANFLPFQPADPYAYLLDQENYIETQSKILTSETLALQTIRSVGLAGHPDFSEGGKPSEAVTTGSLANQNRPP
ELAAFLGSLTVKRVPNSTLLDVAFESTDPRLAARVVNAHIENFIEHNFRSRYEATTQASSWLADQLNELKIRVEKSEDAR
IAYERQNQIWTIDDKQSITTQRLGEINKELTEAQSDRMKKEALYQLAQSGSLDALPAVRDSELLQDIYKKRNDAYTQYTS
ALNQFGPNFPRVQRLQEQLKEFDGLIDAEKKNIVTSIENEYRAARQRELLLLKALDQQKAEANQMAERLVQYNILKREAE
ANKALYEGLLTKLKEAGISAGLRSSNIRVVDPAMIPSSPARPAKMRNISLAFLVGLVGGIGLALLREYMDNTVKTPDDVE
MLARLPSLAVVPAFIDTNGRNGRRRFLRGLAAATNGREARVELVSHHLPKSQMSEAFRALRTALLLSQADHPPQVILVTS
ALPREGKTTAAANLAVTLAQLGDKTLLIDADLRKPGVGRALSLGEGKYAGLSSYLAGVSSLDLVTVPHPAIENLAAIPTG
PLPPNPADLLSSHRITDAIAELRAKYKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGQTPKEAFTRSRDLLTSVKCRL
IGVVLNAVDSTAPDYYYSYRCYPYSYGYGEPQAGELPASTEQDAISRRRPPEHEDDTQAL
>gnl|bykdb|A0A2V9BT79 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MTDENKLVPHENGSNGNVELVPIPGRFASFDLSPREPHLYDYLLILRKHQWLIVSFMLSVVTIVSIATFRMQPVYVATAR
IEIDKENANILPFQGADSYDYMMDSDNYIETQSKILTSETLALQTIRNNGLALRPEFAESGGISEAVANGNLANQTRPPE
LAAFLGNLSVRRVPNSRLMDVSFESTDPRLAARTVNAHIATYIEQNYRSKYEATSQASDWLADQLRDFKIKVQKSEDARI
AYERQNQIWTLDDKQNMTTQRLSDINKQYTDAQAERMKKESLYEFAKAGNLDAVPQLDSNSALTELLKKRGETSADYADA
LQQYGPNFPKVLRLKAQLKDIDDNIEKEKRKILEVLESDYREARQRETLLADALNEAKAETNQMAEKMVEYNILKREAEA
NKALYEGLMTKMKETAISGALRSSNIRVVDPAMVPATPARPAKGKNIMLSFLAGLVGGIGLALLREYLDNTVKTPDDIET
LARLPSLAVVPQFAGSNGHKRRGMLPDFSQNGHDKRIELVAQHLPKSQMSEAFRVLRTSILLSQAEHSPQVILVTSALPR
EGKTTAAANLAVTLAQLGDRTVLVDADLRKPGIGRLLNLGAGKYAGLSSYLAGVSSLDLVSIPHPAIPNLVAIPTGPLPP
NPADLLSSHKLADAIVELRTKFKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGETPKVAFTRTRDLLTSVKSRILGVV
LNAVDSSAPDYYYSYRYYPYSYGYGPQETGDAAQGEILESASEAISRHHDDDDSQAL
>gnl|bykdb|A0A2V9BWU8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=803 residues).
MSEPNKLEPFAQGPRSGHGGLRFMDNRVVDLSDSYEIIEAEEPVDLRAYGRILRKRFATVAIVFFLVFAGSLIATLKEKP
VYRAQVLLEIQKENADIPTIKDLYELESVSDSYLKTQYTILASDSIARRVIDQLHLDSLPEFNAPKWWSLKRFARAPQKQ
AFALGPAPVAHDSAVYQRVLERFQDRLSIEPVSRSRLVTVRFDSGNAQLSARIANALAEDYIDQSLEARWLATQKATDWL
SQQLVGVKAKLEKSEEQLQDYARHNGLVFLENDKGASQNVANERLQALQEELTKAQADGYQKESVYRLVQSGNYGSLPGV
VENKLIQDLSERLAELKRELAQLSTKFNAEYPRVKEIQSQIDEIEATLREERQRAADKITNEYSAAVRREELVKQALDDQ
QKQVNVIAEKAVQYNILKREVETNRQLYEGLLQRLKEAGVSASLKASNIRVVDSAEPPARPAKPRIPLNLAVAALLGLGL
GISTAFLQERLDDTLKGADDVERLFGLSALALIPSVHCLNGDRPSVRKLLDRTLPLKSAHNGTASNPAARWHRIDQVDRG
EKPQAALVEAFRSLRASVLLSTADHPPGSLLITSTQAGEGKTTIATNLAISLAQLGQRVLLVDADLRFPSLQRLFCIRES
LGLVSYLTGQQDWRTAVCPSASPGLDLLLCGPVPPNPAELLSSKSMGAFLGAAKSEYGFVILDSSPLLTLADSRILAALV
DGVLLVVKSGATPREQVIQSQTSIRSAGANLTGVVLNNVSLHTNGYYGLGIYGSNGNGSSNSNGNSHSEMISDSADSWST
LSK
>gnl|bykdb|A0A2V9BWU9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=761 residues).
MDESTALMQRDRRAGSSFEVITAHPQFSSWETPPREPHLLDYWRILRKYQWSILSFLLTVVTFVTIATLRMHPVYEATAR
VEIDNENTNFLPFKSDSYEMYMDMENYIETQSKILQSETLALQTIQSAGLVELPEFGGQPGKASKPASVPVNAANQARPP
ALGGFLGSLRVKRVPNSRLLDVTFEAGDPKLAARVVNVHLENYIEQNFRSKYLATTTASNWLKDQLNELQFKVEKSEDAR
IAYERQNQIWNIDEKQNITQQKLSDLNKELTQAQGERMRSEALYQLVGTGHIDALPPVRDSLLLQDLQKKQSELNTQYVE
ALNQYGPSFPKVVRLQAQLKEIEHLIAREKANIINRIEAEYHTARQRENLLSQALDKQKGESNAMAEKLVQFNILKREAE
ANKQLYEGLLQKMKEASISAGLRSSNIRVVDPAMVPSAPSRPQKTRNILLAFLIGLVGGVGLALLREYLDNTVKTPGDIE
MLTRLPSLAVVPAFVTLNGRNRVPKMLKSGSGNGTESRVELVSHTLPQSQISEAFRALRTSLLLSQAEHPPQVILVTSAL
PREGKTTAAVNLAVTLAQLGDRTLLVDADLRKPGISRALSMSDGKYAGLSSYLAGVSSLELVTVPHPAITNLAAIPTGPV
PPNPADLLSSRRLSEAVSILRQEYKFIVIDSPPLMAATDGVILSVLVDGVLMVVRSGETPKEAFMRARDQLVAVKCRLLG
VVLNAVDSSSPDYYYSYRYYTYSYGAYGKEKDGAFERHHQS
>gnl|bykdb|A0A2V9C238 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=775 residues).
MDPENKIKLYEPAVRKWERLRPTPAVRAEPLEMKESADLLAYWRVLRKRRWTILTVFFVLFTVVLLGTLKQKPIYRAKAL
LEVAKENPNILTVQELFALDTVSDTYLETQFKILQSDTLARRVIEGLRLDKLEEFNPRASQLGDAKPQNAAAAQSFTAGD
TERDPWAYQTALKRFRDRLSVDPIKRSRLVEISFESRDAELAARVLNALASHYIEQSLEVRWEATQKASEWLSQQLLELK
ARLEKSENEMQSYARENGLLFLEKEKGAENIVNERLRQLQEELTRAQAARYEKESLYRLVQAADYASLPGMAENKLVADL
AVRLADLQREQAQLATTFTADYPKVRQIQSQINELDAALARERGRVAGRITNDYLAAVRRENLVAQAFAEQQKQANLIAG
RSVQYNILKREVETNQQLYEGLLQRLKEAGVSAGLKASNIRIVDAAEPPKKPARPNLPLNLALAVLLGTGLGVVQEHVDN
SLKTSEDVERFLGLPALALIPAVESLNGRRKGAYRLYGGSKPLANGKPQTSALPSTTPRWYRIDVEATQQSALAEAFRSL
RTSVLLSTADRPPRTLLVSSSQPSEGKTTVSINLAISLAQLGQRVLLIDGDMRRPSVRKAFDIDNSLGLVSYLTGQQDWR
AAVRPTGLESLDALVCGPVPPNPAELLSSERMRTLLREAKVEYHFVVVDSPPLLNVADSRILATLVEGIVLVVKGGETPR
ELAQRAGAYARDVGANLIGVVLNNLDLRGGDDYYYRYYHYNYYGSDEHPSGDSKG
>gnl|bykdb|A0A2V9CBM2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=782 residues).
MGEQNQSEPYSHAHRLARKRGSLEASVVELADSYEIIGPEEGIDLRACGHIVRRRLSTILAVFFVVFVVIAIATLKQKPT
YRAQVVLEIQKENPDIPTIQELYQLETVSDDYLRTQYDILASDSLARRVIDQLRLDTVSEFNAPQLFSWKWKKKAPTSQT
FTVGPIPADRELYQRVLERFRDHLTIAPINRSRLVAVRFDSHNPDLAARVANNLAADYVEQGLDERWAAAQRASDWLSRQ
LLSVKAKLEKSEDQLQAYARHNGLVFLQTDNGTTQNIANERLQQLQQELTKAQAELYEKESLYRLVQTSDYGSLPGVFEN
RMLQDLTVRLTDLKREYAQLSTTFGSDYPRVKEIQSQITDVEASLQQERKRAADQITNEYFAASSRESLLRHELAEQQKQ
IDRIAEKSVQYNILKREVDTNKQVYDGLLQQLKSAGLAASLKASNILIVDPAEPPAKPAKPKILLNLVLASILGLALGVG
EAFLQERLDDTVTGADDVERLCGLSVLALIPAVQPSNGDQHGGVHYKLLEHAGALSLRENGGARKLVPSWYRIDVHATRH
APLVEAFRSLRASILLSAAEGPRNSFLVTSTQPSEGKTTVASNLAIALAQLGRRVLLVDADLRSPSLHRLFGARESSGLV
SYLTDPQDWRTLVRHSGSSGLDLLFCGPVPPNPSELLSSQSMETLIQSAGEQYEFVILDSAPMLALADSRILAPLVSGVL
LVVKSRTIPREQVLHAQSSISSVRANLIGVILNGVDVRTNGYYDYGRYRSTATKIVSDENFA
>gnl|bykdb|A0A2V9CG11 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=748 residues).
MESPPNREVATAGGYDSFLDYWRILIRHKKMLLLVTLAGLIAAILIGLVQTPVYRARTSLEIQDFNENFLDLKSVDPTVT
ADDYTTGASYFETQVKLLQSESLLERVIEKLNLREARKSHSIVRRMLRLSNSQHVPEDELVHQAERNLTVRAAGNTRVLE
VLYESPDPKLAADFANTLASEFIEETQGMRLKAFQRTAEHLTVKLDEMKAKLEQSEAQLQDYARTSGLTFTSEKDNVSDA
RLVELQSELTKAQAERIAKQAKFEQVKSTPVESLPEMLDDPTLREYRLRLTDLQRQFVELTATLTPAHYKVQRVQAQIAE
LQSAVKNQRTLILRRIGSEYSAARQREEFLAKAYADQEMIAADQSSKAIRYRTLKGEVDSSRQLYEAMLERVKQAELATA
MRASNVLVIDHAEVPRLPYKPNLPMNAALGMFGGFFLALGLVLFRERLDRRIQSPGDAHVYLNISELGVITSAEIKHSRQ
IANHKQANPALAMEAGSSELVLESHLDDRPELAAWNRKSSLSADCYRATVTSILLANQNGDLPQVIVVTSPCQGEGKTTV
ASNLSIAIVELGRRVLLIDGDLRRPRLHKVFGLCNNRGLSSILSVNDIVHIKQLLCETAISGLYVLPAGSSTTNTTRLLH
SRRMSELLALLRREFDMVIVDAPPVTQLADARVLGHLADGVILVVRAGQTTLESALFATECFAKDRTRVLGTILNGWDPK
TGGRYGYGGYYAGYGGVSQRGGIAGDEG
>gnl|bykdb|A0A2V9CYQ5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=793 residues).
MGEQNQSEPYRHAHRLVRRTGNGLEASVVELADSYEILGPEEGIDLRACGHIIRRRLSTILTVFFVVFVGIAIATLKQKP
TYRAQVMLEIQKENPDIPTIQELYQLETVSDDYLRTQYDILASDSLARRVIDQLRLDTVSEFNAPPLLSWKWKKKAPRSQ
TFTVAPIPADRELYQHVLERFRNHLTIAPINRSRLVAVRFDSQNPDLAARVANALAADYVEQGLDERWAAAQRASDWLSR
QLLSEKAKLEKSEDQLQAYAHRNGLVFLQTDNGTTQNIANERLQQLQQELTKAQAELYEKEALHRLVQTSDYGSLPGVFE
NRMLQDLTVRLTDLKREYAQLSTTFGSDYPRVKEIQSQITDVEASLQQERKRAADQITNQYLAASSRESLLRHELAEQQK
QIDLIAEKSVQYNIRKREVDANKQVYEGLLQQLKSAGLAASLKASNILIVDPAEPPTKPAKPKILLNLLVASILGLALGV
GEAFLQEHLDDTVRGADDVERLFGLSVLGLIPAVQPSNGDQHSIHKLVEHPGSLSLRENGCARKLVASWYRIDVHATRHA
PLVEAFRSLRASILLSAAGGPPNSFLVTSTQPSEGKSTVATNLAIALAQIGRRVLLVDADLRSPSLHRLFGARESSGLVS
YLADHQDWRTLVRHSGLSGLDLLFCGPVPPNPSELLSSQSMETLIKSAGKQYEFVILDSAPMLALADSRILAPLVSGVLL
VVKSRTIPREQVLHAQSSISSVRANLIGVILNGVDVRTNGYYDYGRYRSTASQIVSDKISLESDSQGALTQSN
>gnl|bykdb|A0A2V9DEM9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=780 residues).
MDPENKIKLYEPAVRKWERLRPTAAVRAEPVEMKESADLLAYWRVLRKRRWTILTVFFVLFTVVLLGTLKQKPIYRAKAL
LEVAKENPNILTVQELFALDTVSDTYLETQFKILQSDTLARRVIEGLRLDMLEEFNPRASQLGDAKPQNAAAPQSFTAGD
TERDPRAYQTALKRFRDRLSVDPIKRSRLVEISFESRDAELAARVLNALASHYIEQSLEVRWEATQKASEWLSQQLLELK
ARLEKSENELQSYARENGLLFLEREKGVPENIVNERLRQLQEELTRAQAARYEKESLYRLVQAADYASLPGMAENKLVAD
LAVRLADLQREQAQLATTFTADYPKVRQIQSQINELDATLARERGRVAGRIINDYLAAVRRENLVAQAFAEQQKQANLIA
GRSVQYNILKREVETNQQLYEGLLQRLKEAGVSAGLKASNIRIVDAAEPPKKPARPNLPLNLVLAVLLGTGLGVGAAFLQ
EHVDNSLKTSEDVERFLGLPALALIPAVESLNGRRRGVYRLYGGSKPLANGKPRTLALPSTTPRWYRIDAEATQQSALAE
SFRSLRTSVLLSTADRPPRTLLVSSSQPSEGKTTVSINLAISLAQLGQRVLLIDGDMRRPSVRKAFDIDNSLGLVSYLTG
QQDWRAAVRPTGLESLDALVCGPVPPNPAELLSSERMRTLLREAKVEYHFVVVDSPPLLNVADSRILATLVEGIVLVVKG
GETPRELAQRAGAYARGVGANLIGVVLNNLDLRGGDDYYYRYYHYNYYGSDEHPSGDSKG
>gnl|bykdb|A0A2V9DKX2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=761 residues).
MDESTALIQRDRRAGSSFEVITAHPQLSSWETPPREPHLLDYWRILRKYQWSILSFLLTVVTFVTIATLRMHPVYEATAR
VEIDNENTNFLPFKSDSYEMYMDMENYIETQSKILQSETLALQTIQSAGLVELPEFGGQPGKASKPASVPVNAANQARPP
ALGGFLGSLRVKRVLNSRLLDVTFEAGDAKLAARVVNAHLENYIEQNFRSKYLATTTASNWLKDQLRELQFKVEKSEDAR
IAYERQNQIWNIDEKQNITQQKLSDLNKELTQAQGERMRSEALYQLVGTGHIDALPPVRDSLLLQDLQKKQSELNTQYIE
ALNQYGPSFPKVMRLQAQLKEIEHLIAREKANIVNRIEAEYHTARQRETLLSQALDKQKGESNAMAEKLVQFNILKHEAE
ANKQLYDGLLQKMKEASISAGLRSSNIRVVDPAMVPSAPSRPQKTRNILLAFLIGLVGGVGLALLREYLDNTVKTPGDIE
MLTRLPSLAVVPAFVTLNGRNRVPKMLKSGSGNGTESRVELVSHTLPQSQISEAFRALRTSLLLSQAEHPPQVILVTSAL
PREGKTTAAVNLAVTLAQLGDRTLLVDADLRKPGISRALSMSDGKYAGLSSYLAGVSSLELVTVPHPAITNLAAIPTGPV
PPNPADLLSSRRLSEAVSILRQEYKFIVIDSPPLMAATDGVILSVLVDGVLMVVRSGETPKEAFIRARDQLVAVKCRLLG
VVLNAVDSSSPDYYYSYRYYTYSYGAYGKEKDGAFERHQQS
>gnl|bykdb|A0A2V9EVV8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MADENKLVPRENGSNGAVELVSLQSRVPSFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVGTAR
IEIDRENANILPFQGAESYEYMMDLENYIETQSKILTSETLALLTIRNNALSTRPEFSSPNGPSEAVASGSLANQKRPPE
LAEFLGSLSVKRVPNSRLMDVSFESTDPRLAARIVNAHIASYIEQNFRSKYEATTQASTWLADQLGELKIRVQKSEDTRI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERLKKESLYQFAKAGNLDAVPEVQNNSALGDLFKKRSDAASQYTDA
LAQYGPNFPKVQRLQAQIKEFDQTIEKEKQKILDVLESDYHEAQQREALLTRALDQQKADTNQMAGKLVEYNILKREAEA
NKTLYEGLMTKLKETAISQGLRSSNIRVVDPAMIPSTPARPAKTRNIALAFLVGLVGGIGLALMREYLDNTVKSPDDVET
LSRLPSLAVVPQFASSNGSSKRHGFFQGLSSNGHDARIELVAQHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALP
REGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLAAGKYAGLSSYLAGVSSLDFVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLADAIAELRAKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLSSVKCHILGV
VLNAVDASAPDYYYSYRYYPYSYGYGPQEALEAPHENESDAIAHRVSRDRDDDSEAL
>gnl|bykdb|A0A2V9EY85 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=799 residues).
MDDQNQVELYGRSHRLDRRGPGALDSRIIELPDSYEILEPGEALDLRSYGRILRKRLPAILVVFFILFTAILIYTLKQKP
VYRAQVLLEIQKENPDIPTIKELYELDAVSDAYLRTQYSILASESLARRVIDQLQLETLPEFNSAKWWQLWPRKKKSPAP
QTLAIGPVPEAPDRELSQRVLERFQDRLTIDPVNRSRLVAVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEW
LSQQLVGVKAKLEKSEDELQGYARRNGLVFLETDKGASQNVANERLQQLQEQLTKAQSERYEKEALYRLVQNGEFGALPG
VFENKLIQDLSERLAELKREHAQLSTTFSPDYPRVKEIQSQIDEIESSLREERQRAADRIANDYSAAVRREDLVHQAVDG
QLKQVNLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAGVSAGLKASNIRLVDSAEPPAKPFKPRTLLNLSVAVFLGLA
LGICAALFQERMDDTLKGDDDVERLLGLPSLALIPVVPASNGDHLGIHRFLPRDRFLSLAGNGNGPGKDPRPSWHLIDRD
GTQHAALGEAFRSLRTSVLLSTPDRPPSSLLITSTQPADGKTTVACNLAISLAQLGHRVLLVDADLRSPSLHKLFGIDRT
LGLVSYLTGQQDWRAAVHPSGSRGLDLLVSGPVPPNPSELLSSQSMGTLIRSASAEYGFVILDSSPMLALADSRILAPLV
NGVLLVVRSGATPREQLLHAQAGIRGVGGNLIGVVLNSVDIRTNGYYNYGPYGPNAGSPPQETFVPANFQMPPQQKASD
>gnl|bykdb|A0A2V9FFE5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=797 residues).
MDDRDQVELYGRRHQLERRGPDALNTRIVELPDSYEILESGEALDLRSYGRILRKRLPSILVVFFILFTVILIATLKQRP
VYRAQALLEIQKENPDIPTIKELYELDAVSDAYLRTQYSILASESLARRAIDQLRLETLREFNSRKWWQLWPETRKPSTT
QTFTVGPLPQVRDRELSERVLERFLDRLTIDPVNRSRLVAIRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAEW
LSQQLVGVKAKLEKSEDALQGYARHNGLVFLETDKGASQNVANERLQQLQEQLTKAQSERYEKEALYRLVQTGESGALPG
VFENKLIQDLSERLAELKREHAQLSTTFNPDYPRVKEIQSQIDEIAASLREERQRAADRMVNDYSAAVRRENLVQQALDD
QQKQVNLIAEKSVQYNILKREVDTNKQLYEGLLLQLKEAGVSASLKASNIRLVDSAQPPAKPVKPKILLNLAVAMFLGLG
LGIGTALFQERMDNTLKGDDDVERLFGLPSLALIPVVPPSDSDQHGIHRFLPRDKAFEFKGNGAGKNSRSCWHRIDRDET
QHASLVEAFRNLRTSVLLSTPDRPPSSLLVTSTQPAEGKTTVACNLAISLAQLGHRVLLLDADLRYPSLHKLFGTSGSLG
LVSYLTGQQDWRAVVRPSGSRGLDLLVCGPVPPNPSEMLSSQSMSALIRSASAEYGFIILDSSPMLALADSRILAPLVNG
VLLVVKSGTTPREQFMHAQSGIRGVGGNLIGVVLNNVDICTNGYYNYGPYGLNPDCPSHETVVTANFQMPPQQKASD
>gnl|bykdb|A0A2V9GM43 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=797 residues).
MDDRDQVELYGRRHQLERRGPDALNTRIVELPDSYEILESGEALDLRSYGRILRKRLPSILVVFFILFTVILIATLKQRP
VYRAQALLEIQKENPDIPTIKELYELDAVSDAYLRTQYSILASESLARRAIDQLHLETLREFNTRKWWQLWPETRKPSTT
QTFAVGPVPQVRDRELSERVLERFLDRLTIDPVNRSRLVAVRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAEW
LSQQLVGVKAKLEKSEDALQSYARRNGLVFLETDKGASQNVANERLRQLQEQLTKAQSERYEKEALYRLVQTGESGALPG
VFENKLIQDLSERLAELKREHAQLSTTFNPDYPRVKEIQSQIDEIAASLREERQRAADRMVNDYSAAVRRENLVQQALDD
QQKQVNLIAEKSVQYNILKREVDTNKQLYEGLLLQLKEAGVSASLKASNIRLVDSAQPPAKPVKPKILLNLAVAMFLGLG
LGIGTALFQERMDNTLKGDDDVERLFGLPSLALIPVVPPSDSDQHGIHRFLPRDKAFEFKGNVAGKNSHSYWHRIDRDET
QHASLVEAFRNLRTSVLLSTPDRPPSSLLVTSTQPAEGKTTVACNLAISLAQLGHRVLLLDADLRYPSLHKLFGTSGSLG
LVSYLTGQQDWRAVVRPSGSRGLDLLVCGPVPPNPSEMLSSQSMSALIRSASAEYGFIILDSSPMLALADSRILAPLVNG
VLLVVKSGTTPREQFMHAQSGIRGVGGNLIGVVLNNVDICTNGYYNYGPYGLNPDCPSHETVVTANFQMPPQQKASD
>gnl|bykdb|A0A2V9H8K0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=797 residues).
MDDKNQVELYGRDQRLERRGPDALNTRVIEMPDSYEILESAEALDLRSYGRILRKRLPTILIVFFILFTAILIATLKQRP
VYRAQVLLEIQKENPDIPTIKELYELDAVSDAYLRTQYSILASDSLARHAIGQLGLETLPEFNSPRWWRFWQERRKPSTT
QTLATGPVPEVRDRELSQRVLERFLDRLTIDPVNRSRLVAVRFDSHDPELAARVVNTLAADYVDQNLEARWQATQKAAEW
LSQQLVGVKAKLEKSEDELQSYARHNGLVFLETDKGASQSVANERLQQLQEQLTKTQAERYEKEALYRLVQAGESGALPG
VFENKLIQDLSARLAELKREHAQLSTTFNPDYPRVKEIQSQIDEIAASLREERQRATDRIVNDYSAAVRRENLVQQALND
QQKQINLIAEKSVQYNILKREADTNKQLYEGLLLQLKEAGVSASLKASNIRLVDSAQPPAKPVTPRTLLNLAVAMFLGLG
LGICTALFQERMDDTLKGDDDVERLFGLPSLALIPAVPPSNGDLQGIHRFLPRDKALILEGNAAGKNSRSFWHRIDRDGT
QHAALVEAFRSLRTSVLLATPDRPPGSLLVTSTQPAEGKTTVACNLAISLGQLGHRVLLLDADLRFPSLHKLFGTSGSLG
LVSYLTGQEDWRAVVRPSGSRGLDLLVCGPVPPNPSELLSSQSMGALIRSASAEYSFIILDSSPMLALADSRILAPLVNG
VLLVVKSGTTPREQLMHAQSGIRSVGGNIIGVVLNSVDIRTNGYYNYGQYGPNADSSSHETVVTANFQMPPQQKASD
>gnl|bykdb|A0A2V9ILE2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=749 residues).
MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRMLVRHGWTILTVAFVVTMLVALISFRLQPVY
QATARVEIEAATPEIRTLSDLFEAMPADDMFLQTQVNVLQSDNLAWQTIEQLRLGENPAFAPPLKGASPQRGESAEAESP
LVGIFKGGLRVEIMRNSRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWMEQQLDELKAKVERSQQAL
VDYERDNKIINISDKENVEEKKLGDLSKELTDAQAEVVRAESLYNVARNNENQMASLVGNDLLSRLEEKYAELKSQYVEA
REQYGPNFPKVVRLRDQAEEIRSSLEAERKRIVERYHGEYVAAQQREAMISEALARQKVELEKLNQLLIQQNILKHEFQT
NQQLYEGLLQRLKDATLSSGLRATNIHIVDQARVPGAPVRPRKLFNVTIGLLVGLILGVALAFVQEALDDSIKSIGQVER
YLSTNALAVIPLARTVRSRSLDRGGNGSADRREAVELTLLKRPASELAEAYRSMRTAILLATSPRPPQVIVMTSAQPSEG
KTCTSLNLSLALAQRRVRVLVIDADFRKPGIAAAMGMSNERGLSNILRGEQSVDEVLLQAHTLPNLWVLPAGPVPSNPTD
LLSSPDMARLVEELKQRFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRIIENAGGKILGVVLNKV
DVRRGTYYGSYYGYGRGYYNYYYGARSGR
>gnl|bykdb|A0A2V9IVR7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=733 residues).
MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRMLVRHGWTILTVAFVVTMLVALISFRLQPVY
QATARVEIEAATPEIRTLSDLFEAMPADDMFLQTQVNVLQSDNLAWQTIEQLRLGENPAFAPPLKGASPQRGESAEAESP
LVGIFKGGLRVEIMRNSRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWMEQQLDELKAKVERSQQAL
VDYERDNKIINISDKENVEEKKLGDLSKELTDAQAEVVRAESLYNVARNNENQMASLVGNDLLSRLEERYAELKSQYVEA
REQYGPNFPKVVRLRDQAEEIRSSLEAERKRIVERYHGEYVAAQQREAMISEALARQKVELEKLNQLLIQQNILKHEFET
NQQLYEGLLQRLKDATLSSGAPVRPRKLFNVTIGLLVGLILGVALAFVQEALDDSIKSIGQVERYLSTNALAVIPLARTV
RSRSLDRGGNGSADRREAVELTLLKRPASELAEAYRSMRTAILLATSPRPPQVIVMTSAQPSEGKTCTSLNLSLALAQRR
VRVLVIDADFRKPGIAAAMGMSNERGLSNILRGEQSVDEVLLQAHTLPNLWVLPAGPVPSNPTDLLSSPDMARLVEELKQ
RFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRIIENAGGKILGVVLNKVDVRRGTYYGSYYGYGR
GYYNYYYGARSGR
>gnl|bykdb|A0A2V9IXG5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=681 residues).
MQDLNVSESLPQLDIRYILHVLWTGKWVILACMLVALALAAVNNNFQKVSYRAQAQIQIDAPPFLPSPGADFNAQSSYYL
NIDRYFKTEKQKLTSRRMHLLFAGRLKQQNPRFQNQSSDGIAGELGGGISLAPVEDTNLLWLEFVADDPRKAADWVNLYV
DLYVEENDRQQGEAVKQSRDVLKRQLYEIKSMLASQQTQMNQYAESSNLPVTPEMASVEFEMVSRYRADYEDAKAKREEE
EQKLAKLETYIADSSKLTNIPELVSSPSFRSYYIQWVEANNALEKLRLDGKGEEHPTLVAKRTELDNLRKQLRNELVKYA
DGMRVSVSVLRNREQASQKSYSEKMAERRVTSRHMAEMSSFIKSKENWASAFAAVEQKLRDLSLQEGFVTSNIKVVEHAG
AGYRVATRGANFVILATLGGMILGMALVVLGEVINPRVKTVEEIQTSLSVPALGFLPRTKDFGLHQIRESYNVLRTELLF
NKNLRQHKVIMVTSSLPEEGKTTVTMNLAKTLAAAGDRTMVVDFDLRKARLRSILSTGKQNGNSIFSPVEGLKLRVEQTQ
LPSLHLTVAESLPQNPPYLLSQPSLRDFISYLSDRYDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDKRIVRNSL
SALAKTHANIMGAVLNDLDVKKTRYYAYQSYYRYYSDSDAK
>gnl|bykdb|A0A2V9J2P4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=681 residues).
MQDLNVSESLPQLDIRYILHVLWTGKWVILACMLVAMALAAVNNNFQKVSYRAQAQIQIDAPPFLPSPGADFNAQSSYYL
NIDRYFKTEKQKLTSRRMHLLFAGRLKQQNPRFQNQSSDGIAGELGGGISLAPVEDTNLLWLEFVADDPRKAADWVNLYV
DLYVEENDRQQGEAVKQSRDVLKRQLYEIKSMLASQQTQMNQYAESSNLPVTPEMASVEFEMVSRYRADYEDAKAKREEE
EQKLAKLETYIADSSKLTNIPELVSSPSFRSYYIQWVEANNALEKLRLDGKGEEHPTLVAKRTELDNLRKQLRNELVKYA
DGMRVSVSVLRNREQASQKSYSEKMAERRVTSRHMAEMSSFIKSKENWASAFAAVEQKLRDLSLQEGFVTSNIKVVEHAG
AGYRVATRGANFVILATLGGMILGMALVVLGEVINPRVKTVEEIQTSLSVPALGFLPRTKDFGLHQIRESYNVLRTELLF
NKNLRQHKVIMVTSSLPEEGKTTVTMNLAKTLAAAGDRTMVVDFDLRKARLRSILSTGKQNGNSIFSPVEGLKLRVEQTQ
LPSLHLTVAESLPQNPPYLLSQPSLRDFISYLSDRYDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDKRIVRNSL
SALAKTHANIMGAVLNDLDVKKTRYYAYQSYYRYYSDSDAK
>gnl|bykdb|A0A2V9J4D6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=739 residues).
MTHRSRFTPSSASLRPGSSNAPPSFAPLPSCASAGGKSFRWRWLSWISVTIYTFKAERVYQATARLDIEAETPMNLSAES
LYRNESTPADETFLLTQTQVLRSDNLAWETIQQLKLADDPSFTKGPQKQRKESIDSADVRGRLVKLFDSYLGVNLHRNTH
IVEVSFESTDRDLAARVVNALINNYIEYNFHTKYDATRQASGWMEQQLDELKAKVEKSQEALVNYERANSIVNVNDKQSV
AEQRLSELSSDLTRAQSDRAEKESLHQLVKSNEAQIALLAQDHLLETLEQKVADVKTEYIDARTTYGPNFPKVVRLQQQI
DEVQLLIQQERHRVVERIQRDYEAAVEREKLLEATVAQQKFEVGKLNQLLIQHNILKRDSDTNQQLYDNLLQRLKDATVT
AGLRATNIHVVDKAVPPATPVRPKKALNVALGLLAGIILGTAFAFLEEQLEQKTVKTMEDVQRLVGLPSLGLIPLWAPNH
NGRQYGLRRKKNSELPASNGQTGLAALEHPASSVAESYRALRTSIMFSTSPKPPQVVLVTSGHPKEGKTATAVNLASLMA
QTGSRVLLVDCDLRIPGASKLMGISNSKGLSGILTGAYSVDEALQEVKGQPGLWALPSGPPPPNPAELLSSPEMQSVMQN
LRQRFDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPPAVLIRAQQILHSTGARILGVLVNKADLRRGGGYGYGYN
YYNGYYYSDYNSYSLRPPE
>gnl|bykdb|A0A2V9JEC4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=759 residues).
MPRNTDHEQTASARSETALSERPAIGEYVVPQLEDAEGGASAFRVYWHVLKRRWPTVITVASAVTLLATLISLKMQPVYK
ATARLEVKGEMPQLQTINEIDRHAPVDSTFLQTQVDLLQNDSLMWQTIHRLDLESRPEFNPRRTASSKSQLESLPPLQDR
LIRAFKKHLHVALMGNSRLITVSFESTDPELAANAANTLATNFVEANFQGAYDTTREATKWMEQQLDELKTKVERSQQAL
VDYEKANDIASIGDKENVVQLRLEDLSKDLTTAQTDRAQKESLWESVQEDNSLAEVASNDALLQHLEQNYADLKTQYAAS
LAQAGPNFYKAVQIRKQLAEVESLINRQRMRLVKQTKDAYDTAVRRETLLSRTVAEQRKDVERLNQLLIQHNILKGEFET
NQQLYNDLLRRLKDATLSVSLRAASVRVADRARVPAVPVRPDTRRNFPLFAFAGLVIGVTLAFAQEALNNSIRTPDDLEG
SFSIRALTIVPAVFSSRLPYSRLPRLRSKHPLPPSRIELAVLENSSLDVAEAFRILRTSILLSMTPRPPQLLLITSPLPC
EGKTSCSINLAASLAQRGGRVLLLDADLRRPGVARALSLDGKKGLSTVLTGGHQIEVALETFQNLSTLSILCAGPVPPNP
SELVSSATMEQVIGELRRRFDHIVIDSPPALVFTDATILSALVDAVVLVVESDVTTRAALRRARQTIEQAGAHIVGAILN
KATRRATDGYYGSRYSYYGSYYHKPPTSDVLDSGNGSSG
>gnl|bykdb|A0A2V9JPV9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MSRYFNKDEERRYFELMNQHPRNSLAVQPPSRGVPRSTPNLSNRYPQRVIDAPEQVSAAGLWRIIRNRKWVIALFALVVV
AIVATASFLMKPQYEAVGRVVFHRENDSGVLGFKGVDTSLLEDPEDRAAIDTQIGILETDTLAMQVINDLHLDTNPNFAD
RAAHSGNEDRLVKSFHKNLTISKVKGTRLLEIKFRNTDPRLAADVVNQLTKAYVDRYYRNQFEASTQMSEFLASQLKELQ
AKVEESQQKVVDYTKEIGIFGLGDKQNIVTAKLDDLNKELTSAEADRVQKEIDYRLARSGEPELIAKLGPDNLITKLRAQ
QADLENQMAQASVQLGPANPKISELSKQLAQARQSVDVEVRRIGERITYEYKSAVGRERMLRYALEAQKQAADELNANAI
QYDILKHEFETNRKLYEDLLQKQKEVGISASLKSSNIWIVDPARPPKRPAEPNILRNFALSLLFGIFGGVLLAFGLTKMN
ETISTLEQAIALSPLPSLGVVPLLEAKGKSRAPAQLNGVNGDLKPELVSVLQPLSLAAESYRAILTSILLSQPTPPAVIL
VTSALPREGKTTVSTNLAITLARLRRRVLLVDADLRRPSIHRAMGLSTNTGLGALLRKSTVFEKAVSDCAKIPNLFILPA
GPITLPDDTELLVSGFKDLVERWREQFDHIIIDTPPVLPMTDAVHMSVEADSVILVMRSGQIARDEFLCAQDLLLKVNAR
LLGFVLNGAGLSSSDFQYYYGYYGQDQSKRLGKGA
>gnl|bykdb|A0A2V9JSI3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=745 residues).
MTNDNALAPIEHVPFERVGYRKPSVVTVEAEEFDSPLDLRHYWNNLVKRRWTVVTVAFVVSTVVAMVNFRMPPVYEARVS
VEVEGEAPEVQSISNFYRGTPSDEAFLRTQVKVLESDSLAWQTIQQLGIDQSAEFSPPRGGKPVSPAIVQISLINAFRDH
LRVEWVRNSRMLEVSFEARDPRLAAAVANALVSNYAEYNFRKRYDATRQASGWMEQQLDELKAKVEKSQQAMVDYERQNA
IVNINDKQSVEEQRLAQLSNDYTNAQNVRLDKESLFELASSNEAEAAVLMQSEVLGRLEEKYAELKAQLVDASGQYGPNY
PKVVRLQDQVNEIQGFIERERKRIAGRVRNDYRAAMGREKLLAAALAREKEAVGRLNQVLIQHNLLKREFETTQQLYENL
LQHLKDATVSAGLRATNIHVVDPALPPAAPIRPKKTQNIAMGLLGGLALGVMLALFADVLDNSVKSVEDIERLTGMPTLA
VIPLAASDRARRAWRKGAGEKAASSTTPVGLAVLKHPASPLAESYRALRTSVLLSTPGHPPQVILITSSQPNEGKSCTCL
NLALTLAQRGGRVVIIDGDLRKPGVASVLGLANGKGLSSILTGAHGLEEALQQLDALPGLWVLPGGPRPPNPADLLSSVS
MKEVLAELRGRFDHVVIDSPPVLLVTDATILTPLVDGIMLVVESGMTVRGAIQRTHKILENAGGKVLGVVLNKLDARRNG
YYGSYYPSAYGKYYLTDEEQSAVKS
>gnl|bykdb|A0A2V9KA79 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=747 residues).
MQNGTANTSASLTNLVAIFKRRLWLVLATTFVGTLCGGGASVLLPVRYRAQVLLAAESAPTRDYLRLGGYGDAIHIQDQL
RIIKEHLYKPALLERIIREFGLYPVTRGAATSRQIDEMRARIQITVEGNDAFYVSFEGTGAAQVRDVANRLAEEFIHEVS
AADESRVEEAAGLVGARVEQLRKQMQEQQDRITRYKQATLSELPENLGNNYKLLETIQARLQTVGERISNDAARRVAAAN
EMRELQRQGATENRAVVEEASAVQKKLEDLRLELKGLQARGYTENHPEVIRLRRQIQEFEASASAQAPVEGPVSARRPAG
EPSPFFLRYLQLKSEVEAIDQRLNSSKQEQRDLTAQLETYRSRVQSTPTHAGALADMTRDLESTRTQYQSLLDKQQQATL
ASKRGKVETNVLWRIADPARLPSAPVTPGRVRILLLGLAAGLCLGLGLAVLAENLDTTFENAEQFQSFFDFPVLCIIPSM
NLHNLRRKVRSEEISPRAPARRHTGEQRVSIASVPDRPGKHSLTSQPPPSIATDQYNILAMKIRSQLGDENGRVLTITSA
AGGEGKTLTSVNLSLALASTFEGQVLLVDADLRKPRIHHYLDIRPGTCFDDLLVQPRLAIEDCLTTVRTLHVMLGRRSLA
NNPVQALAAKRMHEILAHARQRYRLIVLDAPPILPMADSHILAGLSDGVLLVVRARQTRRELFQHAVESFHATNILGVVL
NDVDVDHTRYAYAYRYYQKNYATKTPA
>gnl|bykdb|A0A2V9KBD6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=730 residues).
MDLSRPEPRLPPKVPSPRVQRVVGAPDEALASTLWRIIRPHKWITAGFTLAVVAIVTVASLVMKPQYDAVGRMVVVFHRD
NDSGVLGFKGVDTSLLEDPEDRAAIDTQISILQTDALALKVIQDLRLDQNPMFIGGAKAVNEDRLVKLFHKSLDISKVKG
TRLIQIRFRSPDPQLAADVVNGLAKDYVDHYYQSQFQVSEQISAFLTNQLKELQARVEDSQQKLMEYQKQNGILGLDNQQ
NIVTTKLADLNKELTASEADRVQKEVSYRLARSGQPELLAKLEPGSLLTTLRAQQDDLERQNAQASVQLGPTNPKMAELS
SQLSQVRSSIDAEVKRIGDRLTYEYHSAAERERMLRAALEKQKQVADDLDAHAVQSEILKHEFETNRKLYEDLLQKQKEL
GITASLKSSNIWIVDPARAPKLPSEPNLVRNVALSLAFGLFGGMCLAFGLEKINEKTIRTVEQVQLLSPLPVLGALPLLE
ANSKNGAPANLPALSIYRNRALVSLLEPMSLAAESYRSVLTSLLLSQPTPPVVIQVTSALAAEGKTTVSANLAILLARLR
RRVLLIDADLRRPRIHLAMQLNATAGLGALLKKSVAFEEAVCSFPNLPDLFILPAGPVTQPEDTELLLSTFKELVESWRQ
RFDHIIIDSPPLLPVADALRLSVVADSVILVIRAGEVGKDTFQRAQDALFKVNAPLTGFVLNGAQLDSADFRYYHSYYSP
DQSKRLGNAA
>gnl|bykdb|A0A2V9KCS3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=852 residues).
MWRCIPTTFSSFRAAPARRPGGARWKRCWAWARASAQAPRSIAVNRDLFRVNHSRADSTSGALMDQIVHLPKGPQRELIR
RTNGGVPASGSLPYGDSPVDQEYGADAVSGGLLYYWHMILRRKWTVLIIGFVGTLSGFLVSLPQTPVYRSRTSVEIQALN
DNLMNTRQIDPTPGTNDMYVQTDILTQIKILQSDSLMERVVTKLKLDKKPAALEQPTKLSAWRKALGLPQPAAPSREQAA
GMAAASVSVRSVNETRIVEILCDSTDPKFAADFANTLVSEYMEQSLESRWKNAQRTGDWLTRQLEDQRINLEKSEDRLQG
YARSSGLMFTAEKDNVAEARLRQLQEELSKAQGDRVAKQSRYEVALSSSLEALPEVLDDASLQDYRQKLTELRRQLAELG
ATYTSTHPKVERVDAQIASVQSALERERVNILKRIRNEQEAAVRRESLLAAEYGSQAKLVSEQSGKTIHYNILRREVDTN
RQLYDSMLQRVKEYGIASAMHASNMRVVDPAKAPRLPYKPNLLQHAGVGFIAGLLLGTVFVVIQEQADRSLQSPGDGPTY
LNLPELGVIPSAKADRGLNSYFKRLPALKGPKDSEQTLGSALVKKNGRRNGNGNHEIELVTWYRKPSLLAESFRTTLASI
LFFEADGNRPRILVMTSSAPGEGKTTVTSNLAIALAEISRRVLVIDADMRRPRIHDIFDVANTWGLSDLLREKDAVDDYP
FEALSRKTLIPGLYVLPSGPGTVSISNLLYSPRLAELLNRFRKEFDTVLFDTPPMLQISDARVVGRLADGVILVLKAGQT
TRDMALAATQRFAEDGTPVLGTILNQWNPNSTAGYGYYSDYHQYYSGERKSG
>gnl|bykdb|A0A2V9KIE8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=781 residues).
MGKSEILPGDRLNRIAPVSMEQVRGQEFLEVGHEEAPHLMDYWHLILKRRWTVLTALLAVFLTVAIGTFKQKPGYSGTAL
LEINPEPPNVLNFKEVLQISNQDVDSYRETQFRVLESRTLAERVVRDLALYRSPEFYRKSILFGLMETTPANVPSPTDNA
PPDVNSEAFTNAVKHFLDAVEISPVRRSNLVEVSFGSHDPRVAAQVANRLAQDYIDSNLQVKWDETIKASDWLQGQLVGL
KAKLEKSDDQLQAYAQEHSILFITEKQNLVNDRLQQLEQEYTKAQAARFHAEASYTLVKSTKNMDLPSVLSDKFIQELEG
RLAELERQYAEMTSMVKPEYPKAVQLKKQIDVLEARITAQKQALVENIVEEYHAAESNEKLLAQAVVQQKAEVNDIAQKT
IQYNILKREADTNKQLYESLLQRLKEAQVSEGLKASNIRIVDQAETPKLPVKPRVILNLALGFAFGLALGIGLAFFQEYL
DNTVKSPDEVEELVRLPSLAVLPSFALNDGKGDASKQLAKAAPGDRVVAPAIQTTAVGKESFRTLRTSILLSAHPVPRTI
LITSALPGEGKTTTTVNLGVALAGLGSKVLIIDCDMRRPACHRATGVENKPGFVQCLTGRVQISEAILPVPGVANLWVIP
CGPIPPNPAEVLSSPVAGALLNSLRSEYEYVIMDSPPLLSVSDSRILATMTDAVVLIARANSTPYQVIQRAKNLLYGAGA
RILGVALNGVDFRHGGYGYGYYRRYGYGYGYGYGYGYGYGYGYGKDAEEGDNEAQSPDQNS
>gnl|bykdb|A0A2V9L5B5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=778 residues).
MNESIDVHQRRGLVQGDQDSSGESQHAIEPAFSRSLQESEVLDVSPEEVPHLLDYWQVVLKRRWTVLVCLLVVFTTVAIG
TLKKRPVYEGKVLLEINPEEPQVLNFREVSQEAPTVDVDSYRETQYKILRSRTLAEKVVNDLHLYQSPEFYRNRGLFGLY
ESDPEKIPSSDPGPPDTLTDAYRNSVTHFLASVDVNPVRRSNLVEVTFDSYSRTVAALAANKLADDYVEQNLEVKWDAAE
KASQWLQGKNAEIKAKLEKAEDELQAYAQANSIVYITEKQNMATARLEELLEAYTKAQSERFEKQSLYSLVEAGKIQDLP
GVLSNRLVQDLEIRLADTKKEYAQVTTWVKPDYPKAQQVEKQIDALQAELDKQKKAVVDNIVDEYRSATAKEQYFAQAVD
DQKREVNEIAARSIQYNILKREVDSNRQLYEGLLQRMKEAQASAGLRASNIRVVDAAEAPKYPAKPRVLLNLVLGLILGL
GLGVGMAFFQEYLDKTLKTPDEVERLLRLPSLGVLPRFTPNGAGEVRQDSLEAVEPGVATALAPAIQTHAEVLEAFRSLR
TSILLSASPVPRVILITSALPGEGKTTTAVNLGAALASLGSKVVVIDCDMRRPSCHRSVGVKNSPGFVQCLTGHVELAEA
VLPAPGVPNLSVIPCGPIPPNPAEVLSSSLAAESLRKLRADFDYVLVDSPPLLSVADGRILATMVDGAVLVARAFETPYD
LVRRARALLYNAGARILGVALNDVDLRREGYGHNGSYGYSYTGYGAPGSEGSSRHGNT
>gnl|bykdb|A0A2V9L7I0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=765 residues).
MDESENLQRDPVRALARTATQPLEKPEILDVSPEEVPDLIDYWQLILKRRWTVLVCLLAVFTTVAIGTLKQRPVYVGKVL
LEINPEEPQVLSFKEVTQAAPTVDVDSYRETQYKVLQSRTLAEKVVNDLRLYLSPEFYRNQMFFGLFESDPEKIPSISQP
GLPDTSSDAYVNAIAHFRKSVDVSPVRRSNLVELTFDSYSPEVAAQAANKLARDYIEQNLEVKWDAAAEASKWLEGKIVE
IKAKLEKAEDALQAYAEANSIVYITEKQNMGNARLEELLQEYTKAQAQRFEKQSLYSLVEAGKVQDLPAVLSNRLIQDLE
ERLADVQKEYALVTTWVKPEYPKALQVKKQIDALQAEIDRQKKAVTENIVDEYRSAAAKEKYFAQAVEDQKREVNRIADK
SIQFNILKREVDTNKQLYEGLLQRMKEAQVSSGLNASNVRIVDAAEIPKGPAKPRVLLNLILGLVVGLALGVGVAFLQEH
LDKTLKTPDEVERLLHLPSLGVLPRFTLNGNGKVPEEEDSLAAVPEVEMAVAPAIQSHADAVEAFRSLRTSILLSASPVP
RLILITSALPGEGKTTTTVNLGAALASLGSRVVIVDCDMRRPACHRSTGVRNAPGLVQCLTGKGDLAQAVLPVPGVANLN
VIPCGPIPPNPAEVLSSPLAAELLRKLRTEFDYVLVDSPPLLSVADSRILATMTDAAVLVTRAFETPYDLVQRARSLLYG
AGARVLGVALNDVDLTRDGFGYQHYHYGYIAGVSPSSGRESEARD
>gnl|bykdb|A0A2V9L9C5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MREEFGKSGTLVGRAINDSPEPIHPIISITSAGEFERPSVLRAIAVLRKRWWEVLSVAMVVLISVTIYTFKAERVYQATA
RLDIEAETPMNLSAESLYRNESTPADETFLLTQTQVLRSDNLAWETIQQLKLADDPSFTKGPQKQRKESIDSADVRGRLV
KLFDSYLGVNLHRNTHIVEVSFESTDRDLAARVVNALINNYIEYNFHTKYDATRQASGWMEQQLDELKAKVEKSQEALVN
YERANSIVNVNDKQSVAEQRLSELSSDLTRAQSDRAEKESLHQLVKSNEAQIALLAQDHLLETLEQKVADVKTEYIDART
TYGPNFPKVVRLQQQIDEVQLLIQQERHRVVERIQRDYEAAVEREKLLEATVAQQKFEVGKLNQLLIQHNILKRDSDTNQ
QLYDNLLQRLKDATVTAGLRATNIHVVDKAVPPATPVRPKKALNVALGLLAGIILGTAFAFLEEQLEQKTVKTMEDVQRL
VGLPSLGLIPLWAPNHNGRQYGLRRKKNSELPASNGQTGLAALEHPASSVAESYRALRTSIMFSTSPKPPQVVLVTSGHP
KEGKTATAVNLASLMAQTGSRVLLVDCDLRIPGASKLMGISNSKGLSGILTGAYSVDEALQEVKGQPGLWALPSGPPPPN
PAELLSSPEMQSVMQNLRQRFDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPPAVLIRAQQILHSTGARILGVLV
NKADLRRGGGYGYGYNYYNGYYYSDYNSYSLRPPE
>gnl|bykdb|A0A2V9LGY4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=749 residues).
MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRMLVRHGWTILTVAFVVTMLVALISFRLQPVY
QATARVEIEAATPEIRTLSDLFEAMPADDMFLQTQVNVLQSDNLAWQTIEQLRLGENPAFAPPLKGASPQRGESAEAESP
LVGIFKGGLRVEIMRNSRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWMEQQLDELKAKVERSQQAL
VDYERDNKIINISDKENVEEKKLGDLSKELTDAQAEVVRAESLYNVARNNENQMASLVGNDLLSRLEERYAELKSQYVEA
REQYGPNFPKVVRLRDQAEEIRSSLEAERKRIVERYHGEYVAAQQREAMISEALARQKVELEKLNQLLIQQNILKHEFQT
NQQLYEGLLQRLKDATLSSGLRATNIHIVDQARVPGAPVRPRKLFNVTIGLLVGLILGVALAFVQEALDDSIKSIGQVER
YLSTNALAVIPLARTVRSRSLDRGGNGSADRREAVELTLLKRPASELAEAYRSMRTAILLATSPRPPQVIVMTSAQPSEG
KTCTSLNLSLALAQRRVRVLVIDADFRKPGIAAAMGMSNERGLSNILRGEQSVDEVLLQAHTLPNLWVLPAGPVPSNPTD
LLSSPDMARLVEELKQRFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRIIENAGGKILGVVLNKV
DVRRGTYYGSYYGYGRGYYNYYYGARSGR
>gnl|bykdb|A0A2V9LK56 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=776 residues).
MDEIQNSNGFQGASLAPRTTALPDSRVLDIGPEKVPSLFDYWQIILKHRWLLISTLLIVFSIVAVGTLKQKPSFQGSILV
EIDPDPPSVVNFKEILQVASADVESYRETQYRVLESRSLAESVVKDLELYRLPEFYRSRRLFGLFESDPARIPSPTEDLD
PSSEAFNNSIANFMNSMSVGPVRRSNLVEISFYSNDPKLAARIANRLADDYIEQNLQVKWDAALKASEWLSGRLDELKGK
LEKSDNALQEYAKKNSILFVDDRKNLANERLGQLQQEYTKAQADRFQTESLYNLVKPDAAKDVPGTLSNKLIQDLEFKIA
DLEREYAQLTAVVKPDYPSAVRLKKQIDLLQSILGKDKRTLVQNLVDAYSSAVNREKYLEQALKGQEKQVNDIAEKTIQY
NILKREADSNKDLYNGLLQRMKEAQVSAGLRASNIRIVDAAEVPRRPVRPRVILNLALGIIFGLGLGVAGVILLEYLDNT
LKSPSQVESLLRLPSLGVILEFDLFSARKSGEARLTKGSEAGGKSDIVIRRDPAAVEAFRSLRTSILLSANPSPKIVLVT
SALPSEGKTTITVNMGATLASLGSKVLVLDCDMRRPTCHRATGVPNRPGFVQCLAGRVELKQAIFPVPGTENLFVIPCGP
IPPNPAELLSSQLSMDLLNALRSQFDYVLLDSPPLLSVSDGRILATLTDAVVLTIRAGHTPIEAVRQACASLKSVGARIL
GVTLNGLDLRRDGYGYGYGSRYGYHYGYGYGYGYGYGADSEDSTEAGTQNSSDGVR
>gnl|bykdb|A0A2V9LPQ3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MADIQKLTTTEPAPLARRRAASSESIGFGLLPTDFDGFSSVLRVYWEIVYRRRWQIVAITVAAVTIMAIYSFKVNPIYRA
TAHVEIEAEAPLTMSVSDRFRSMPADEAFLKTQALVIGSDHLAWETIGQLGLAENGAFIPQTPKDASGQRAPEPRMLRDR
LVREFQRSTTVRLMPNSHMMEVSFESTDPDLSAKVANTLINHYIEYNFRKRYDATRQASGFMEQQLEELKAKVEKSQEAL
VGYERQNSIVNVSDRQNVVEQRLSDLSRDLTTAESDRAQKESLYQMVKSNPEQIAMLAQNDLLQKLQEKSADLKAQYVDA
LGQFGPNFPKVVRLRGQVAQMQSLIEQEQKRTVERIQNDYRAASTRVSLVSTSVVQQKAEVGRLNQLLIQHNILQREFQT
NQQLYDDLLQRLKDATVSAGLRATNIHIVDTASPPAVPVRPNKLLNLMLGLVAGGLLGLVLAFAEEGLERRSIRTPDDVE
RLLGIPALAIIPSASLLIRRYGSSKRGGAQGEAQKRSESVAVMMLTEPASAVAESYRALRSAILFSSTPEPPKVLLVASS
QPKEGKTCTSINLALSLAQNSVPVLIIDADLRKPGVTRELNLPSTKGLSGVLTGRYSLDEALREVENTSLSVLPAGPTPP
NPAEMLSSPAMRQLITELVERFKHVVIDSPPLLMVTDATILSTMVDGTVLVAESGVTSPGALARCHRILDVAGGKVLGVV
INKVDFQQEGYYYGSLYRYYGSYYGKPDNGESASP
>gnl|bykdb|A0A2V9M454 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=757 residues).
MNGDELVPLNSGPVTPPPNRNGSGPHSYIDLEQVDAFGQLRATWDILLKHQWLILVTAFVLTLLVTVYSYKMKPVYRATA
RVDVEAEEPLLQSLNDLFRTEQADDSFLASQISILQSDNLAWETIQQLGLARLPNSGQTSPADGRVLGTPPAMKNAAVAA
FKARLKVERPKDTRMALVSFESTDPREAAAVVNGLVTNYIEHNFKSKYDATRQATGWMEQRLDELKLKVEKSEEAMVTYE
RQNNIANIGDKQTAEEARFEDMSKELSQAQSDRISKESLYKMVVSNEAQVGFIQTNSLLPGLEAKELDLKEQYSEALAHY
GPTYPKVLSLQDQIKDLQALVVRERKRVVDNLHNDYLAAVEREKFLATAVAQQKVQVDRVNQLLIQHNLLKREFESNQQL
YDNLLQHLKDGNVSAGLRATNIRIIDEATIPSFPVRPNRPRNIEFALAAGLILGIALAFTREALDNSIKNAQEIEKLTSL
PTLSIVPLSHSSVLRRPGLFHSKAANGANGDGGYAVELAVLKKPGAAISEAFRTLRTSVLLSTAERPPKVLLITSAQPSE
GKTATTLNLAVTLAQKGSRVLLIDSDLRRPGLAKALKLRNQNGLAEILTGACEFDETLLEKVEGLDRLSLLPAGPYPPNP
AELLCSTKMENLIKHLRDQYDHLVLDSPPVLPITDATILSSLVDGVIMVVECEATTRAALSRACRVIEHSGGKILGTVLN
KVDVRRDGYYGYRYYHGYYSYKYKAYYREEDRSSGRS
>gnl|bykdb|A0A2V9MAM9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=758 residues).
MLPVSKLSKAPQRPSHSLSRAEFQRLARPSPEALAAGTSAEIETGSLSIIEYLRVLRRHSLLLAVITAATVGAAFLVSIA
QPRLYQSVASVEVQGLNENFLNLRDVNPTATAPTHSEDSYIETQAEILRQDSLIGRAFNRLPAERRGGLVLPGWSERLLP
VFAPRSPGGNDDREAILRVKDRLRIEPSKQGRIIRILCDATDPQLAADFANALAQVFIEQSVEARWNGASQIREWLNPQL
EELKGKLVKSEGELQAYLRSSGLIFGAGQETLAENRLHLIESELSKAQADRIAKTPAYQLADKEHPELLVDNAVIRDYQV
KLTELRKQLADLDSVLTPENYKVVRLKAQITALESALAKEREETRQRLRNDYLTARRREALLSSAYQQQTHLASDLRKKM
IHYDTLNREVATTRQFYEAMLQKVNDAGVATAIRPSNIRVVGPAQPALQPYKPNFLLNVAIGLFGGLVLAIGCVTVVNQA
EAGRSREPGDVEARLNLVELGAIPSARSVVGASPGRSLRSDSHNATELTGWENKFNALSESFRCLVTSILRLGGDEGQSP
PRVLVITSTLPAEGKTTVATNLGITLASIQRRVLLIDGDMRQPRIHHIFDLPNTWGFSNLLRGADELPMDTIVKRTTVPN
LYVLSSGPGTEDIFSLLFSPRLRRLIERFREEFDHVIIDAPPSLEFADARLLGLTADGVLMVVRANHTDNKTVQLAIQRL
LTDGVPVLGTVLNDWNPNIATYGYYRYGKSYSWKNAET
>gnl|bykdb|A0A2V9MN96 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=734 residues).
PYRIGGQHPLLSYWRILKKRKWTIVATFAIILVLAIIATLRMPRLYEAASRIAIYPENSNVLGLKDLENGGMSEDWDYNV
SLETQLSILRSDALALKVVEALHLDSNPRFTGFVPVANDASRSIGSANLGPDSQQIASMLSIFRSGLTVQVMPRTRVIEI
TYIHPDPQLAAEVTNALVKTFVEENFRTKYESTSQTADWLSKELSDLQLKVQASEEKLVRYEKQKGIVGIDEKQNIVTAK
LDELNKELTGAQTDRMQKEANYGLAEAGDPSGFAKLSADNLLEKLRVQQAELETQYAQATTQFGPSYPEVIQLRSQLNQV
RNSIATEQKNLLSKVRDEYMAAIQRETLLTSAFDHQKQEANQLNESGIEYTALRRDADSNRQLYQSLLQRLKEASVTAGL
RSSNIRVIDVARLPTGPAKPDVRRNIFLGFLLGLAGGVALAFLQESMDTTVGSLEELSAITALPMLGVIPLQLAENGRRH
LHPAGGSLITASTVDGPVAHVRPKSEAAESYRALRTSILLSSFGAPPKVVLVTSALPQEGKTTVSANSAVVLAQKGGRVL
LVDADLRRPGVARALGLKTSGGLSTLLSGVDTMENVMVPFPGLPFLQVLPAGPIPPNPVELLGSSVMKDCIARWRNEFDH
IIFDTPPCLSVTDSVVLSVEADRAILVARSGQTPKGAVRRASELLLQVNARVMGVVLNAFNFRSTDDNYYYYGSKYSGSY
YQQPEENDRGAYAS
>gnl|bykdb|A0A2V9NGH6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=781 residues).
MDSAPLIAANTRVLRELPSAHPVEFRRQFGFGIYNPATFQDSVVHEYLRVLIKRKWVVISSVVMIFVVVAIATLKATPVY
DATGSIAINKLDPALISFKDSANAGPDYYDPSDLDTEVGILKSDLLAFQVIKQLNLDKRPEFGGSGQAQSTSLELTTDIL
QPDSVKASAVLASFKSDLKVLLKPNTRIIEIRYRSTDKDSAARVVNTLINTYIEQNFKTKFESTMQASDWLSKQLIDLQI
KVETSQEKLVRYQKQHQILGIDEKQNIITAKLDELNRELTTAESGRMEKESIYGLVQATDSDAAAAAAISADHSTRNASL
SSSLLEKLREQQADFRIQVSQLSTQFGPAYPKVAQLNSQLQEVESQIQLEMKKVIARVRSDYLASVHREEMLRAAMEKQK
QEANQLNESAIEYTLLKRDVDTNRTLYEGLLEKLKEAGVTAGLRSNNIRPVDLARVPIEPAEPDVPRNLSFALVLGLTTG
VSLAFLLEGIDNTVRTPEQAQAISGLPSLGIIPDGSKLSIESSARRRLSLTSSREAIELVTQSRPQSQMAEAYRALRTAL
LLSSVGAAPKVVVVTSALPSEGKTTTSINTAIVLAQKGNRVLLVDADLRRPSIHKTLGMGPRTGLSSVLTGSANVQQTIV
RSALLPSLFILPAGPPPPNPAELLSSGNMKKVLDELREQYDHIVVDTPPTLSVTDPVILSTRADAVVLVIRSGQTTRQAL
RRARDILLQVNAHATGVLLNAVDLNSGDYYYYEYQGKHGQRYFGQDEPAIAEEAKATSSGA
>gnl|bykdb|A0A2V9NL07 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=789 residues).
MYLLFQFSIQLGRQMEPSPVMQIGNQVREMGPASMQIGRNIAAIHPAMAAQDSILREYLRVLIKRKWIVVGTLAAIFGAS
LVATLRITPIYDAVGSIAINKPDPMLQNLRDPGNSGMDYYDPTDLDTEVRILHSDLLALQVIKQLNLDQMPEFGGHGAPP
ASSLALTTDAFEADSARANALLGAFKGGLHVVLEPNTRIIDIHYRSPNKELAARVVNTLANTYIEQNFKTRFESTMQASD
WLSRQLVDLQMKVETSQEKLVKYQKDHQILGIDEKQNITTAKLDELNKELTAAESARMEKESVFRLSDSVDTESAAAVAN
SGSAKGSGSTSGLLDKLQAAKADLKIQIAQVSTQFGPAYPKLAELNNQLQEIDSQIQGETKKVGGRLRGDYLAALQRENM
LRSALEEQKQQENKLNESAIEFSLLKRDFETNRTLYEGLLQKLKEAGVTAGLRSNNIRQVDIARTPAGPAEPNIPRNLGF
ALALGLTSGIGLAFLLEGIDNTVRTPEQAQLISGLPSLGMIPLGSRTAAEANPTGLSVAASKEAVELITISRPQSQMSES
YRALRTSLLLTSLGAPPKTILITSALPQEGKTTTSINTATVLAQKGTRVLLIDADLRRPSIHKTLGMGPRAGLSNVLTGG
TTLQQATVRSTLLPNLFILPAGTPPPNPAELLASSQMLDLLAELREQYDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRS
GQTTKPALRRSRDILAQVNARVAGVLLNAVDLDSPDYYYYYEYQGKYGQRYYDEDMTGGDSVRAASGSA
>gnl|bykdb|A0A2V9NWS3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=795 residues).
MVGLNFFLGASMASGPLIPANGQMLREISSLSSFDLNRQLAAYYPNAPIQDSVVREYMRVLIKRKWVIISCLAIIFGAVS
VVTMRSTRIYDATGSIAINKSDPALLNFKDSPSAAVDYSDPTELDTEVRILKSDLLALQVIRQLDLDKRAEFGGNGQVPS
PNSVQLTTDSLQVDSQRTTDLLSAFKGKLRVALEPNTRIVDIHFRSPDRELAAHVVNTLISTYIEQNFKTRFESTMQTSD
WLSKQLVDLQMKVETSQEKLVKYQKEHEILGIDEKQNITTSKLDELNKELTSAESDRMAKESFYTLVQAADADTAAAAAL
SSATGSGLSSASSNLLEKLREQQADLKIQVAQLATQFGPAYPKLTQLNGQLKEVDAQLQAEMKKVVARVRSDYLAALQRE
TMLRGALTKQKQEANKLNESAIEFTLLKRDVETNRALYEGLLEKLKEAGVSAGLRSNNIRNVDAARVPSEPVEPNVPRNL
AFALALGLSTGIGLAFLLEGVDNTVRTPEQAQAISALPSLGIIPMGSKAPTESNGRQRLSLASSKEPVELVTQSRPQSQM
AESYRALRTSLLLTSIGAPPKVILVTSALPQEGKTTTSINTAIVLAQKGTRVLLIDADLRRPSIHKALNIATKIGLSNVL
TGNATMSQATVRSTILPTLFVLPAGPPPPNPAELLASAQMKDSLAELREQYDHIVIDTPPILSVTDAVVMSIRADTVLLV
IRSGQTTKQALRRSRDILMQVNARVAGILMNAVDLRSPDYQYCYEYQGKYGHRYYQEDELPESEEAAKRASAGGL
>gnl|bykdb|A0A2V9PYE6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=691 residues).
MDPALISFKDSPSVGPDYYDPSDLDTEVGILKSDLLTFQVIKQLNLDKRPDFGGSGPAQSTSLGLTTDILQPDSVRTSEI
LAHFKSDLKVSLKTNTRIIEIRYRSTDKGLAARVVNALINTYIEQNFKTKFESTMQASDWLSKQLIDLQMKVETSQEKLV
RYQKQHQILGIDEKQNIITAKLDELNKELTAAESGRMEKESIYGLVQATDSDAAAAAATSADHSTRIASLSSSLLEKLRE
QQADLRIQVSQLSTQFGPAYPKVAQLNSQLQEVESQIQLEMKKVIARVRSDYLASVHREEMLHAAMEKQKQEANQLNESA
IDYTLLKRDVDTNRTLYEGLLEKLKEAGVTAGLRSNNIRPVDLARVPIEPAEPDVPRNLSFALVLGLTTGVSLAFLLEGI
DNTVRTPEQAQAISGLPSLGIIPDGSKLSIESSARRRLSLTSSREAIELVTQSRPQSQMAEAYRALRTALLLSSVGAPPK
VVVVTSALPSEGKTTTSINTAIVLAQKGNRVLLVDADLRRPSIHKTLGMGPRTGLSSVLTGSANVQQTIVRSALLPSLFI
LPAGPPPPNPAELLSSGNMKKVLDELREQYDHIVVDTPPTLSVTDPVILSTRADAVVLVIRSGQTTRQALRRARDILLQV
NAHATGVLLNAVDLNSGDYYYYEYQGKHGQRYFGQDEPAIAEEAKATSSGA
>gnl|bykdb|A0A2V9QB26 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MTEPMDKHALPPASHDLVLRKSEGSPGHGEAGSYLYGHRDELEPGGFVEDWRILCRHTGILAGITLMGALAGVLLSIWQS
PVYRARTALEIQNINEDFLNIKQVTPVSEGNSSTALTEIATQVRLLQSESLIKRVLTKLKDRFPEDPKVRTSRFSLWRKA
SLPETKPSDESGAAQAAARSLNARVSGLTRVVEASYDSTDPRFAAAFLNTLVQEFMDSNMEARLKSSEYTSQWLSRQLED
MRIKLEHSEDALQSYARSTGLIFTSEKTKISEEKLQQLQGELSKTQTDRITAQSRWEITAASPPDALPDFLNDSALRSLQ
EKLTELRRQHAELITIYTEKHNKVKQVEAQIALLEAALQKEQAAIVDRIRNDYKTALRREKLLSAAYRNQSRLVTDQDEK
SIQYGILKREVDSNRETYQAMLQRVKEANIASAVRPSNVRIIDAAEPPEHPYKPNLPMNAAVGLLSGLCIGVAFVVTRGR
ADRTFRAPGEAQLWLNVPELQVIPTAVEESRRCLYTERCNKTTTLSLSRQQRDSGLPKRTSKQVDSPSVELVTWYRKASL
IAESFRSLLTSILFSGSNGACPRVLVLTSAGPKEGKTMVASNLGIALAETKRKVLIIDGDLRKPRMHELFGLPNGRGLSS
LLRDPQRALAKLSRIVQETNIPGLFVLTSGPLTESAADLLHSANLSGLLAKIKIEFDLVIIDTPPMLQMADARVLGRVAD
AIILVTRAGQTTRDAAEAATQRFTEDNTRVLGTVLNGWDPKETSHYDYRYQFYRYHH
>gnl|bykdb|A0A2V9QD92 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=775 residues).
MEPSPVMQIGNQVREMGPASMQIGRNIAAIHPAMAAQDSILREYLRVLIKRKWIVVGTLAAIFGASLVATLRITPIYDAV
GSIAINKPDPMLQNLRDPGNSGMDYYDPTDLDTEVRILHSDLLALQVIKQLNLDQMPEFGGHGAPPASSLALTTDAFEAD
SARANALLGAFKGGLHVVLEPNTRIIDLHYRSPNKELAARVVNTLANTYIEQNFKTRFESTMQASDWLSRQLVDLQMKVE
TSQEKLVKYQKDHQILGIDEKQNITTAKLDELNKELTAAESARMEKESVFRLSDSVDTESAAAVANSGSAKGSGSTSGLL
DKLQAAKADLKIQIAQVSTQFGPAYPKLAELNNQLQEIDSQIQGETKKVGGRLRGDYLAALQRENMLRSALEEQKQQENK
LNESAIEFSLLKRDFETNRTLYEGLLQKLKEAGVTAGLRSNNIRQVDIARTPAGPAEPNIPRNLGFALAFGLTSGIGLAF
LLEGIDNTVRTPEQAQLISGLPSLGMIPLGSRTAAEANPTGLSVAASKEAVELITISRPQSQMSESYRALRTSLLLTSLG
APPKTILITSALPQEGKTTTSINTATVLAQKGTRVLLIDADLRRPSIHKTLGMGPRAGLSNVLTGGTTLQQATVRSTLLP
NLFILPAGTPPPNPAELLASSQMLDLLAELREQYDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRSGQTTKPALRRSRDI
LAQVNARVAGVLLNAVDLDSPDYYYYYEYQGKYGQRYYDEDMTGGDSVRAASGSA
>gnl|bykdb|A0A2V9R9V4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=800 residues).
MSDQKRYPDNLPPEVTFRQLPARQAHDSGAVIYPEIDLPRYGEAEDFHLRMLWRIVRKRRWLIIGIASIITTLVTIDVFR
TKPLYEATTTIEIGRDNGARINSNGLFIQEEDYLNVTMNTSEVILKSLPLLEDVVVQLRLDQNPAFLASQKKSVWESLHE
IAGKIQRDDASAPPAVFTATAMKSKIEGNRSPEEVERLAPYVGMLEESLRVRPILDTRAMTLTFKHTDPVIAAGVANAIA
QRFVETSFDKKIEKFTSASEWLDRSTRELKSKIERSEQALADYTKTNNIYSTDGKATLVAEKLSRLHDLATRAETDRILK
ESLYEQVRQGRVAQIPEAFADTKTVELQRKLGELATTAAELSVTYGPKYPKMAEINQQMAAIRDQIAAGRVQLEEKLKAD
YERVVRDENALKAALEEAKAGAAQENQRAIQYSLLKQDVDTAKSLYTEFLQKTNQAYLEVAQQQSNIRIISPARVPKEPV
SPNRQRTILIGLLLSLSGGIGLAWLLERFDDSIRSVDDVNRYTQLPALAVIPVIGANKSLLNGRRRKDNTPELLALGSGD
KASAIMQRARLMEFDGRSPASEAYRALRTALLLSAAGNPPKTILVTSVRMEEGKTTTATNTAIALAQLGASVLLIDCDMR
NPSVHDVFGTSRTLGLSTYLVRNVEIDELTQDLPGENLRMISSGPIPPNPAELLSSERMKRLLAQLSERYDHIVLDSPPL
ASVTDAVILSTMVNGVILVVHGGRNSRQAVQRACHELSAVGARIFGIVLNNVDLRREGHDDYYYYSYQYSYSADAKRTKT
>gnl|bykdb|A0A2V9RQF1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MPANAQGLRESPDPLPVEVNRTTQHYAYPVLPSQDSVLREYLRVLIKRKWIVISSVTVIFGVVAIATLKSIPIYDASGSI
AINKSDPALLNIKDSANAPIEYYDPADLDTEVRILKSDLLALQVIRQLNLDKRPEFGGKGESSGNSLALTTDALQPDSEQ
TTALLSAFKGNLRVALQPDSRVVDIHFRSPDRQLAAHVVNALTSTYIEQNFKTRFESTMQASDWLSKQLVDLQLKVETSQ
EKLVKYQKEHGILGIDEKQNIITSKLDELNKELTAAESDRMQKESVYRLVQSGDPDTAASAALSAAGTAGTNSSTSGLLE
KLREQQADIRIQTAQLSTQFGPSYPRLAQLNNQLKEVEAQTQVEMKKITSRVRSDYLASLQRENMLRDALDRQKQQANRL
NESAIDYSLLKRDVETNRTLYEGLLEKLKEAGVTAGLRSNNIRNVDIARAPRSPAEPNVPRNLSFALALGITTGIGLAFL
LEGIDNTVRTPEQAEAISGLPSLGMIPLGSKSSSDSKSKRLSLASSREVVELVTQSRPQSQMAESYRALRTSLLLTSLGA
PPKIILITSALPQEGKTTTSINTAVVLAQKGTRVLLIDADLRRPSIHKTLGMGPKIGLSNVLTGNAPLQQAIVRSNVLPS
LFVLPAGPPPPNPAELVASSNMRDVLAELRDQYDHIIVDTPPTLSVTDAVVMSTRADTVVLVIRSGQTTKQALRRSRDIL
MQVNSRISGVLLNAVDLNSPDYYYYYEYQGKYGQRYYQEDEVKDLEESGAQVTQTSA
>gnl|bykdb|A0A2V9USA9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=781 residues).
MDSGPLVPANSGVVREIPLTSPEFGRAAVPQVYPVLPSQESAAGEYIRVLAKRKWVIFSCVAAIFAVVAIASLKMTPIYE
ANGSIAINKPDSTLNFQNSATFSLDYYDPTELDTEVKILQSDLLALQVIKELNLDHSGGPNGRAPSSLELTPDPLQVDSA
HLSSVIGGFKGSLRVALSPNTRIIEVHYRSGDPQMAANVVNTLMQTYVENNFKSRFESTMQASDWLNKQLVDLQMKVETS
QEKLVRYQKEHEILGMDEKQNITTAKLDELNKELTSAESERMDKEAFYRLVESGDPDAIASSAGGIETGSAQSASALLES
LRAKQAELHIQTADLNTQFGPSYPKLAQLNNQLKEIDTQIQGEMKKIASKVRGQYMTALQRENMLRDALEKQKQEANKLN
ESAIQYNILKRDSESYRQLYEGLLQRMKEAGVSAGLKSNNFRIVDTARVPNGPIEPNIPRNLGFALVLGLMSGVGLAFLL
EGLDNTVRTTEQAQTISGLAPLGMIPLGSKGIREGSTGKRLALAASNEAVELITQVRPQSQMAESYRALRTSLLLTNLGA
PPKVIMVTSALPQEGKSTTSINCAIVLAQKGVRVLLIDADLRRPSIHKTLGMGPRSGLSNVLTGSTTLQQAITRTPILPN
LHVLPAGTPPPNPAELLASTNMKDVLAQLREEYDHIVLDTPPTLSVTDAVVLSPRADAVVLVIRSGQTTKQALRRSRDVL
MQVNAKVSGVLLNAVDLSSPDYYYYYEYQGKYARYYRDDEPSHDGDGEDVEETSPASSTSA
>gnl|bykdb|A0A2V9V3Q5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=779 residues).
MALGPLVPHNDGFREIQPAEPTELIKPIGPGLYTVLPSQESALREYLRVLLKRKWIIIACVVGIFAAVAIASLRQTPVFD
AVGRIAINKADSNLVTFKDSMPVMDYYDPTDLDTETRILQSDILALQVIRQLNLDKRPEYGGQSAPQPNLVADPLQNDSK
RTTALLGGFKGNLKVSLIPNTRIIEIHYRSTDPTLAASVVNTLAATYVEQNFKTKFESTMQASDWLSKQLVDLQMKVETS
QEKLVRYQKEHEILGIDEKQNIITQKLDELNKELTSAESERMEKEAIYRMTQTGDPDAVASAVTSAPVATLAGTGSSPLL
DKLHQQQADLKIQVAELSTQFGPAYPKVAQLNSQLKEIENQIQVETRKAVDHLRGQYQTALQRETMLRAALEKQKQEANR
LNENAIDYTLLKRDVDSNRQLYEGLLEKLKQAGVTAGLKSNNFRIVDPARSPNAPVEPNIPRNLLFALVLGVSSGVGLAF
LLEGMDNTVRTTEQAQMISALPSLGMIPLGSKSRNNGTGIGRLTLTSSREVVELVTQVRPQSQMAESYRALRTSLLLSSL
GGPPKVIMVTSARPQEGKTTTAINSAIVLAQKGVRVLLVDADLRRPSVHKTLGMGPRSGLSNVLTGNATLEQAISPSPIL
PNLFILTAGSPPPNPAELLASSNMKDVLDELREQFDHVVIDTPPTLSVTDAVVLSPRVDAIVLVIRSGQTTKQALRRARD
ILMQVNAHVTGVLLNAVDLTSPDYYYYYEYQGKYSQYYQEDPPDPPAEAQKQPQAASGV
>gnl|bykdb|A0A2V9V8F7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=832 residues).
MCSARMRQTFITNNFLSASEHPRRRLWSLWACWSALLGRNRMQDCCSGVGMDSGPLVHTNGHMIREVQAPYPVEFSRQLL
TGIYPNAPAQDSVLREYLRVLIKRKWTVLFCLAGIFIMVAISSLKMTPVYEASGSIAVNKADPGLVNFKDSGSMSIDYYD
PADLDTEVKILQSDLLALQVIKQLNLDKRTEFGGKPDSASSLNLAPDPLQTDSTRTSALLSAVKGSLRVSLVPNSRIIEL
HYRSPNKELAATVVNTLATTYVEQNFKTKFESTMQAADWLSKQLVDLQMKVETSQEKLVKYQKQHEILGIDEKQNITTAK
LDELNKELTAAESGRMEKESVYRLIQSGDPDVVASAPVGGDSNSGNNPNSGSPLLDSLRGKQADLKILVAELSTQFGASY
PKVAQLNNQLKEIDIQIQGEMKKMGGRVRGQYMASLHREGLLRDALEKQKQQANKLNESAIEYSLLKRDVETNRQLYEGL
LEKLKEAGVTAGLHSSNVKIVNAARVPMAPSEPNIPRNLAFGLLLGLTSGIGLAFLLENLDNTVRTPEQAQLISSLPSLG
MIPQGSRTGVEGKNENRLIVASSKESVELVTKSRPQSQMAESYRALRTSLLLSSLGAPPKIILITSALPQEGKTTTSINC
SIVLAQKGVKVLLIDADLRRPGVHKALGMGPRSGLSNILTGSATLQQAITRSPLLPNLFVLPAGTPPPNPAELLASSDMR
DLLAQLRDQYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTKGALRRSRDILMQVNAKVAGVLLNAVDLSSPDYY
YYYEYQGKYGSKYYQEEELDDSDEPKASSTNA
>gnl|bykdb|A0A2V9VYY4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=769 residues).
MALQPTRNNSDDFEALAPIDPLPVNGHQPLHTYFGEPHNALLHYWHVLTKRKWVVLPTFAIVFALSAIATLSETRLYQAT
SKVAIFPEVPNVLGFKDAENIAPDYEYEATLETQVAILRSDALALKVIEGMRLYQDPRFTAVKQSSPESAMGEPSMQPDP
VQAAGLLGAFRGGLSVQPVPSTRLIQVSYTHSDPRFATEITNALVKTFIEENFRTKYNSASQTSEWLGKELADLQLKVQT
SEEKLVRYQKDHGILGVDEKQNIVTEKLGELNKELTEAETDRIQKEADYKLAMNGDPEMFMKTSPDGRGGSGLLDKLREK
EADLETQYAMATTQFGSGYPRVTELNNQLKQVRAAIEAEKTKLQQKMRDDYLAALQRENLLDSAFNKQKQEANKLNESAI
EYTVLKRDAETNRQLYQDLLQRLKEAGVSAGLRSSNIRIVDIARVPTQPISPNVHRSLVLGFLLALGLGVGLALVRETFD
STVRSMEEVRAVSTLPALGTIPLQLVTDERFRKRRLTISPDGERSGMLALVTYERPKSEAAEAYRALRTSILLSSFGAPP
KVILVTSAMPREGKTTISANSALVLAQRGSRVLLVDADLRRPGVEKLFGVRAHGGLSTLISGSSNVEEVILPSSEVPNLW
ILPAGPIPPQPTELLGSTVMKDYISRWRNEFDHIIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTRPALRRACDLLLQ
VNARVMGIVLNALNLHSVEGYYYYGTQYSNNYYSEESPNNKPKAASKIS
>gnl|bykdb|A0A2V9WI32 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MGESLMDSGIVRRRSDTSTLEQLPTEIQFPADPARSYAPLPEEGFLLREYGRILKKRKWVVISTWLIIAILATVYALHMT
PVYDATGRIAINRENSVNLGFKDSDQGTIGADYEDYNIALETQIRILQSDALAFQVIKNLKLDNNPAFAESSLLDRFRRG
LKLNVVPRTRIVEIHYSHPDARLAAQIANILINTFIEQNFKTKFESTMQTSAWLSVQLSDLQMKVETSQEKLVRYQKEHD
ILGIDEKQNIVTSKLDELNKELTAAEGDRIQKESAYKLASAGNPEIFAKAEPSSLINQLRTQESDLRMKYAEATTQFGSS
YPKVMQLGNQLKQVEASIQAEDERIASRVQNEYLSALQREKLLGAALDVQKQEANHLNESAIEYNLLKRDAESNRQLYEG
LLQKLKEAGVSAGLRSSNIRIVDVARVPTSPSAPNIPRDIVLGLALGLFGGIGLAFVLESLDNTVRTPEEAQIISALPSL
GIIPLSTKQIARDRKNGHPRLSLGSRSSESADSLQLITFARPRSELAESYRALRTSIMLSSLGSPPKVILVTSALPQEGK
TTTSINSAIVLAQRGGRVLLVDADLRRPGVHKALGLRNTSGLSTLLTGGDGSQNAILSTEIPNLFVLTAGPPPPQPAELL
GSILMKDYLCRLRKEFDHIVIDTPPALSVTDAVLLSVEADSVLVVVRSGQTTKAALRRVRDLLSHVNARITGVIVNAFDL
HSGSSYYYQYDSKYYGRYYEEDPPQNGTSAAGKAS
>gnl|bykdb|A0A2V9WPZ6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=798 residues).
MACWSALLGRNRMQDCCSGVGMDSGPLVHTNGQMIREVQAPYPVEFSRQLLTGIYPNAPAQDSVLREYLRVLIKRKWTIL
FCLAGIFIMVAISSLKMTPVYEASGSIAVNKADPGLVNFKDSGSMSIDYYDPADLDTEVKILQSDLLALQVIKQLNLDKR
TEFGGKPDSASSLNLAPDPLQTDSTRTSALLSAVKGSLRVSLVPNSRIIELHYRSPNQELAATVVNTLATTYVEQNFKTK
FESTMQAADWLSKQLVDLQMKVETSQEKLVKYQKQHEILGIDEKQNITTAKLDELNKELTAAESERMEKESVYRLIQSGD
PDVVASVPVGGDSNSGNNPNSGSPLLDSLRGKQADLKILVAELSTQFGASYPKVAQLNNQLKEIDIQIQGEMKKMGGRVR
GQYMASLHREGLLRDALEKQKQQANKLNESAIEYSLLKRDVETNRQLYEGLLEKLKEAGVTAGLHSSNVKIVNAARVPMA
PSEPNIPRNLAFGLLLGLTSGIGLAFLLENLDNTVRTPEQAQIISSLPSLGSRTGVEGKNENRLIVASSKESVELVTKSR
PQSQMAESYRALRTSLLLSSLGAPPKIILITSALPQEGKTTTSINCSIVLAQKGVKVLLIDADLRRPGVHKALGMGPRSG
LSNILTGSATLQQAITRSPLLPNLFVLPAGTPPPNPAELLASSDMRDLLAQLRDQYDHIIIDTPPTLSVTDAVVLSTKAD
AVVLVIRSGQTTKGALRRSRDILMQVNAKVAGVLLNAVDLSSPDYYYYYEYQGKYGSKYYQEEELDDSDEPKASSTNA
>gnl|bykdb|A0A2V9XGR9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=782 residues).
MDSGPLVHTNGQMIREVQAPYPVEFSRQLLTGIYPNAPAQDSVLREYLRVLIKRKWTILFCLAGIFIMVAISSLKMTPVY
EASGSIAVNKADPGLVNFKDSGSMSIDYYDPADLDTEVKILQSDLLALQVIKQLNLDKRTEFGGKPDSASSLNLAPDPLQ
TDSTRTSALLSAVKGSLRVSLVPNSRIIELHYRSPNKELAATVVNTLATTYVEQNFKTKFESTMQAADWLSKQLVDLQMK
VETSQEKLVKYQKQHEILGIDEKQNITTAKLDELNKELTAAESGRMEKESVYRLIQSGDPDVVASAPVGGDSNSGNNPNS
GSPLLDSLRGKQADLKILVAELSTQFGASYPKVAQLNNQLKEIDIQIQGEMKKMSGRVRGQYMASLHREGLLRDALEKQK
QQANKLNESAIEYSLLKRDVETNRQLYEGLLEKLKEAGVTAGLHSSNVKIVNAARVPMAPSEPNIPRNLAFGLLLGLTSG
IGLAFLLENLDNTVRTPEQAQIISSLPSLGMIPQGSRTGVEGKNENRLIVASSKESVELVTKSRPQSQMAESYRALRTSL
LLSSLGAPPKIILITSALPQEGKTTTSINCSIVLAQKGVKVLLIDADLRRPGVHKALGMGPRSGLSNILTGSATLQQAIT
RSPLLPNLFVLPAGTPPPNPAELLASSDMRDLLAQLRDQYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTKGAL
RRSRDILMQVNAKVAGVLLNAVDLSSPDYYYYYEYQGKYGSKYYQEEELDDSDEPKASSTNA
>gnl|bykdb|A0A2V9XW18 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=787 residues).
MDLGPLAPLGTPTIREIQPSQNVDLVRPQDPRFYPPLASHESGAREYLRTLIKRKWIVIICLVTIFSVVAIATLKTTPVY
EAGGTIAINKPDTTLNFQNSATFSLDYFDPTELDTEVKILQSDLLAMQVIRELNLDRRPEIAGQAPPIPSPSLDLTDPLQ
IDPGRASSMIGGFKGNLRVTLSPNTRIIEVHYRSADPQMAANVVNTLMQTYVENNFKARFESTMQASDWLSKQLVDLQMK
VETSQEKLVRYQKEHEILGADEKQNITMAKLDELNKELTAAESERMDKEALYRLVDSGDPDAILSSANALEEAGAGGQSS
SALLGGLRSKEADLKIQAADLSTQFGPSYPRLNQLNNQLKEIDSQIQGEMKKIVAKVRGQYNAALQRENMLHTALDKQKQ
EANKLNESAIEYTLLKRDVDTNRQLYEGLLQKLKEAGVSAGLKSNNFRIVDSARPPTGPIEPNVPRNLLFAAVLGLASGM
GLAFLIEALDNTVRTTEQAQMIAGVASLGMIPLGSKSAREGPNPKRLVIASSKEAVELVTQVRPQSQMAESYRALRTSLL
LSNLGAPPKVIIVTSALPQEGKTTTSINTAVVLAQKGVRVLLIDADLRRPSIHKTLGMGPHSGLSNVLTGSTTLEQAISD
TTILPNLFVLPAGTPPPNPAELLASSNMRDVLNQLREQFDHIVIDTPPSLSVTDAVVLSPRADAVILVIRSGQTTKQALR
RARDILMQVNAKVVGVLLNAVDLSSPDYYYYYEYRGKYASYYREDSSGREHEEEEEVIEDAPSSSSA
>gnl|bykdb|A0A2V9Y2R7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=781 residues).
MDSPIVVRSADNLPGQRSLEILDQTPPSCQIPYSYNSYSASGHAINLLHYWHVLRKRKWAVLVTLIVVWVLSAVATMKQT
RLYEAVSQLAIFPENLNALGLKDGDGGSPGEDWDYNVTLETQTAILRSDALALKVIETMHLDKDPRFVGSTAASQPNPGA
QGLSELKPNNDEETTALLAAFHSGLSVRVIPRTRLLELRYIHQDPVLARDIVNKLAKTYIEENFRKRYESTTQTSEWLSG
QLADLQLKVETSEGKLVRYQKEHSILGIDEKQNIVTAKLDELNKELTEAQTDRIQKEANYKSAMVGDPTAFAKIQAGGTS
SLVDKLREKEADLNVQHAQATTQFGSAYPKVVELRNQLQEVRSGISVEQTRMQHRIRDEYLAAAQRERLLTSAFEQQKQR
ANLLNESAIEYSVLKRDAESNRQLYLSLLQKLKEAGVTAGLRSSNIRVVDVARTPMFPVKPDVPRNIKLGFILGLCLGVG
LAFVLESCDNTVRNMEQVSAISTLPALGMIPLQVSGNGNLRKRLKTVPAADGELQSPTLVTYARPKSQAAESYRALRTSI
LLSSFGAPPKVILVTSALPQEGKTTISANSAVVLAQRGSRVLLVDADLRRPGIGKMFGIRSGGGVSTVISGVEKFEDVVV
PFTQVPKLWILPAGPIPPQPAELLSSTVMKDYIARWRNEFDHIIIDTPPCLSVTDAVVLSPEADRVILVARSGQTTKPAL
RRACDLLLQVNARVMGIVLNALDLHSADGYHYYYSYGGRYAGHYYDDGSPQNGTSAVSKVS
>gnl|bykdb|A0A2V9YDK8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=783 residues).
MDSGPLVQTNGQTIREVQPVYPVEFGRQMLTGIYPTLHPQDSALREYLRVLIKRKWTIILCFSGIFIAVAIASLKMTPIY
EASGSIAVNKTDPGLVNFKDSGSVSVDYFDPADLDTEVKILQSDLLALQVIKQLNLDKRSELGRKPDDASSLNLAPDPLP
TDSARTSALLAGFKGNLRVSLLPNSRIIELHYRSPDKNLAANIVNTLAATYVEQNFKTKFESTMQAADWLSKQLVDLQMK
VETSQEKLVKYQKQHEILGIDEKQNITTAKLDELNKELTSAESERMEKESVYRLIQSGDPDVIASTTSVAGSNGGTGANS
GSSLLDNLRSKQADLKIQVAELSTQFGSSYPKVAQLSNQLKEIVAQIQAETKKIAGHVRSQYMASLQRENMLRAALEKQK
QEANKLNQSAIEYSFLKRDVETSRQLYEGLLEKLKEAGVTAGLRSSNVKIVNAARVPMAPSEPNIPRNLAFALVLGLTSG
VGLAFLLENLDNTVRTPEQAQIISGLPSLGMIPQGSKSIEASNQKRLTVASSKEAVELVTQARPQSQMAESYRALRTSLL
LSSSGAPPKIILVTSALPQEGKTTTSINCAIVLAQKGVRVLLIDADLRRPGVHKTLGMGPRSGLSNVLTGSATLQQTITR
SPLVPSLFVLPSGTPPPNPAELLASSNMKDALAELRDQYDHIVIDTPPTLSVTDAVVLSTKADAVVLVIRSGVTTKGALR
RSRDILMQVNAKVTGVLLNAVDLNSPDYYYYYEYQGKYGSRYYQEDELTEDKDGALTASSTSA
>gnl|bykdb|A0A2V9YHT3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=754 residues).
MDSGKLIRAEDAGNGKSSLDFPPPLLPAGYFPATLPQPALLDYWHILVKRKAVVLITLAVVFALVAFRTYRTTPLYESTG
RVAIYHESQTLTGFKDSVPIDADDWDYTVAMETQVRIMQSDSLALKVAHDLGWDKAFAPANAGAIPLDSKLTPPQESALI
GRLRGSLQVSSIPNTRMIELRFSDPAPRETARVLNVFMDDYIQENIRAKYDSTMQATDWLTRQLSELRMKVESSQEKLVK
YEKDNDILGIDEKQNIITAKLNDLNKAYTDATNDRIHKQATYRLTLNSSPELLSQADPNTLIEQLRTREADLKTQYAQVS
TQFGPAYPKVVEVGNQLKQVQETIQGETRRIGGRLQSEYQAATQRETLLQEALNQQKREANRLNERAIQYTLLKRDLDTN
QQLYDGLLQRLKEAGISAALKSSNIRIVDSARPPVLPSQPDVPRNLLLGLAAGLIAGVVLAFGAEVMDSTIRTPEQVQIV
SALPSLGIVPMSISLSSQAQGRNGKGIVLRPGKRERVEMIAHSHPKSEIAESYRALRTSILLSSLGAPPQVILVTSALPQ
EGKTTTAVNCGIVLAQQGSRVLLVDADLRRPAVHHSLGIRSNGGGLSTLLAGQHSAEEVLVRSNQLSNLYVLPAGPPPPQ
PAELLSSALMKQWISTWRKHFDHVVIDTPPCLSVTDAVALSVVADSVVLVIRSGVTRKEALRRARELLARVNAKVAGVVV
NAVDLRSPDLHHYYYSGGGRGYKYYDDSTTQKNR
>gnl|bykdb|A0A2V9ZLH4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=782 residues).
MEPGSLIPSNGQPVRELQAIAPVEFSQQVGPGVYPPLPTNDSVLREYLRILIKRKFVALSCVVVIFLLVLIATLRMTPIY
DAAGSIAINKLDPSFINFKDSASASDYYDPADLDTEVKILKSDLLALQVIKQLNLDRRVEFGGKGDMPSPNALGITTDEL
QINSSRVTNLLGAFKGNLKVTLQPNTRIIEIHYTSPNKELAATIVNTLVNTYIEQNFKTKFESTMQASDWLSKQLVDLQM
KVETSQQKLVKYQKEHSILGIDEKQNIITEKLDELNKELTAAESDRMQRESLYRLTRSGDPDVIATATATGGTEGNASSG
STLLDKLRSQEADVKIQVAELSTQFGPSYPKVAQLNNQLKEIDVQIQSEIRKIAGKVRNQYLAAVQRESMLHDAMEKQKQ
EANKLNESAIEYSLLKRDVETNRQLYEGLLEKLKEAGVTAGLRSNNVKIVDAARVPQAPSEPNIPRNLAFALLLGLTSGV
GLAFLLENLDNTVRTPEQAQMISALPALGMIPLGSKRPNEDGSRRLAVAASKESVELVTQSRPQSQMAESYRALRTSLLL
SSSGAPPKVILVTSAMPQEGKTTTSINCAIVLAQKGTRVLLVDADLRRPGVHKALGMGPRSGLSNVLTGSADVQQTITRS
QVVPSLFVLPAGTPPPNPAELLASANMRDLIESLKRDYDHIVIDTPPTLSVTDAVVLSTRSDAVVLVIRSGKTTKQALRR
ARELLVRVNAKITGVLLNAVDLSSPDYYYYYEYQGKYGGRYYQEDEIALDTEDSSKATSTSA
>gnl|bykdb|A0A2W0AJ66 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=744 residues).
MTRYFELTGEPAPDSAAQTLVQTPPNLKPGLPNRYTQKVVEALEETFLGNLWRVVRSRKKIIAAFAVMVVSTVMTASFLM
KPRYDAVGRVLFFREDEGAGVLGFKGPGSSLPEDADERAAINTQIGILESDGLASQVIHDLHLENGKFDGGKIEPGNEDS
LVRAFHKNLAISNVRGTRLIEIKFRATDPRLAADVVNYVTKAYVDRNYSSQLYASNQLSQFLLNQLTDLKAKVEESQQKL
VDYQNRNGIFGLDDKQNIVTAKLDDLNKELTAAEADRMQKEATYRLTPSSQPELIAKSEPDNLVTKLRAQEADLQMQLAQ
ASVQLGPTHPKIRELSNQLAQTRRSIRSEVKRTRERMTNEYRMALERERMLRNALETQKQAADTLNANAIQYNILKRDVD
TNRKLYEDLLEKQKELGISATLKLSGLRVIDPAQPPKRPSEPNVPRNFGLSVGFGLVGGVLLAFGLAKMHEPISTLEQAQ
ILSPLPALGVVPLLEGSANQSLVEGNVPQTASKPELVSFLQPLSPAAESYRALLTSILLSRPTPPAVIMMTSALPSEGKT
TVAMNTAIALARLGRRVLLVDGDLRRPSVHRAMQLTSTIGLTALLSNSAPFEDAVIRCAELPNLFILTAGKVSLPEDTEL
LVARFKDLLEGWRGQFDHIIVDTPPVLPLTDAVRMSVEADSVILVVRSGHIVKDAFLRAQDLLLRVNAHLTGFVLNAAEL
SSSDFRHYYGYYSQHETNRPDAVA
>gnl|bykdb|A0A2W0AUU7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MDARGLMKWNSTDISTQQSSASQNLHRASSRRVPLNPMQVVFRLLHKHLWTIAACTSLALSISLLYAVHQPRLYRATANI
AIDRDSNAGVSLNKTFASPLGDADDYSVSLETQIHVIASRSLALAVVRKLDLTHNAEFMRDANRQFASLREAAPDPTDIA
GEAVVSGLSVKTIKNTRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNIRSRYEAANHAAKFLSTQLNELRAKVEESQQKLV
AYEREHNIVMVDEKQNVVTSKLDELNKQLTAAEEDRMEKDASYQAIAAGSLDRLSESKSGDALQSLYLREAELKNEYAQA
TTTYGPNHPKVLELTNRIKAMDTSIQTELKRLQGRAELEYQVAARREQKLRAAFEAQKIEANKLNESAIQYGLLKRESEA
NRQLYDTLEERMKEAGVTAGLRSTNIRLIDPAGATGLPVSPNLRRTSCIGLFLGFLLSAAAIGIREGMDRALRDPAEVES
FTAMPSLAIIPQHHPSPRLLTPRVGEAPQIMCLTEPRTAAAEACRALGTSVLLASADLKSLLVSSPLPGEGKTMTAANLA
VVLAQQGKRVLLVDADLRKPGLDREFRIASTPGLSDLLSGSAGEEPVIQQIERVSGLSIVSAGSSQARTAETLGSARMRS
LMESWRERYDYVILDTPPILAATDAVRLSKEVDSVLLVIRSGQTSRDALARSCDLLNQANAPVLGIVVNGVSSRSAGSYY
YGYYPQLAKGYYGDSPQA
>gnl|bykdb|A0A2W0BGU4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MTNPLMKSDPATRRELVDYEIAPHPTPEPITIAPRYYPDPNASPEAGSLALYWNILLRRRWSILAVVFLATLTATLASLK
MKPVYKATARIEVEADTPQTQMLNDRYQQLQTDQDFLRTQIQVLQSDNLAWRTIEELRLADNRMFADESRVTESQAHKMK
LIETFKRQLSVELVPGSRVVLVGFESRDPELAARIANTQVENYSDYNFRQKYDATRQAAGKMEEQLDELKAKVEKSQRAL
VEYERQNAILSIGEKQNVVEQRLGEISTNFTQSQNDRIQKEALYNQVQTNPDQVPAIANNEVMQKLEENYANLRGQYVEA
LNQYGPNYPKVLRLDKQVKEASALIAAERGRIAQRIRNDYFAAARREQLLGATLAEQKKESGNFNRLLIEHDLLKGDFEA
NQQLYQRLLQRVKDATVIAGLSSTNIHIVDPALAPIIPVRPRTRLNIVLGLLVGMIFGSMLAFIQDSLDNSLKSPEEVEM
LIATRALALIPMKRLTRAERLLATNRSINARENGTAILNVAAQATSEQSEAYRALRTSVLLSVASRAPQTVLITSAKIGE
GKSSTALNLAMALAQCGSSVVLLDCDLRKPVLARLLGIQNERGMSTHLTGHDSINDVIQPYKEQPNLWLIPSGPIPPNPA
ELLCSEAMESLFGELRRRFKHIIIDSPPLLAVTDATVLASAVDGVILVVESGVTPKKFVSRARNILDGANARLLGVALNK
VHMRHDGYYGSYYSGYHA
>gnl|bykdb|A0A2W0BQL1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MDARGLMKWNSTDISTQQSSASQNLHRASSRRVPLNPMQVVFRLLHKHLWTIAACTSLALSISLLYAVHQPRLYRATANI
AIDRDSNAGVSLNKTFASPLGDADDYSVSLETQIHVIASRSLALAVVRKLDLTHNAEFMRDANRQFASLQEAAPDPTDIA
GEAVVSGLSVKTIKNTRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNIRSRYEAANHAAKFLSTQLNELRAKVEESQQKLV
AYEREHNIVMVDEKQNVVTSKLDELNKQLTAAEEDRMEKDASYQAIAAGSLDRLSESKSGDALQSLYLREAELKNEYAQA
TTTYGPNHPKVLELTNRIKAMDTSIQTELKRLQGRAELEYQVAARREQKLRAAFEAQKIEANKLNESAIQYGLLKRESEA
NRQLYDTLEERMKEAGVTAGLRSTNIRLIDPAGATGLPVSPNLRRTSYIGLFLGFLLSAAAIGIREGMDRALRDPAEVES
FTAMPSLAIIPQHHPSPRLLTPRVGEVPQIMCLTEPRTAAAEACRALGTSVLLASADLKSLLVSSPLPGEGKTMTAANLA
VVLAQQGKRVLLVDADLRKPGLDREFRIASTPGLSDLLSGSAGEEPVIQQIERVSGLSIVSAGSSQARTAETLGSARMRS
LMESWRERYDYVILDTPPILAATDAVRLSKEVDSVLLVIRSGQTSRDALARSCDLLNQANAPVLGIVVNGVSSRSAGSYY
YGYYPQLAKGYYGDSPQA
>gnl|bykdb|A0A2W0BVQ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MTNPLMKSDPATRRELVDYEIAPHATPEPITISPRYYPAPNSGPEAGSLALYWNILLRRRWSILAVVFLATLTATLASLK
MKPIYKATARIEVEADTPQTQMLNDRYQQLQTDQDFLRTQVQVLQSDNLAWRTIEQLGLADNRMFADESRVIDAQAHKMK
LIETFKRQLSVELVPGSRVVLVGFESRDPELAARIANTQVENYSDRNFRQKYDATRQAAGKMEEQLDELKAKVEKSQRAL
VEYERQNAILSIGEKQNVVQQRLGEISTNFTQSQNDRIQKEALYNQIQANPDQVPAIANNEVMQKLEENYANLRGQYVEA
LNQYGPNYPKVLRLDKQVKEASALIAAERGRIAQRIRNEYFAAARREQLLGATLAEQKKESGNFNRLLIEHDLLKGDFEA
NQQLYQRLLQRVKDATVIAGLSSTNIHIVDPALAPIIPVRPRTRLNIVLGLLVGMIFGSMLAFIQDSLDNSLKSPEEVEM
LIATRALALIPMKRLTRAERLLATNRSINARENGTALLNVAAQTTSEQSEAYRALRTSVLLSVASRAPQTVLITSAKIGE
GKSSTALNLAMALAQCGSSVVLLDCDLRKPILARLLGIQNERGMSTHLTGHDSIDDVIQQYGEQPNLWLIPSGPIPPNPA
ELLCSEAMESLFAELRQRFKHIIIDSPPLLAVTDATVLASAVDGVILVVESGVTPKKFVSRARNILDGANARLLGVALNK
VHMHHDGYYGSYYSGYHA
>gnl|bykdb|A0A2W0C122 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MDARELIKSNPAELSAQNTPASQGIHYGWARLVPLNPVQRVVRLLHKHVWIILGCTSLSVSVSVLYAMRQPRLYRATTNI
AIDRDSNATVPLNKAFASALGDADDYSVSLETQIRVLASRSLAEVVVRKLDLAHNAEFMRDANRQFASLREIAPAPESIA
VQALLSGLSVKTIKNTRVVEVSFTGRYRDLNARIVNTLVDVFIDDNIRSRYEAANRAAKFLSAQLTELRATVEESQQKLV
AYEREHNILMVDDKQNVVTSKLNELNKQLTAAEEDRMEKEASYQAIAAGSLDRIGENKSGEALQSLRLREAELKNEYAQA
TTTYGPNHPKVIELTNRINAINLSIQTELKRLQARAELEYQVASRREQKLRAAFEAQKVEANRLNVSAIQYGLLRRESEA
NRQLYDNLEERMKEAGVAAGLRSTNVRLIDPAEATELPVSPYLPRSSYLGLFLGFLLSAAVIGFRESMDRALRDPADVES
FTAMPSLAIIPQHRGSPRLLTSKVGEAPQVLSLTEPRTAIAEAYRSLGTSILLASRDLKSLLVSSPLPAEGKTMTAANVA
VVLAQQGKAVLLVDADLRKPGLDREFGIAGTPGLSDLLSGGAGEECVIHKIEGVANLSIVAAGSSPAMTAEMLGSDRMRA
IMESWRERYDYVILDTPPIIAATDAVRLSKEVDSVLLVIRSGQTPTDALARSCDVLNQANIPVLGIVVNGVSPRSSGSYY
YGYYPQLAKGYYTNSPQV
>gnl|bykdb|A0A2W4RYA1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MPDINLDDLDDASRRGAAGDGQPPAGATVPSRAGAQHAHGLDEDHGDVHLRDYVRILYKRRWLMASAFLTVMVAVALYTF
TATPLYEARTRLLIDSDPNIVSFEGVVDQEQAQPDYYTTQINLLRSRLLARRTIEALDAWNHPLLVPERGALAVVREGVA
SVMRWFRSPEGGVPDPAVGQAGGQEPPETPEQTAVIDAFLRRVSVSPVRNSRLVDVSFESPSAAFSMRVANALAKAYVQE
TLDYRLSASRDANDWLMARLAEQRKAVEEAEAALQRYREQNNALSLQDSQNIVAQKLTDVNTEVTRARTERMRQESLYRQ
LQDALARSADLDGFPAVLNNQLVQQQKLELAALNQKKAQLSETFGDRHPEIVAINRAIELAQQKLDTEIQKVVASITAQY
EAAVAHENNLLAALAQQEREAQQLNAKAVEYRVLERNAQSARQLYDSLLQRAQETGVSGELRTSGIRIVDPAVLPRTPSS
PRKVLNLSLGFVVAVLGALGLAFFFEYFDNRLRTPEEMQAVLGLTSLAMLPSVPASSLRSGDPLMTGPVPAGFAEALRML
RTNLLFARADPDMRSVMVTSTGVGEGKSVVAGNLAVAIAQTGQRVLLVDADLRRPRAHGLFGLAQEPGLSNLLVGTAESR
ECVHETPVEGLYVLPAGHIPPNPAELLGSARFRRVLDSATRQFDWVVVDSPPVMPVADAAIVGHMVSGVLFVVHSEKTSR
HAANQALGQLARAGARVIGGVLNRVDLDRNPYYYSAYYSREYTRYYVPAERARSSSS
>gnl|bykdb|A0A2W4TLP2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=747 residues).
MAHLPPAHGGRAARRGGSSWHPTDYLRVLYKRRWVAIPGFLLVFLSGAIGSIRTVPVYEARTQLIIEKDARRATSINTVL
EDRDSWYQDDFYPTQYRILQSRTLASRTAAAIEGGLPERVPPASSLSFSLSSLLGGAVSAVADMFGPGPVPAAGGEEPAA
VESAARAALTSRIQGGIVVVPIRNSRLVEIKFQSPDPEFAARVVNAHAEQYIEQSLQFRLEATSQTNAWLNTQLEEQRRL
VEESERKLQQYKEQHNTVSVDDKQNIVVQKLNALNEQLVQARIERMNREVQVNAIRELRASGESLETYPAIMNSPVVQAL
RADIAAKEAERARLGTQYGPAYPAMRELATQIERARRDLETEVSKVAAAIEADFETALARERALQQSLDQQQRESLGLDR
RMLEYAALEREALSNRQLYENLMARAKETGAAADYRGTSIQVLDRAEVPRVPVLPRTQRDLMLAALAGLVLAFGLAFGVE
HFDSRIKLPEEIKTHLGLPFLGMIPTFPGGDESGEAPLLSADAPPAFAEAIRAVRTAVLFSSAEEGARSVVITSTGPHEG
KTVVSSSLAIALAQAGQRTVVVDGDMRRPRMHEALDRSQEPGLSNVLVGEAALADALRPTSVPNLTLLAAGHIPPNPVEL
LCSPKYADLIAELKKRFDWVVIDAPPVMPVTDAAVVANSASGVLFVVGAEMTPRQNAAAAVEQLRGANAKFIGAVLNRVN
VQRHSYYYSPYYRKEYGKYYQRAANRA
>gnl|bykdb|A0A2Z5FVL3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriaceae bacterium SBC82] (length=731 residues).
MCILMTRRYTAVAEIQVQKPNSDSLTLDSNAASPAGGDTDPNSASMNLETQATVLESPALAMKVIEDLHLEDTSAFKPHF
TFTGWVNSLFSPPPPADPAGVALSAAPLRRDRLLKQFQENLEVKIIPGTRVIEVAFSSSDPNLAARVVNQLVASLVNYSF
QSRRTVDTEASKFLESQLAEMKADSDALEQKAVKLQKQTGVVQVAGSGDGDGQGQAYSSTLDQLQKATAAVSQAHTNVIL
KGAIYEVVKSGDPETIMGLPSNTALAGAASGMSNDLAVISSLRTREATLNGQINELLAKFGPAYPKVDELKADLTAIQNS
IKEEIQRMRDRARNEYVVAQQVESGAKQLYDAEKQRADEMNDKAVQYSMARQQADQSRSLYEKLQSRMKEAGVLEGFHSS
NITVVSPALAPSAPSRPNIPLYLAGSLATGLLFGCIMAVVVDLMDSKIADIHGLESLMGEAPFGILPSFAAKKKGLRLSG
HSFALPGREAIAALKDPHSAYVEALRALRTTLLSTRGGAPPQVLLVTSSTEGEGKSTLSSNLAVVLAQQGKRVLLVDADL
RRPNLHVLFNSSLEVGLSTILAGQLSVDAMGQAFLQVEAVPGLDILLSGPIPAYSAELLGSSKMRQLLDLWRGYYDFIIL
DGAPVLPVTDSVVLSSQVDATLLVARYQSTQQQSLDLSLRTLRAQLGTNRHIGVVLNGVERTADAYYKYYGFSNSTYYTN
TKRLGGGSEIS
>gnl|bykdb|A0A2Z5G3A3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriaceae bacterium SBC82] (length=779 residues).
MKTLPSPQSIYTPIPETPLTISDMGALVVRRRAIIAGVTFAFLAIASLYCLLSTRRYMATGTIQIQKDSSDALRLESMMQ
GGAADEDALDENITLQTQTNILQSDSLALRVIEDLHLDKTPDFESKFNPIDMVLGIFSPGGASDPPGASLQQSPGRMSHA
LKVFSKNLTVTPVVGTRLIQISYVSSDRKLAESVVNALAQDLTNFSFETRYKATAQTSQWLTSQMADLRKQSEALQAKVA
DLQKEAGVYTVGDGGPDGKTQAYSSDINRLELATTALSGAESNRILTGAVEQIVKTGDPELISGLAGSPMLGAASSGVAS
SLSLIQGLRSQEAVLQGQMAEYSSKFSPDYPKLVDMKSNLQVIQAAIASEVARMGARAENDFKVAKTAEAQSQMSYKALK
KRADALNDKTIEYELTRQEATDSRTLYVSLLGRLKEAGLLEGLRSTNVSVVDPGRSPAKPTKPNIPLFLGGGLASGLFLG
FCAALLFDTTDTKIQDLDELELMLGGVPIGILPAFDRPATFLRLTSSSGLDRIDAVDPVTRNVIALQQPNSGYVEALRAI
RTSLYLSKGGSPPQVVLITSSIEGEGKSTLAANFAVLLARQGKKVLLVDGDLRRPKLHTTFDVAMEGGLSSILSGSSSEK
DSSQYSAPVTSLPNLKLLVAGAPPTEPTDLLSSTRMLEALAAWRREYSFVIIDAAPVLSATDSVILSGLVDTTLLLGRYK
YTDRQLLARSYRLLQMHGGSPTGIVLNGIEREAEKRYSCYGYSGSDLVTQRKGGEHANA
>gnl|bykdb|A0A2Z5G448 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriaceae bacterium SBC82] (length=753 residues).
MQGPDPASERQQGTSVAGKPAGSDRQDFILTPADFRKILIKRQFIILACLATGLILGAVITFFTTPVFESTARIDINPDR
STNLGISDLLNSKAGGNDESTRLLTEARILQSDSVIFAVIESENLFAKKPFSKVFEKQPYVLGKPLTPAQRIPLIRLLRS
NLQVVVIPNTDLVEIHYRDPDPNQASRIAQAVVDQYLELDLRSRYEGTLRISNWLSGQLTELKAHAADAQRKIAQFQRAN
NLIGMDAEGGNLVSDSLRLVNEQLIQAEADRIVKEARYHLAETRNPELLVSVAPTTTLVSLRTQQAELLVQSAELKSKYG
FDYPRVREVEKQLTAVQTDIDAEISNLLKRFEEEYNAAVNTEALLKGRLEQVKQEAFRVSDSSADFEILKHEAQSTTDLY
DALQMKLKEASVTAGLNSNNVNLVDKAEVPAFAVAPKKRTNYGFGALIGLFIGIAAALFLETLDDTIRTSEDAEAISSLP
SLAVVPRFTTAAKEARSTYGQQAKPITPADSQFPSDLVSYLTPQTVGAEAFRTLRSSILLSSADNEARLILITSSLEAEG
KSTIAANLAISFARRDARVLLVDTDLRRGTLHLKFRLPNREGLSTLLVRESGSSAYQSPIDDLPNLFVLTRGPIAPNPGE
ILASRHMESLMEGWKTEYDHVILDSAPVLPVADSLSLAPGADSTIIVVRAAITRKKALLRVRSLLRRARARVTGIVVNDV
DLRLENYYTYSKQYGYDYATNYGGGYGETDAEK
>gnl|bykdb|A0A2Z5G7H4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriaceae bacterium SBC82] (length=767 residues).
MGPRADVRERPITLGDLRHIFRRRRRVMVSCVGGCVALAVLVCVFCTRRYQAFGEIQVQKDSSDALGLDSMMGGAEDASD
ALDANITLQTQADLLESDTLALQVIEALELETTRDYQPRYDALGSIFRLLSPSGPADPLNASLENSPRRRTRALKIFDAN
LNVKVVSGTRLIEVRFLSSDPVLAAKVVNQLMDGLVEYNFQTRFTATNQASEWLTGQLSDLKKQAEALQARVIALQRQSG
VVSLGVQDAQGRDQAYSVIVDRLQQATATLSQATSNRILKGAVYKIVQSGNAELISGLSANGIVSGSPTLSTSLGLIQSL
RMQEAALQGQIAQDTSKFGPSYPRLMDSRANLSGMESAIEDEVHRVAERSKNDYEIARREEDESRTEFATEKHQADSLND
KAIEYAIVRQEADDSRGLYEDLLKRLKEAGVLEGLRSSNITVVDPGRIPSTPKQPNIPVYLAIAAGVGLFLGVCGAFISD
SIDDKIQTIEEIERDLELVPLGILPHLGEPNWYRRPGGPSLSRARSPSSGVNSLAIFAHPNSPYTEALRGLRTALLLAKS
SAPPQLLLITSSVAGEGKSILSANLAAVLAQSGRRVLLVDADLRKPSLGDRLGMESRTGLSQYLTDERSPEDILEVGRLP
KLHLLTSGPVPPYPADLLGSLRMMEALDRWRGYYDFIVLDSPPVLLVTDPVVLASLADATLLVARYGMTNRLSLARSHRT
LMDQSTQDRVGIVLNGVSQGSPFHYEYYGHSGSLGYPEIHGGKHVDA
>gnl|bykdb|A0A317HKM4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=747 residues).
MSLDSHRPARSDPDSDDARGTGSPDTWGTDTLQIRDYARIVYRRRWIIFLIVVAGLIGGALYNWTAPRIFEAGATLQIEG
DTNILALDRPLVDQRDWMSTFLPTQVGILMSADLARTAHDELTSSEAALPPNERLSQVPTVAEIAAARSIGGVKDTRLVN
VGFRSTDPEIAARVANALARAYVRWNVEYRSKMTGEASAWLSRQVEEQRKLLEASETALQAYRRDHGADALVRTNQLGEE
RQNIVVQKLGDLQAAVTRARADTIEKDAQIKQMSALEADHKPLDTLPAIAANPFIQTLKGELTTSERELGQASKELGEHH
PTIIKLREAVQNADRKLQAEIAAAAHTIRNDFEAAQSREQALEAALDRSKREVQALNAKAVEYSALEREAASNREVLDKL
LQRSTEARLARELESTNIRIVDSAEIPTVPSLPRQTHNLMLAFAGSSSLALVLVFVLEVFNTRVTSVEDVKRHLRIPVLG
LMPQVPSKNGRVPLLVQGAPARLTELFQAARTNLIMAPELARPHILLVTSSEPGEGKTVTAANLAASLAGLHQRVLLIDA
DLRKPGLHQLFGEEQQPGLADVLAGKTTSRDFRQTKISRLWLLPAGTASRHPADLLGSERFSRLIDYLQKQFDWIVIDSS
PVLAVTDPCVIARVASGALLVVRSGRTSRDVASAAVERLDAVGANVVGAMLNGVVLDQPGRSYLPYYHREYPAYYCEQTG
SSWIPKLPDAAALQGDSTRAAAPPANS
>gnl|bykdb|A0A317I2L9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=787 residues).
MMSQDNRLMPMPAVERSLDKPLTDLNAARSYGPAANEPTQLRDYLFVILKRKWLILSLCLVVTSLVAVQMFRQPSIYEAE
TTIRIEQRKSNILQSDKLVIGGQLDPNFWGTQLKLLESPALARQVALTLDLQHNPNFFGGGSQGGFFASLRRILSGDQRR
TKAKPAEPTKLELVGESQLRDQPLSPEELAALEPYEDAIIGNEQVDGIVNTNLFVIKYKHHDPDIAQKVANTLAEVFANN
NLERSTTNSSKQETMLAKEIGELQFKVKHDQEVLFNYARENNLNPTGNQNLDVEGQRLNSLSGQLLDAENQRKTAQAIYN
SAKNASDPFTVPEVIKSTRIVALRERISAIKERRDALLVTYTPEWPEVRKLEASLKPLEAELQAAAAEAIQGLKAQYEAA
LAHEQSIKSMYNAQRGVTSQQTRAQIDMVSYTQTLETNKQYLNTLQQRLREIQASSGDRGNEVSVENYSRVPKAPIGPAR
IRNVMIAFLLSLVAGIGLAFLLDFLDDTVKSIEDIDRYVHLPALALIPASRSIGGRLKGMTSANVGPSESTALAMVDDVR
SPVAESYRHLRTSLLLSSAGQPPKTILVTSSQPSEGKTTTAINTAFMLAQTGADVLIIDCDLRRPRLHAQFEVSNARGLT
TWLSGEKDLDGLLQSLPRNPNLKILTSGPVPPNPAELLGSEEMRRLLGTLSERFAHIIIDSPPAISFTDASILSTMVDGV
MLVVHGGRSSRAVVRRAKQQLLDVGAHIFGVVLNNVRQESHDYYYSGYYSNYYSSDADAGASTGETA
>gnl|bykdb|A0A317J121 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacteres bacterium] (length=755 residues).
MRHLNHDQPEPGNNRLPALPNSYFVQPGELTIEPASSSPGIDYWHLLRKYLILLSLFAVAGAAAGFFSVAFLNPVYQSRA
LLEVQAPTVTLFKNSGVSGNDEVSQVNIQTQIQLLRSSSFLRRVMERLQLETVPPPPVQNDIFSRLRRRLTTNTQDPMAL
MTSGLNVALATFDARPINGTRIIEITCDSTSPDIAANFVNTLANEYIEQNSQGRAQNLQQTSQWLSGQLEETRNKLQEAQ
QHLQEFVQSSGNLFVLQDNTLDNSKLRQLQGELSAIQADRIAKQAKYELVAKTSPEALPGVLEDINVRGYQTRIADLRRE
AAVLKTTLTPDNPKVKKIEVQINELQITLNKEVTAEIQRIKNDYDVALRREKLLSADYTKQASQVSAEATKASQYSGLKR
EVETLQQTYSAMLLQANESNINSSVPLGMGTIRLVDPSTPPAKPYKPRPALNIAFGTMAGLFLSVGIAFLWERMDKSVRT
PGHSRTLLNVPELGVIPSIEPRGSRPAWRLLLGRESRNAGEMVGSEVSLDTRVGFWDSAPASQLLADSFRVTLASLMLGN
GTRRPPRVILVTSPGAGEGKTTIVSNLGTALAETGRSVLILDGDFRRPRLHKVFDLADTWGLTNILEEGSAAPERFGLLT
TVPGLFVMPNGPKSGSISKMLYGSEIRRFFQMVREKYDIVLIDAPPILEVADGRLLAEFADGVLLVLRSGVTDRVAALQA
YQQLSEDQTPLLGTVLNDFKATRRSRQGYYNYAGR
>gnl|bykdb|A0A321LE75 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium AA13] (length=799 residues).
MSDERTDIERIKPEEMAFGRPGYPRAVGYPEAYATGSYGYGEADDRINIRAIWRTVRKRLWLISLIALIVTTIVTLEMFR
TKSMYKASTTIEIEKENRTLVKSGDVVISTDESDDAYYTSLVMKTKIRTLMSRPLLEDVVIHLGLDHNPQFMEVTRKKSL
VEAVQTIGSKFKQEVTSELPVLEPGVQIEGGIDRSPEESARLAPFVAVLSGNLSPEPLEDTRLLVINYSHTDPKLAATIS
NTVAAAFINRSFSNKTEKFTKTSDWLNTMVRERRAEVQKAEEELANYTREHNLFSTDGKEAPAVNKLAQLYTQVTTAEVQ
RKLKESLYQQVKGGNIDVATEAFTDSKLTGLQARLNELEVKARELDVKFGADHPRVVEIRNQMVTIQEQINRSRGDLEAR
LKAEYERAIRDETALKESLERAKIDAAQQNQDAITFNILRQNVETAKTLYTDFLQKQSQARVQVAEQHNNMRVIEPAQPP
GGPIGPNRMRGILIGLFLSLVAGIGLAFVLEYFDNTIKSVEDVNRYAQLPALGIIPAITSSRPKLLTAKGQGALGANGSA
PAAAGLQRAASTLATLDTRSSAAEAYRVLRTSVLLSTAGNPPKTILITSGQPGEGKTFTAINTAISLAQLGASVLIVDCD
LRKPSTHKALGIDHSHGLSNYLSRDVAIDGLIQKLPIPNLSILTCGPIPPNPAELISSEKMKNMLAMLCERYDHIVIDSP
PLMHVTDPVILSTLVDGVILVVHGGKSTREVLKRGRQELATVGAKIFGVVLNNLDLRREGYDSYYYYRYYGDYSERSVK
>gnl|bykdb|A0A321LPW6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium AA13] (length=797 residues).
MAQERVELERVSTARVALDAAPPPRYPALAGAAGTEYGLGYPEEYGRIHLLEVWRTIRKRRWLIAATVVIVTSIVTVEMF
RIKTAYQASAMIEIGKDVQAVQGPSAAAVQDDSDNFYPLVRIKTYMIELKSRPLLSDVAARLRLDQRPEFLAAEDRRGVW
SAIKSIGGRSALREAGESPPEQASDAADTDKQPGPGADANDLAALIRALDKNLSVEPIRDTRVIKVVFTHTDPKLAAEVV
NAVTQSFIARSFSTKAEKYNNAASWLDRSTRELQAKVQKAEQSVADYTRDHNIYSTEGKETLTTDKLSRLHDQVMRAETD
RLLKGSLYEELNMGRLDRLSEAFSDPKISELTKIRGELAATYAQLSVRYGPENPRVAESKKQMAEIDNQIRASRASLEAR
LRADYERSARDEVSLKGALDRAKTEAARQNQDAIQYGILKQDVDTAKSLYTEFLQKTNQANLELAQQSSALHVIEPAEVP
TFPVDAKRLQGVLIALFVSLCAGLIFAFLLEYLDNTIKTVDDVARFVRLPALGVIPMMTAGKRGLGPKRRAYALAAAGPA
ARALLASQAEIVECDSASSAAEAYRVLRTSVLLCAAGSPPRTILVTSGQQGEGKTTTVINTAVSLAQLGAKVLIIDCDLR
RPSAHKLFKLPNTAGLSTYLSREIDVEALIHTQELKNLSLLPCGPIPPNPAELLSSQKMKDLLSAMSERFDHVLIDSPPL
INVTDPIILSTIVDGVILVVHGGRSTRDVARRARQELVNAGAKIFGVVLNNVDMRQHKYDDYYCYYSKQYDSYGHAQ
>gnl|bykdb|A0A348UZU3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=731 residues).
MSENYVDPQSLETAEIDLRKYIDIFYRRRWTVISLTLIAVALSLIISFVTRPVYKARGTVMIEKEPNILSFEDIFQIETF
RDDYFQTQYKLLQSRSLAERTIERLKLWEKKEFSGGKNVTGEDLKNPVFRQKLVDKFLGRLEVKPIRMTRLVEVAFKAHD
PALASDCVNALFDSFVDMNIEARYETTEQATEFLSEQIAELKKEISQKEQELQNYGQEKDIVILSDKETTMLDKISELNK
ALTEAQIERVRKESYYNGIKNASPDFIPEAMNNPLIQRLREEYLKLSREYAKMEEKFQPEYPEMQRLKAELDTARELLKN
ETQRLIRAAYADYQAALKKEASLKELFEQQKEEAFRLNSNAILYNSLKIELENKKNLLESLLKRQSETGVSARLKGLRTS
NIRIVDRADIPLRPDSPRKFRNLLLALFLGLFGGLGLALGMEYLDNTVKSAEDVERYSGWPTLGVVPIFDQDATLNGHYY
AYRSAEDEDGKKKRKEEKGETENEPRSIELISHFAPDSTFAESYRSLRTALLLSGPLSSLKSLIITSPLPNEGKSVTISN
LAVSLAQTEKKVLLMDADLRRPKQHRIFNLKNHDGLSNYLTMGLELKKLVKTTMVPSLYFINSGPIPPNPAELLGSERMK
ELLGRLKGSFDFILIDTPPVLSVTDSQVLGKMVDGLILVVQADRTPKEALRQTREIIDLLQLKTFGVVINALNLDNRSYY
HRHYYRHYYKH
>gnl|bykdb|A0A348V070 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=763 residues).
MDKITPTTPTTGARQTQQNLLEQILYYWHAVLRWKWTGLTVAVLIVALTLVYILISPHIYTASGTIWIDETQSVLPFEEL
SRLSGGINSQSHAMLLKSRSLAADVIEKMKLHSHPEFIAPKLPVKLQKEGVQPDNPVFKERLIDEFIESLNVSPLTGTKL
IQVSFNHRNPELAAEVLNTLLDSYIEMLIKRKYTASEQATEFLSTQISALRKDIEEAEKKLAELGTAQGILPLSSAEAPL
IQKITEVNTALTAATLDRVNKFSAYNQLKALRPEELPESPSNPAIARLREQYALLSREYARRLATLKPEYPEMQKLKSEI
EATYDSLTREKENLIKTAYAEYQGALAKEQNLQKLLDDLKAQAYKANSTAILYNSLKIETDNKKALLEALSKRQSETDLA
SRLKDLQALNVWIVDRASPPVNPSFPNRRKTFIIGVLLALIGGAGTSLFINYLVATVKSSRDIAQATGWPTIGTIPAFEK
EFKPRGPRAEFRTLSGLLKGRPGILDKKKKKKHDTPRPKSVSLKTEEGAPENDKNNHQIELIIQREPRCIQSEAFRSIRT
SLLLSFDSPTRKALIFSSPLSKDGKSSVISNLGLALAQAHKRVVIVDSDLRKPRQQEIFNVDYTWGLTHFLSSIVDASEI
IRPTAYTNLFVVPSGVTPSDPLEVMFSEKMRAFITFLKQQFDFVLFDSPPVLAVSDALVLGKQVDGLILVVRAGQTPVNA
LKQARNKIEDHKINCLGVIINGVSLLEQEGYYARQYYHYSKPL
>gnl|bykdb|A0A350UEK1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacterales bacterium] (length=789 residues).
MSQQSPPPGDARDHDSRLPARFEIVEAGVPHRLEGPQVNYYGSPAPEEDPDSGGLLDYWRILRRRKGTLIIGAVAGLLIG
IASTLPRTPIYQAKTTLEIQSFNQNFMNMGNLQEVTEGSGPAGNMVDLQTQIKILQSDTLVDRVTAQLSNGTTPAEPAAP
GRLAAWRQALNLPEEAATGAKARAVEMAADTLKVRASGQTRIVEVLVDSTDPAVAASFANRLTAEYVEQSMEARWQSSQR
TGEWLTRQMDDLRIKLERSEDALQSYAQRNKLVFTGKDTNVDEEKLKQIQDQLTAVQGDRVSKQSRWEMASSAPAETLPD
VLNDTLMRGYQEKISDLRRQQQELLETFTPENQRVKRVAAQVASLEKSLEVERAQILRRIRNEYEEAMRKERLLQTDYDR
QTRLVTALGEKAIQYNILKREVETNRQLYESMLQRVKEAGLASALRASNVRVVDEAQPPERPYKPSLPLNAVLGLLAGGF
LAVGFVVTTEKADRALREPSDIPFYLGARELGVVPSAGRVEDGKKHRLLTGRSKKADAETQSLTLATNGLSEKLELVTLQ
RRLSATAESFRAVLTSILFSGNGHGPPRMIVVTSASPSEGKTTVATNLALAMAETGQRVLLVDGDTRRPRQHGIFEVPND
AGLTDLLKPGDGDWKKLIHESGAPGLWVLPAGPGVAAPSHLLYSKKLRAALEWFREEFDMVVIDTPPMLQIPDARLFGKL
VDGVVLVVRANSTTRDAALAARMRLREDGVTLIGTVMNDWDPQDSPGGYYGSYGKYSTYRQYYSNQAAS
>gnl|bykdb|A0A350UIQ4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacterales bacterium] (length=784 residues).
MPKPTPPSNPQGDSASANSRLPVKFEIVDAPPANSDPYYGGPQFDSDEEEGGLLEYWRILRRRKGTLVIGATVGLLLGIA
VTLPQTPIYQAKTTLEIQSFNQNFMNMGNLQEVTEGAGPSGSTIDIQTQIKILQSDTLLERVHSLMNPGEEVAAPAEPAS
TPSRISAWRRALNLPDVPENDARQHAIAMAADSLKVRASGQTRIVEVLVDSTDPAIAAQFANLLTSEYVDQSMEARWQSS
QRTGEWLTKQLDDMRIKLERSEDALQNYAQRNNLLFTGNDTNVDEVKLKQIQDQLTAVQGDRVSKQSRWEMASSAPAASL
PDVLNDSSMRGYQEKLSDLRRQQEDLLEVFTPETSRVKRVNAQISSLEKSLANERDQILRRIRNEYEEAMRKERLLQADY
DKQTRLVTVQGEKAIQYNILKREVETNRQLYESMLQRVKEAGLASALKASNVRIVDPAKAPERPYKPRLPLNALLGLLAG
GFLAVAFVVTTEKADRALREPSDVPFYLGVRELGVVPSASLLEEKKGRKLLGEESQSLVLTNVGLGEKLELVTVQRRLSA
VAESFRAALTSIMFSGNGSGPPRMIVVTSPNPSEGKTTVATNLAVAMAETGQKVLLIDGDTRRPRIHGIFEIENEAGLSD
LLKPDCGEWKKLIHQTPVPNLSVMTAGPGVAAASNMLFSKRLLSALEWCRSEFDMVVIDTPPVLQIPDARLFAKVADGVV
LVVRANSTTRDAAMACRMRLREDGTHLIGTVMNDWDPKDSPGGYYGYYGKYSSYHQYSRNQGES
>gnl|bykdb|A0A350UQT3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacterales bacterium] (length=698 residues).
VSRIDEEMWKIGAFILVVLIATAVISLRLTPVYESTATLYVDRQEAKGIVGQESQANVPSALDAESFLASQIRLLQSDSV
VRPVAQRFRLLESEQQLAKEGDQARAQDAPIVLRNLKVARPPNTYLLQVSYRSPDPQLAADVANQVAQSYIEHTYNIRIR
SSQSLSRFMERQIEELRVKMEDSSGRLAQMERELNVINPEEKTNILSARLLQLNTEYTRAQAERVAAEAGYEQTRSGSLE
SAQVSGQGEAIRRLLERQNEAAERFAEVKAHFGVNHPEFRKAQAQLREIQSQVDATRDNAIRRMQVEYEQAQAREKMLER
SVNETKAEYDTLNFRSFEYQRAKREAEADKNLYDELVRKIREAGINAGFQNNMVRIADAARPAWKPVFPKLTLNLLLAFL
FSSLLAVGAAILVDTLDNTIRDPEQVSRTLKTHIIGTLPSVKNTRELMLPAKLLTAGETHVEDPSARPKDRQFSTYEEAV
RTIRSSVLLTDFDRRLRTLLMTSATASEGKSTTAGHLAFAHAEQRKRTLLIDCDLRRPSQHKLFGIPLGAGLSNVLNGET
GWRDVLVRPANNEYLEIITAGPPSRRAADMIGQLLGPVMEEMARGYDLVILDAPPLLGFAESLQMASSADGVIVVTRAGE
TSRKAVAAALTTLSHLRANVLGLVLNQVKKHHADSYYYYGYYGKYYKRYQSAAQNAEG
>gnl|bykdb|A0A352EX26 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=819 residues).
MNPSNELIRKEPADTAIGRPADSNGIPHSYNYGVDPNAESEVHLLDYWRAVRKRLWLVIGIVILITTLAVINAAQKPDIY
SANARVQVDLENNGALVGKTPYYMGSMNDPVYFNTQLQILGSQALARRVVKTLDLEHNPDFFKGTQKRTTWQTVKMMAGF
DNNVPKPDQSKPNDVLQLRTTVAPTTSQEDLVEAKRLSPYVGAILGGLRVDPVKESRGLYKETRLIDIGYTHTDPEVASK
VCNAIADTYVFNNLEKKTESNASTGDVLQKRIAELQQAIRSDEERLVNYAKNNQIISLDANQNTVVERLAGLNKQLLEAE
NERKTAEAAFNAAKAPGAASALAEGDNKQAGDGENKLADLRQKRALLMVDATEEAPEVKEVDQQIAELERQVNDSRNRKT
NTLLTNLETQYRQTLGREQALRAAFQQSRSETVTQNEAAINYRIIQQEIDTNKTLLDSLLQRSKENDVIMASKPNNISVV
DYAITPAGPVGPNRMRTVALALFLSLGLGVGLALFLEYLDDTVHSTDEVERLLHLPALAVIPSANGMGRRKLLGGPGALQ
KRNGHSGNHELLMNVDSRSPLAESYRHLRTSLLLSTAGRAPRSLLVTSSLPGEGKTTTAVNTAVSLTQTGASVVLIDADM
RRPRMRSIFGFSERPGLSSILSSDVSREDTLAMISKDEVTGLHVLTSGPIPPNPAELLGSEQMRRLMTLLQAEFTHVVVD
SPPINSFTDGVLISSLVDGVLLVVHGGKSSRHVVKRARQLLHDVGAKVFGVVLNNVTLQSNDYYYYQRYYASGNYTSDLE
ADMPAPPPPASASSTLDLR
>gnl|bykdb|A0A352F3R7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=787 residues).
MAQDNRLLPVSALDRSIDRPLADLVPAKPYGTSGSEPTTLRDYLFVVLKRKWLILSLVLVITSLVTIQSFRAPSIYEGET
TIRIEQRPMSVLQTKEIVITGQNDPNFWGTQLKLLENPALARQVVLTLDLQHNPAFFGGQTQGGVFSSLRRIFSKPKKAT
VAPAAPAGLVVVGESEVTGDSLTPEQLAELEPYEDGIIAGEAVEAVTNTNLVKIRFVHSDPELAQKIANTLAEVFVNNNL
QRATAGSSKAEDVLAKEIASYQTKIKQEQEAQFNYAKNHNLPLTIDASSNLEVARLSTLSSQLLQAENDRKLIQAQLEAA
RREKDPFSIPDVNASARVDKLRDRISALKEKRDALLIVYTSEWPEVKKIDAQLKGLEAELAKAPPEIVTSIQRRYEAAVS
RENLLRRSYEQQKGTTTQQTRDQIDLIALTQGLETDKQYLNTLLQRQRELQVTSGDRSNEVNIATYSRLPKEPIGPQRLR
NIFIAFLLSLGAGIGLAFLLDFLDDTVKTVDDIDRYLHLPALALIPASRERGRLIGTGPSPEGPSDTTALALVHDARSPI
AESYRHLRTSLLLSSAGQPPKTILVTSSQPSEGKTTTTINTAFMLAQTGAEVLVVDCDLRRPRLHAHFNAPNNKGLTNWL
SGETDIDNLMQTLPAQPNLKFLTSGPVPPNPAELLGSDEMRKLLGILSERFSHIVLDSPPAISFTDASILSTMVDGVVLV
VHGGKSSRAVVRRAKQQLLDVGAHIFGVVLNNVKLETQDYYYSGYYSSYYAEGEDKPEAVPGETAQS
>gnl|bykdb|A0A352F549 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=820 residues).
MKEPSDLSKALEIILKNSALEQSNGSSHNGHGNPPIVAYGEEASPEGEMHLRDYWKTIRKRLWLIIGLALIVGSVTALRQ
ARQPDIYQARARVQVGTQTYSPALGASRGESFYPENGYMEPEYFNTQVQILTSPTLLRRVAKNLDLEHNRTFLDGRVENR
STWRSLLTMFGFSQKQAEAPKNQNVLPDVNSSPAFASAGFNADDPAEVERLTPYAESLQGLVDVEQVKKTYLIDLRATHT
DPVVATKVVNAMADAFALWNMEVKTKTNTVAGSYLQKRIAELQSQIRSGEEQLVNYAQSHEILSLDASQNTVVERLAGLN
KELLEAENDRGLAEAAFRTSKLPGATEASAEVSDKQIAELKTRLGELRQKRAQLLLTDTEESPEVKDATQQIATLEKQLA
DTRGSAKQIITTNLEVNYRKAVEREKTLRDSFNKQRGETVAQNQAAINYNILKQEIETNKGLLAGLMQRSKENDVTMAGT
PNNIHVVDYAAIPKGPVGPRRMQAVTLAMMLATAFGIALALFLEYLDDTVKDSRDIESGLRLPSLAVIPIAGKSTQRFFP
ISRALQRTNGNGASPELLINGTGSSVQAEAYKHLRTSILLSTAGRPPKTLLVTSSVPAEGKTTTVVNTATVLAQTGAQVL
IIDADMRRPRLHQVLDMSNDDGLSAILSSEVSEADVLSKIRKYQDSNVYLLSSGAIPPNPAELLGSTQMKRLLEIVGESF
NYVVIDSPPIASFTDGVLISSLVDGVLLVVHGGKTSRQVVKRARQMLQEIGAKIIGVVLNKAELNAGNDYYYHYGYKGYY
SRADERSSQSESSSITVVPK
>gnl|bykdb|A0A352FLX4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=827 residues).
MNQSTNLSRTNTVPIGDEHIGLERTNGGHVLPGVMQGAYSYEREERGSRLLDYWRIVSKHLWLILGISVLIPTLVAIYVV
RKPDIYESQARIQVDLENANPLLGGMSKNSNVILNSETNDPAYFNTQLQILTGPGLLRSVAKTLDLEHNPDFLRETSSKN
KSTWLDIRGMLGLKAKTPPQSSTPDVLPQSSSSSSSTAAQEQAEAERLSDYVDDLQETLKVEPVKETRLTVRETRLIDIS
YRHSDPHLAAKIVNTVAQIFIDQNREKKTETSGSTGTYLLKRIAELQSNIRGKEEELINYGKNHQILSLDANQNTVVERL
EGLSKQLLIAENERKMAESAYKASLQPGAAEALAEGGINEKDVPSATRITTDSELKLAELKQKRAELLVENTEKWPAVRE
IDKQIAAIEKVMGDARRRATGVVTTNLATRYRQALATEELLRKAYDQQRAETLTQNEAAVSYRIIQQEIETNKTLLDGLL
QRTKENDVVMAGTPNNIRVVDYAIAGKKPVAPRRVLTVALAFLFSIGCGIGLAFIIEYLDDSVRSMEDVENLLRLPAIAL
IPQVGTVKPKRNLAASGKKGALVSSNGSGSGEVLLTNIEKRSPVAEAYRHLRTSILLSTAGRPPRTLLITSSVPSEGKTT
TAVNTAISLAQTGAKVLIIDADMRRPRLHSIFNLSNDSGLSALLSREASEAEIISAIQHDEASGLSVLTAGPVPPNPAEL
VGSEQMLKLLSVVADNFAHIVVDSPPIAAFTDGVLIAAIVDAVLLVVHSGKSSRKIVGRARKLLQDVGARIIGVVLNKVP
STGSNSYYYSGYYQHYHYGAETTADQQ
>gnl|bykdb|A0A352FRF4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=798 residues).
MTQDERLVPARPARDLDRTLAELTQSKGYGGRYGGGSPAEVNLKEYLFVVLKRKWLIMSLVLIITSLATIQAYREPSIYE
GATTIKIEQKTPSILQSGNGGGIVIGQSDPNFWGTQLNLLHNEALARQVIVRLDLPHNPTFFGPQGQSTIFASLKRIFSR
DSVPKTSPTPAAGSVPLNEEALNNQEFTPEQLAALEPYEDTITANEIIEPQPQTNLVIIRYRHTDPALAQKIADTLAEVF
VANNLNLQESGTSKQSQDLGQEIAKYQGQVKQKQADVFNYAKQYELPLTDAPASNLRQQRVSTYSSQLLEAENQKRSLQS
AYEAAKTSPDPFANPEVQKDERIMKLREKISELKDKETGLLQKYTKEWPEVQQVEAQIAQLEVELKKAPTEVLASMKAKS
DAATTQLADLKTAYTKESGLTAQQTKNIIELASMRADLASDQQYLNTLFQKRRELNAVSGETGTNVSVSNPSRLPRAPVG
PARLKTILIALILSLVAGIGLAFLLDFLDDTIKSVDDVDRYINLPALALIPAVRNDRTRLRGGEAALAGPNDTTALAMVK
DIRSPIAESYRHLRTSLLLSSAGTAPRTILVTSSQPSEGKTTTAINTAFILAQTGAEVLIIDCDLRRPRLHAHFNISNAR
GLTNCLSGEASEIDSVIQSYAALPNLKLLPSGPMPPNPAELLGSEEMRNLLLSLREKFTHVIVDSPPAISFTDASILSTF
VDGVILVVHGGRSSRAVVRRAKQQLLDIGANIFGVVLNNVKIEKTQDYYYGGYYGHYKSSYYAAEEQPATDQGDATNT
>gnl|bykdb|A0A352FTJ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=811 residues).
MNEATKLVKQDESRPVERRSDESQPYRGYGYGADAGDGEVHLLDYWRAIRKRLWLVIGVAVLMTTLAIIYVARKPDIYES
SSRVQVDLENNPMYAEKAAPMIVNPINDPAYFNTQLQILTSPGLLRRVVKTLDLEHNQAFLRPTAAQPHSTWKTIVKMLG
AGAEKKDTVPAPNVLPLTSAMAPAVSSDDLVEAKRLAPYVSALAAGLRVEPVRENRAGYNKETRLIDIDYQHGDPEVAAR
VVNAVAQTFVRSNLEKKNETNTTTSEFLSKRVEELQAQIRAAEEKLMAYAKSNQMLSLDANQNTVVERLAGLNKQLLEAE
NDRKMAEAEFNAAKAPGAASALAEAGAKEIEATDSELTKLRQKRAQLLIEATEEAPEVKEIDQQIDVLQKHLADTRARGT
ATLLKNLETKYRQAADREEALRKSFNQQKGETVTQNEAAINYRILQQEIETNKGLLDNLLQRSKENDVVLAGRPNNISVV
DYAIVPDFPVGPARLRTVMLAFLLALGFGAALALFLEYLDDTVHSTDDVERFLRLPALAVIPAMSSASAPRRLLSSAASL
QKRNGSNGSNPELLLNINGRSALAEAYRQLRTSVLLSTAGRAPKTLLVTSSLPGEGKTTTAVNTAISLAQTGASVVIIDG
DMRRPRLRSIFDLPERDGLSSILTSEATPEDMLRSVARDESSGLFVMSSGPVPPNPAELLGSDQMRKLLATLSEKFTHVV
IDSPPVNSFTDGVLLGSMVDGVLLVVHGGKSSRDVVRRSRQLLLDVGAKLVGVVLNNVSVRSHEYYYYYQRYYHQSYYTQ
ETAEEVAATRS
>gnl|bykdb|A0A353C9L6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=884 residues).
IDGLKYGRFGVIRSKNRENTADIWYKTRLRKFCRVGDVQGQESSMEQDQRLTPLPKSADLRANASEYGSSYSSFYDEEVI
EGKRTVQQYFRIVYKRLPLIIAIVTIVTAAAAIYMYRQPTVYQATTDMIIEPRRPKVTSKDAININFGQDANYYQTQLML
LRNRDLVKQVVIDLGLYREPNLFGASERGILASLRSIFTGSGQNAEVPSALPVVSEPELLGEERPRTILSPDEEKRADQY
AGILFSGLTVDQVERTNLVNVRVKSTNQALAPKVADKIAEVFKLRDAERETQGAKNSAADLAKSIEELQNTIAQQEIDLI
AEMRSSGLPLQERGQDLSASRLSSLSETWLKAMESRRQLEGRYNAALTANSRGEGMNIPDLYENKIFQDTIRLNTERKAK
LQDQIRDIEKQIQETEAEKAELLVKYTPEYPEVGKKEAKIASLKETKDKTEREVSGIIDRDQKKIEKDAVTGALVSLRAQ
LDSKRREEAQALDAYEKEAALANVQGQAQTKLTTLKREIETKRNLLDTYTQRLKEKELEVESGAPDNIKIAANAGGAYPV
GPQRSRNILVAFLLSLAAGLGLAFLLDYLDDSVKTSEDIGRHVGLPTLALIPHYFGSEKRRLRLLAANGNGNGGAPSTGL
VTLEERHSPMAEAYRHLRTSLLFSSAGKPPQTILITSSQPSEGKTTTAINTAITLAQSDVDVVIVDCDLRRPRLHSHFDL
ENTQGLTNYLSGERNTQNLIKTCRDLPRLKVITSGPIPPNPAELLSSNEMRNLLQFLRGKYKHIIIDSPPAISFTDAAIL
STQVDGVVLVAMAGRSSIHLMRRFKQRLGNLGARIYGVVLNGIKSGSVEYEYYGAGYYDYYRKSEVDTATPLMDDARNIH
NTNG
>gnl|bykdb|A0A357F267 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=838 residues).
MEQDQRLTHLPKAVDLRANGGDYGSGYSSFYDEEIADGRRSLQQYFNIVYKRLPMILTLAIIVTAATAFYMYRQKSVYQA
TTEMLIEPRKPKVTSKDSININFGNDANYYATQLQLLQNADLMRRVVVDLGLYREPDLFGDGDRGFFAAVTSIFSSTKEE
EKEKEADSLPIVSDTAESPSPSSALELTPEEEKRVQIYAAMLRGGLSVEQRERTNLVNVSIRSTNPDLAARVADKVAEVF
RDQDAERETQGAKNASEDLGRSIDELRETIAQQEIELIEYMRSSGLPLQEKGQDLAATRLGSMSETWLRALEARRQLESR
YNAAVSARARGEGMNLPDLYENKIFQDTMRLNTERKAKLQDQIRDIDKQIQQAETEKAELLVKYTPEYFEVKKKVERIAA
LQETRAKTETEVTQIIDRDQKKIEVDAINGALVSLKAQLDAKRKEEAQAQAAYDAEAARANIQGQAETKLTTLKRGIETN
RNLLDTYTQRQKEAELAIASGRPDNIKIAARAITPKSPIGPQRNRNIFVAFMLSLAAGIGLAFLLDYLDDSVKESEDIGR
HLGLPTLALIPHYFGSEKRKHRLAAANGSEAVASTALVTLDERNSPMAEAYRHLRTSLLFSSAGKPPQSILVTSSQPSEG
KTTTAINTAVTLAQSDVDVILVDCDLRRPRLHSYFDLDNTHGLTNYLSGERNTDNLIKSCRDLPRLKVITSGPIPPNPAE
LLSSNEMRNLLQFLRGRYKHVIIDSPPAISFTDAAILSTQADGVILVAMAGKSSIHLMRRFKQRLGNLGARIYGVVLNGI
KAGSMEYDYYGSGYYDYYRKSDADSSTPFMDDAADTKD
>gnl|bykdb|A0A372IRG7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidipila sp. 4G-K13] (length=755 residues).
MQGSAIAPQGQQELHPPGGVPPHESPAFTPADFRKIIIKRKWVILFCVLVGVGIAFYHIFTTIPQYEAISRMSIDFSRST
NIGIEDIIESKLSGGEESDQKLQTELRIMQSDSVVMDVINSLDLYHRKPFSDMFAKQPYTGHLTPLQRYQLIRAFQSSEK
VIVETGTQIVEIHFQNPDPEVAAKVVNAIVQAYMERDLRSRFEGTTRVSNWLSQQLSTLKSQVQSSQQELSDYQKKNNLV
GLGPTGTSLVTDDLRTINDQLAEARADRIVKEARYRMAQTRNPDLLVSVSGGVLGSLRSQEADLMVQKAQLQSKFGPEYP
KLREIDRQLGSVRSDIQTEITNLTQRFQTEYDAAVKTEGLLQQRLDDTKQQAFHENESAAQFEILQHGAESASELYDALQ
MKLKEAGITAGLNSNNIDVIDTAMIPPYPVLPQKRQDATFGFLGGLIVGLILAVFLESMDDTLRTSDDAEAVSLLPALAV
IPHFQPFSKKAINAKDEAADRNGSLAKVSPDLLAYNEPQSIVAEGFRSLRSSILLSAVDREPKLLLLTSGFAAEGKSTCS
SNLAVSFAQRNARVLLVDTDLRKGTLHMKFRLSNRTGLSTYLSRESKEESFEYPIPGLPNLAVMTRGPIAPNPGEMLASR
MMEDTLARWRQEFDHVILDSSPILAVSDTLSLAPQADAVLIVLRSGITRKKALSRVREQLRRSGARVLGTIINDVDLRLE
NYYTYSRRYDYGYKGYKGYGSAYGAGYAGGKDGEE
>gnl|bykdb|A0A372IT17 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidipila sp. 4G-K13] (length=765 residues).
MTSPTHILERDAMAVYDEWTVADLLSILRRRRRIVLGMVFALLLLVTLYCLLITPLYQATGEIEIQREPSGAFGLDNGVL
GDTSHEASDALENSMSIETQAGILESDTLALHVIRALDLESTQNFFPAKKRGLTIPGWIFFWRSPLEPRSVPLEEAPNRR
YVALRIFARHLTVQPVTGTRLIEIRYSDPDPALAARVVNRLVQALADYTFQSRLAQTSESSSWLAGQMSGLKKQAEALQT
KAIGLQSEAGMYGDNGSHDVVLAQLENLNQALSQAELNRILKEAIDHTAQSGDPELISGLTASAGAEETGGLQHSLELIE
TLRSRESTAKAELAQDETRYGAAWPGMQERQAQLTEIQKSIHDEVRRVGERAHADYEIAQRAEDTAREEFEKQKTLAAQM
NDRRIAWTLARQEADESRRLYDQLFGKLKQAGVLEGLHTSSFSIVNPARIPPGNHPKSPNLPLYYAAALGAGLFLGCAGA
ITCEFTDRSITSLTEVERLTGAPLFSVIPLLEPSFHLPRLLRGGGSSGVTAAASWELQGTGSASGSPFSESLRTLRASLM
LSRSSAPPQVLLVTGTRDAEGKSTIALNLAAILAHQGAQVLLVDGDLRRPALHRYLNMPESPGLSEALAGSAAPPEPQPL
TALPSLALLHAGRKPPFPSELIASRRMEELLGGWRHQYDFIVLDSPPVLPFADALVLSQMSDATLLVARPGVTAKPAIAR
SYRALSLQMAQNAVLGVVLNGVRETSAEYYEYYGYKGSRYGGTRT
>gnl|bykdb|A0A399WK13 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=825 residues).
MKETRNIITTTSPEPVELQRPPDPAIPTTGRYPGYSATPQGEGFQLIDYWRAVRKRLWLVVGIAVVMTTLATIYIARKPN
VYRAKAVVQVDNEQVNPDLVTTDRARPISNADPSYFNTQLQLLWSESLLRRVVKEHNLDANKEFQAAAKASSGSMLGRLL
RSVGLASGDKQKQEESVPIDPNSTLASADEIAEAVRLTPFVEVIRRNLSVDPVRESRATVKDTRLIEISYSDTDPDLAAF
VANAIAETFTNQNQEKRTGTSRKTNDFLQERIASLQSDIRRDEEKLVEMTQNAGILKTSDDSTIVMDRLSGLNKAMLEAE
NARKNAEANYFEIAKSPERLSAMAEAEMARFITEQQNNIRQFQSDTLKKISDLRQARALKLQEYQEGAPEIKEIDAQITS
YQNSIDNAVQKFQNDLDKYRDSTKKTLLYNLQTKYLQAKANEDKIRADFNKQFGEATGQNQSAVSLALLKQTIDTNKGFL
ENLRKQVSSNDVAAQGSDNNITVTEPAVPSNIPVSPRRLTTVLGALFLSTLFGVGLALFLEYLDDTVRSTEEVESLLQLP
ALAAIPTIDSMPKRRLQLVAENGEPADDNLGSELLIHADPRSSLAEAYRQLRTSILLSTAGHAPKSLLITSSLPSEGKTT
TATNTAISLAQTGASVVIIDADMRRPRLHSVFGISNADGLSTILSNDLSEAEILNIITQDESSKLHLLTSGPVPPNPAEL
IGSDQMAKLLKMLQGHFTHVVVDSPPIASFTDGVLIASMVDGVVLVVNSGKSSRQVVRRSRQLLLDIGAKIIGVVLNNVN
LRSQDNYYYYQSYYTRDNYRSDDEA
>gnl|bykdb|A0A399WNU1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=817 residues).
MQSNFQVVKRNSRQDPESLDFYDQDDLYPESYYGDSIQEPTEKQQLFNLLSILKKHWLLVLSITLIGTFLVIVYEAQKPD
FYEASVRVQVNNESNPAAGEGTASSIILNPGSDPTYFATQLQIIEGPGLIRRVVKNLDLEHNPTFFRPGKDQDTTVWQNV
ARMFGLYSQPVRNQAESAPPAKNTLDLKTDTDADLDSQAEQLAPYVGFIKRNLEVSPVKDSRTATKETRLIRIEYRHYDP
VIATKLVNAIADTYVLQNLEQKVQSNASASDFLQKRVAELQAKIRTGEESLINYAKSNQILSLDANQNTVVQRLSDLNTK
LSQAENDRITAEAAYKAALNNPLAGTTAQAKDARTAGLESQLTTLRQQLAQLKVDYTDEWPEVQKVEKQIAGIEKELQSN
RKRSADTQIASLLQTYREAASRENELRSNFDAQRSAVLNQNEAAINYRIIQQEIDTNKSLLNSLLQKARETEVVLNGTPN
NVHVVDRALVPGAPSGPQRTKNVVIAFFASLFGGIAIAFGLNWLDDTIRVPVASQAQLGAPIVGMIPQSNGHRRSNHFLA
KFNRHRNGDGDPDPAESRSAYADSFNNPLIAEAFHQLRTSLLLSTAGGSPKTVLVTSGEPSEGKTITSLNLAKSLAQLGG
KVLLVDADLRCPKMHLINNIDNSCGLSTLLTAEEVDQDLVDRAVTKSSEPDLDILPSGPRVPNPASLFASTHMKGLIERL
SATYSYIVIDSPPILYFADSVILSTQVDAVVAVARVNFSSRDVLTRARQKIQDVHGNVVGIVLNDIQLNNFKYYNHTYYR
QLEPPDLDQGDGNVLHL
>gnl|bykdb|A0A399WUJ8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=846 residues).
MDQDQRLTPLPRGLDLNQPHGELPAAYTAYYDHESQSGQRTLRQYVRVITKRLPLIGAIAIVVTAAAAFYSFRQPSIYSA
STEMLIEPRKAAPTDAININLGGDETTYYNTQLQLLQNPDLMKKVVLALGLQRDPDLLGQSDRGFFATIKSLFSGPAKAQ
APQGTLPVLTGTENADPTAAQLSPEESARANQYAAALSGGLRVDQTERTSLFTVSVSSTNPQLAAAVSDKVAEVFIEEDA
KRELEGTQSAYDELTKSIADLKVTIADQENKLTEYMRSSNLPLQEKGADLAASRLQTLSEQWLSAADDRRKLEARYNGAV
TASSRGQGQNIPDLYENKVYQDTVRLNTERKAKLQDQIRDIEKQIKDAETEKAELLVKYTPEYVKVKQVEEKIVSLKNTK
QQTESEVSQIIDRDQKKIEKDAVSGALVSLRSQLDAAKRREDQLLNAYEVEAERANVQGQATTTLTTLKRALETNRGLLD
TYTQRQKEQELSLAAGKPNNIKISNRAVVPTSPDGPKRARNIFIALLASLGAGIGLAFLLDYLDDSVRTSDDVSRALGLP
TLAMIPHHGINEKKRLSLRGIAGESNGKSTAASTALITLEDRHSPMAEAYRHLRTSLLFSSAGKPPQSILVTSSQPSEGK
TTTAINTAVTLAQADADVVLIDCDLRRPRMHSHFGLSNTQGLTNYLSGEKSTENLIKAAPGLPHLKIITSGPIPPNPAEL
LSSNEMRNLLQFLRGRFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSMHLMRQFRTRISALGARIYGVVLNGIT
SESVEYDYYGTGYYHYYQHRTDDATPIMEDMGPSEPPRDQGSSFRP
>gnl|bykdb|A0A399Y5V2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=574 residues).
MTESHATTLELRDYLGILRRRKWFIILPTVVILVAAITASLLTTPIYEASADVLIQSNKRSSVIADVAMPAEDPARELQT
QIQVITSRPVAEETAKRLQLNVPPEAIQARVTAQVLGQTSIIRVRARDASASLARDIANGVSATYIDLRRKSALDSFAQQ
ANDLQQKVDEATAELQQRDAELADAISKTRGEKTSDTGSQALVATLTNRREQAAAVQSFWKTALDKLQIQSNLQTSSAET
VAPATLPTAPVEPKLSRKVIFALTIGILLGAGIAFLVEYLDDSLRSKQDAEKAFGAPILGMIPRAQSWNDRRSAMLLSVK
DPASTTAEAYRSVRTNLQFSLLDSGSRVVLVTSPSASEGKSTTAANIAVVLAQSGKSVIIVDCDLRRPRVHKFFELRNTE
GVTTAILAERPLVDLLQRPRIAGAPPSLLALTSGPIPPNPADLLGSARVSELIETLGTLADYVVIDSPPIVPLSDAAVLA
PKTDGAIIVAKAGQSSRRASAQAAEKLDAVGAELLGVVLNEVTPNFGEPGYYYDYYYYYQSYRPIPEKQGSKRGGGRRSK
DSGGARAAQTAGSR
>gnl|bykdb|A0A3B9MEU8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=789 residues).
MMSQDNRLLPVSALDRSIDRPLADIAQAKPYGVSGADTTTFRDYLSVVLKRKWLILSLVLVITSLVTIQSFRAPSIYEGE
TTIRIEQKPMSVLQTKEIVINAQSDPSFWGTQLKLLENPALARQVVLTLDLQHNPAFFGGQSQGGVFASLRRIFAKPKKA
SESPAVSSGLTVVGESEVTNGSLTPEQLAELEPYEDAIIAGETIEPVPTTNLVKIKFMHSDPELAQKIANTLAEVFRNNN
LERSTAGSSKAEDQLAKEIAKLQTQIKHDQEAQFNYAKNHNLPLTAEAGGNLEAARLATLSGQLLQAENDRKMIQAQLEA
ARKEPDPFSVPDVNSSARVEKLRDRISALKEKRDALLIVYTPEWPEVKKIDAQLKGLEAELAKAPPEIVTSIQRRYEAAV
SRENLLKRSYEQQKGTTTQQTRDQIDLMAITQELETNKQYLNTLLQRERELTVASGDRSNEVSIPTPSRLPKTPVGPQRL
RNIFVALLLSLGAGIGLAFLLDFLDDTLKSVDDVDRYLHLPALALIPSNRDRGRLIGISGGPPSAPSDTTALAMITDVRS
PIAEAYRHLRTSLLLSSAGQPPKTILVTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDCDLRRPRLHAHFGAPNSKGLTN
WLSGETDIDALIQTYEQHANLKFLTSGPVPPNPAELLGSDEMRKLLGILSERFTHIVIDSPPAISFTDASILSTMVDGVV
LVVHGGRSSRAVVRRAKQQLLDVGAHIFGIVLNNVKLETQDYYYSGYYSSYYADGDKPEEVPGEPAETR
>gnl|bykdb|A0A3B9MK99 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=771 residues).
MCIRDRVISVLVLITTISVIHVARKPDIYQASARVQVGLENNADLVGKTPYYFGPTNDPVYFNTQLQILGSPGLMRRVVK
TLDLEHNPDFFKGTIQKRSTWQTIKRMAGFASADPPDVTAKPKDELQLRPAVAAATSQEDLVEAKRLAPYVGAVLGGLRV
EPVKESRGLFKETRLIDLSYTHIDPEVASKVVNAIAETYVYNNLEKKSDTNMGTADFLQKRIAELQQQIRSDEERLVNYA
RNNKIISLDANQNTVVERLGGLNKQLLEAENARIEAESKFNAAKVGGAATALAEVDAKQVNETEGKLADLRQKRALLMVD
ATEEAPEVKEVDQQIAELERQVKDVRSRKSVTLLTNLETDYRQTLAREQALRKAFEQQRGETLSQNEAAINYRIIQQEID
TNKTLLDSLLQRSKENDVIMASKPNNISIVDYAVTPDGPIGPNRSSTVSMALFLSLGLGVGLALLLEYFDDTLRSSEEVE
RLLQLPALGVIPSANASARRRLIGASGALQKRNGHSDSPELLMNVDGHSPLAEAYRHLRTSVLLSTAGRAPRSLLVTSSL
PGEGKTTTAVNTAVSLAQTGASVVIIDADMRRPRLRSIFGLSDRAGLSSILSSDVSEADMLEMVSTDEATGLRVLTSGPI
PPNPAELLGSDQMRRLMATLQSQFSHVVVDSPPVNSFTDGVLLSSMVDGVLLVVHGGKSSRHVVRRSRQLLHDVGAKIFG
VVLNNVALQSHDYYYYQRYYGARNYKSDGDDDIEPTSHARRNGSHNTLDLN
>gnl|bykdb|A0A3B9MLP9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=818 residues).
MKEPSDLAKALDIILKNSSLEPTNGSLRNGYATPPIVAYGEEASPEGEMHLRDYWQTIRKRLWLIIGLALIVSTIAALKQ
ARQPDIYQARARVQVDTETYSPALGASRGGSYYVDNTYMDPEYFNTQVQIISSPTLLRRVAKTLDLEHNRTFLDSHVDNR
STWQSLMRMFGLGSNPKNSAVAENGALPDRGNQPLTTSGLSLEDPAEVERLAPYVDSLQGMLDVAQLKKTRLIDIRASHT
DPGVAAKVVNAVADAFALWNIEVKTKTNTLAGTYLQKRIGELQSQIRNGEEQLVNYAQSHEILSLDASQNTVVERLAGLN
KELLVAENERSLAEAAYRASLAPGVTEANAETSDKQVAEFKTRLAELKQKRAQLALTDTEESPEVKDVNQQIAILEKQLD
ETRGSARKIITVSLDSNYRQALDREKTLRDSFNKQRAETVAQNQAAINYNILKQEIETNKGLLEGLMQRSKENDVTMAGT
PNNIHVVDYAAVPKGPIGPRRMEAVFLALVLALVFGVALALFLEYLDDTIKSPGDIESGLRLPSLAIIPIAGRSAQRLLP
ITRALQRTNGNGSGPELLINSRGPTLQAEAYKHLRTSILLSTPGRSPKTLLVTSSVPAEGKTTTAVNTATVLAQTGAKVL
LIDADMRRPRLHHVFGLSNNEGLSAILSSETSEAEILAKINRYLETDIYLLSSGAIPPNPAELLGSAQMKRLLDVAGETF
AYIVIDSPPIASFTDGVLISLLVDGVILVVHGGKTSRQVVRRTRQILQEIGAKIIGVVLNKAEVRSSDYYYYHYDYKGYD
SQPDDETTESKSSSIVAK
>gnl|bykdb|A0A3D1ASD2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacterales bacterium] (length=734 residues).
MSEMRLDRSNLPALPSTYSVSHITAEPEARETTVPLTHYVWVLRRHKWKILGFVLACCIATLLVSTRLTPIYAATATVDV
DRQMPTNVLGQDSGRAPVNDADEYLATQINLIKADSVVRPVVQKLRLREVDGNDLMENTSEARSAAAEDAPVRLKRLEVI
RPPNTYLLQITYQSANPRLAAEVANGVANSFLQHSFEIRFKSSESVSQFMTKELEELKAKMERSSDALAKFQRDLSVVNP
EEKTSILSARLQQLNTEYTNAQTDRVRKEAGFNAMQSGQMEAALISSQGQSLKKLTEAYDEAQSRLADVKLHYGINHPEY
RKAQGQVAELDRQLQTAKTSITEQVAIEYRTATQREQMLKQELARTKSESDALNARSFGYEELKREAEADKKLYDELIRK
IKEASINANFQTSNVRIADSARPPLKPVFPRTRLNVLIAFLFSTILAIGAAVMSDVLDNTLKDPEQIARTLKTQVIGTLP
SMKSWRARLGPIAKGGAKAELVPLGELGDRYASGYDEAVRTLRNSILLTDFDRRLRSVLLTSASPSEGKSTVAAHLAVAH
AEQKHRTLLIDGDLRRPSLHKFFDMPMNAGLSSVVLQSANWREVVVPAENVAGLDVLPAGPPSRRAADMVGNRLPQILEE
AALEYDLIVLDAPPLLGFPEPLQMAVNVDGVIVVSVAGQTSRKAVASVLSTLHRLRANVVGLVLNEVRKEMSDSYHYYGN
YGKYYRAENEKRAS
>gnl|bykdb|A0A3D4VGU2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacterium sp] (length=759 residues).
MDTLDPQRQSGSAIASADEKTVAPQSTINLSDLRKLFLKRKWIILICVLAGIGVALYHVETATPQYEAVSSVSIDMNKST
GVELTSLASSSGGLQSQDRVETQLHIMQSNTIAWNVIKTLKLYNKPPYSGVFKKAGYHGTVTPSQKLALLNTFKGATQVV
LVPETDLAEIHFQNQNPKVAQEAANEIVNAYQDWTLRAHFETMTRISDWLSQQIISLRESVNKSQNDLVQYQREHNLLSV
GQQGSSLVDANLETINSQLAQAEADRIVKEARYKMALTRNPDLLVSVAPNTVLTSLRSQEANLLVQQADLQSRFGPRYPK
LEEVRQQLKQVRSDINKEITNLTQRFKAEYDAAVQTQNLLEARLENTKQQAFKQNESSAQFEILKHKAQTSSELYDALQL
RLEEAGITAGLNSNSLEVVDHANLPVIPVTPQKKRTVVFGFLGGLIAGIAISLLLESLDDTLRTSEEVESIGHLPALAIV
PRFVSGAKRKTAYGSYGAEKRPKEPVAEKEDQISRDLLTLLEPQSIVAEGFRTLRSSILLSSVDREPKAILLTSGLAAEG
KSTCAANLAISFAQRPARVLLVDTDLRKGTQHLKFRVSNRVGLSTYLSRESGEESIVFPLPELPNLGVLPRGPVAPNPGE
MLASRMMADTIQKWRSEWDFIIFDTSPVLAVSDTLNLVRHMDGTLVVVRSGITRKKALQRTRELLRRANARILGSVVNGV
DMRLENYYTYSRGYSYGYRSGYESAYGAGYGVEDTDDKG
>gnl|bykdb|A0A3D5SQ87 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=818 residues).
MKEPSDLAKALDIILKNSSLEPTNGSLRNGYATPPIVAYGEEASPEGEMHLRDYWQTIRKRLWLIIGLALIVSTIAALKQ
ARQPDIYQARARVQVDTETYSPALGASRGGSYYVDNTYMDPEYFNTQVQIISSPTLLRRVAKTLDLEHNRTFLDSHVDNR
STWQSLMRMFGLGSNPKNSAVAENGALPDRGNQPLTTSGLSLEDPAEVERLAPYVDSLQGMLDVAQLKKTRLIDIRASHT
DPGVAAKVVNAVADAFALWNIEVKTKTNTLAGTYLQKRIGELQSQIRNGEEQLVNYAQSHEILSLDASQNTVVERLAGLN
KELLVAENGRSLAEAAYRASLAPGVTEANAETSDKQVAEFKTRLAELKQKRAQLALTDTEESPEVKDVNQQIAILEKQLD
ETRGSARKIITVSLDSNYRQALDREKTLRDSFNKQRAETVAQNQAAINYNILKQEIETNKGLLEGLMQRSKENDVTMAGT
PNNIHVVDYAAVPKGPIGPRRMEAVFLALVLALVFGVALALFLEYLDDTIKSPGDIESGLRLPSLAIIPIAGRSAQRLLP
ITRALQRTNGNGSGPELLINSRGPTLQAEAYKHLRTSILLSTPGRSPKTLLVTSSVPAEGKTTTAVNTATVLAQTGAKVL
LIDADMRRPRLHHVFGLSNNEGLSAILSSETSEAEILAKINRYLETDIYLLSSGAIPPNPAELLGSAQMKRLLDVAGETF
AYIVIDSPPIASFTDGVLISLLVDGVILVVHGGKTSRQVVRRTRQILQEIGAKIIGVVLNKAEVRSSDYYYYHYDYKGYD
SQPDDETTESKSSSIVAK
>gnl|bykdb|A0A3E0NV31 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=759 residues).
MDRESYFNEDLRRHGGGGVGPGARRGDNDPSEGIKVRQLIESIRVRIFTVVLVWLLTVVVMVVHVWTQTPLYRSTATLEI
EPKQNLLPYQDLSARGGDQSNIETQITLLRSGNLLAKVVERLELTTRPEFVRSVDRGFFLDAAEAGLDLIKNGFRPRRRG
EALSEAGALRRLQENLSIAPVGNTQLVRVSYSSPDPDLSTDVAGAIALTFIETTLQTRYDATRRAVKFLEDQLAELENEI
EDSQDQLLAFARSRDLDVDGESASSRRVGDLARLQTEAEAEAARLRSYVDTLRAGRTEGVPDTAKTQELRALEAQIARQE
QELAALSARYGPEWPSVRQTRSELAELRRDLSAAGGRAADAVLQQYRAAQRRADSFAAQIRAERRSSDRESEAAVQLEIL
ERKTQTNKQLYDGILQRLRETDIVAELQKEGIRISIPATRPNSQYAPNKTRSTLFALGIGLALGIAAALGLEFLDQTVKS
SDHITESIGLPVLGTVPSIGKQEGNWLAAKLKLPRRKPSRTPPKLLEPKGDRRSNIVRESYRSVRTSLLLSSASEPPRTI
LVTSALPAEGKSTTVANMAISFANNNARTLIIDLDLRKPALAPLFEVDSENGMSKFLAGRAEFADLLQQTKHKNLALVSA
GPCPPNPTELLGSKRMRWCLGVASEHFDVVLIDSPPSLELSDALTVSPYVDGVVIVARAGQTPREAVRRTSLRFQRAGAR
ILGALINGADLRNPDYGYYYSGYLSRTYDYHYAGTSADG
>gnl|bykdb|A0A3E0P0A3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=751 residues).
MNLRQRTVAPRESDEAFAGSGDDLKLIAEYGSILLRGWKVLIAFAVLGLALGIARYLSAPVVYSATSQIQIERRAPNLLG
GQMFAQPWWNPEFFPTQEQLLKGRGLAEAVTRDLALWNHRYFGGAVDRSSYVRPGEPVTADDDAVVVARLASRVRSGLSV
QQVSGTQLFNLTYSTGDPEIAMMLANGYAEAFIETGKASSRADAAQASSDIQAEISSLEAEIQELEADLVSYTQSSDIVA
PNEETNVTLQRLTAANSAFLEAQRRRIEAQAEYNELSNRPADDLAETLSGGLVSSQRAELIRLQREYDTKLETYRPDFPT
MVELKTQIDEARRQLNQLIEENSRQAVTAARARYQQALQTERSLEREYEAMKEETRRYQSASTALQNLTGDIAAKRETLD
RLRRSQSQANISASSGNQAIVTQTERAVLPTSPVSPSLRRHLPFGVALGLLCGVALVLLIDFLDRSIKSPEELERRLGLP
VLGVVPDLNRRGSSRRVYGARAPAKRVDRGADLAIDLLPHSQPRLPASEAYRALRTATLLSKADEPRLLVVTSTEAQEGK
TATALNLAIVMAQLARRTLLIDGDLRKPRIHEALGISNRVGLVNCLVHQTELENVVQATPVPNLWVLPSGPLPPNPSELL
SSGHARELFAQLRQQYDTILIDTPPVLAVTDAVTVAVRSDGLLLCVRSQRAPREAIQRCVEQLTRAGAPMLGTVFNAYKA
RPGRYGGRYQSYGYGYGYGAYGDVELQDDVA
>gnl|bykdb|A0A3E0PCJ6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=831 residues).
MRESRDIVRNPRTESAEVERPFEAVAPITNYGYARYRNEDLREHSPLFEYWRIIRKRLWLVLGITVLLTTVTAIYMARKP
NVYMASATVQVDLEQANQDLVTPDRRMPVMTSDPAYFNTQLQLLNSEVLLRRVVKELNLDTNEAFRKDSAEGSGSALRGM
LTALGLASDDSKKEDVVEEVPLASNTELATVEEMNEAVRLAPFVDAVQRDLIVDPVRESRATVKDTRLISISYRNQDPNV
AAFVVNGIAEVFTRVNDEKRTGVNSKTNEFLKKRIGELQSEIRQGEERLVDLKKNAGILKTDENTTIVTQRLMGLNEQLL
EAEEQRKNAEAQFNAVRDSPSRLSALAEEQMARYITERENDIRRFVNDTQKEITALRAKRQKMLVEYVERAPEIQEIDRE
IATLMNEIADFRDKNDKALQQYRKTVGETILENLKTRYLQTKEREDKVRSAFNAQYNEAQGQNQSEVTIKLLEQDIETKK
GFYANLENQQKGNDLAGAGTENNISVAEIAIPPERPVSPRRLTTVAVVMMLSLLFGAGLALFLEYLDDSIKTTEEAETYL
QLPALAAIPTVEASSKRRLLLVGVNESEEPEPGNALLISNDSRSSTAEAYRQLRTSILLSTAGHAPKSLLITSSLPAEGK
TTTAVNTAISLAQTGAKVLVIDADMRRPRVHSFFNLGNAEGLSTVLSSDLAEKEILNLVKKDEASGLYLMPSGPLPPNPA
ELVGSEQMKRLLVTLEKNFTHLVIDSPPIASFTDGVLMASLVDGVIMVVHSGKSSRSVVRRSTQFLHDIGAKVFGVVLNN
VDARSNDNYYYYQSYYHRDDDPDDPEAADEA
>gnl|bykdb|A0A3E0PCN7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=813 residues).
MQKNKQLALRPKEEGQETIVYGDYEGDYFDSSYYGGAPAPSERQQLMAAIGVLRKYWLMIVAITLLGSLAAVVYVAQKPD
YYTATVRIQVNNENNPAVGNDTSSSVILNSGSDPAYFATQLQILEGPGLLRRVVRTLGLEKNPEFLQPNQGEQSTVWQNV
LKMFGFYQTKSMTPVEFADKETEDALQLSLDSNEQPSEPEKLAPFVNSIRGNLSVNPVRDNRTAAQETRLIEVQFTHFRP
EVAAKIVNTLGETYVRQNLEQKVQTNASAGEFIQKRVAELQSKIRAGEQNLLSYSRNNEILSLDPDQNIVVQRLSDLNGK
LNQAEMERINAEAALSAAQQDPMRGVTVASKDARTTSLEQELSTLRLQLEQLKVEFTEEWPAVKEVRRKIAAVENELKGT
RKLSADVQLSDLQRQFREASSRENELRRNFEAQRNAVLNQNEAAINYNIIRQEIATNKTLLDSLLQRARETEVILNGTPN
NVNLVDRAQPPSAPQGPNRSRAVLMAFVASLIGGIGLAFVLNWLDDTVRADDNFELHEGVSVLGMVPGADRRLGNGFVGS
LIRKTQTKLVGENFYSLDRFARPVMVEAFNQIRTSLMLSTAGGPPKSVLVTSGQPFEGKTINSLCLAKSMAELGKKVLLI
DADMRCPKMHLINDLSNTTGLSTLITADYLSDERIDNAIRKEVDYCLDVLPSGPRVPNPANLLGSIEMRSLLDRLGARYS
HIIIDSPPILYFADSVILAANVEAVVIVSRANFSSYEVHSQAKKKIEEVGGNVVGVILNDVPISEYKYHNSYYYRQLEEF
EDEQANNGSLHLE
>gnl|bykdb|A0A3E0PHB0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=856 residues).
MESNDRLLQIPEIQERRSKKSLQTAPQDYPPAYSPFYDDEALGDSRSIREYFNIVYKRLPLILAATIIVTAAVAFYMFRL
SDQYAAAATMIVEPPKPKATDSQSVILNFGYDQNYYNTQLQLMRSEDVMRDVVVKMKLYEKDSLYGGKSRGIFETLGAMF
TGGPKNSEEAGALPVVDSVDGETVDQINLTPEQSQRADKYTAALVNSLVVEKVEGTNLVKLTMNGSDPELIRRVADTLTE
VYKDRSIMLATKTQVEAHKELQNSIEKLKKTIEDGEQNYIGALRESNLPVGDGKGAELSASRLSTVSSQYLTAIDERRKL
EAEYSAAVQAKNPYALSDASGGVLASQLRQTKTERKAKFDEQVRALDEKVKTAESELAKLRVKYTEQHWKVKEAISLIAS
LKEQKNQLEDESKQIIEDESKTLEKAVQKEITSALAAKLNTARRREAQLAAAYEQESAKANQQGQKETMLTTARREIENN
RGILDRLLQREREMELSINTSAPDNIKVSGKAQVNRTGPQRTRNILIALFISLAGGIGLTFLLDYLDDSIKSSDDIGRSL
GLPTLGLIPHQKMMDRGKKQKLLTGGSNGRGPSTEFVALEDNRSGMAEAYRHLRTSLLFSSAGKPPETILVTSSQPSEGK
TTTAINTAITLAQSGAEIVIIDCDLRRPRLHSLFDLENTHGLTNYLSGERNTDNLLKPYPKLPNLKVITSGPIPPNPAEL
LSSNEMKNLLQFLKGKFAHVVIDSPPAISFTDAAIIATLVDGVVLVAMAGKSSVHLMRRFKHRLLNMGARIYGVVLNGLK
PNSVEYGYYGYGYGYDYSNYYQKDDSTPLMEEVAAEELGEGWIEEIDDEDQNGSGK
>gnl|bykdb|A0A3M1PY35 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=742 residues).
MAASEPYRREPPTGGEWDLDALRRVLWQRRWLVAAIALEVLLVGAVVTFLRTPLYEASARLIIEKTMPRVLDSEDVVSAP
VGFFDTERFYQTQYLLMRDPAVLERALDNDGLRELLLASLRPEDEEDLAAWEPPDDGDLVEMLGAGLDVAPLEKSNVVRV
SYRHRDPEIAARIVNAVVRAYRDFFVESGTDARRGASEFLDRRIEDAQAELLELERRLAEERRRLGPVLARGSDEMGSER
LVALDQALTEAKRERAAAEARVEALDGAEPLSIEAVRSDPLVVRLREELASREQRLEELRTRFGPDWPEVRELSRAIAEA
RVRLAERAAAVFEEAVGAARADLELARTREARLQALFQQELAATDALQRRAQDYDRLYREYEQKRQVLDRLLARREEIGI
AKDLRSILERQVSVVAPATPPERPAVPRYRLDLALSALLGLFLGIGAAFAAEARDNKVRSVEQLGELGGLPVLGSVPHVE
GPPRPRLVFSRKRREGASPVVAPGAHSVEEAFRTLRSSLLLSHPGGPPRVLMVTSALPGEGKSTFSANLARTLAAFGDRV
VLLDADLRHPRLHRAFKAPRDRGLANVLAGATGLDDVLFETRYDNLALVPGGPCPPDPATLLDPERVRAVVRALRERHGA
EFVIVDTPPTLVFADAYSIVPAIEGVILVARALRTPKDAVREVCEALRKIKAPLLGAVLNDEAGDDASGSYYRYRHYKRG
YYAKARAAAAEDAGKEKKRSAS
>gnl|bykdb|A0A3M1Q0S9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=763 residues).
MTESSEQREFNLRDYWQIVVRRRWLIVTCVLVATVAALVSSLLATPVYRATCTLAIERTGVRVLRETLSSAEPSWLDYQN
WYNTQYQIMQSDEVLRRAVDLLDLMNTGLPGQDDSRENRFFSAIRKLRTTVVRTLSRTQVPIEEDDPYAPYVKTLRGGLS
VEPIRDSQLVTISFVHPDRVFAARVANALAEAYIRFSLAAKLDIAAQSEAFLVDQVRSLKEDINRRRLELHEYAMRHNIV
TGDANEVSLQNLQDLRNRRVEAEADLEDKRARYQVLTSASPDSIDEVRQHPTIAQLSAEVARLERDYANKRVLLGERHPD
VQQIATELAAGRERLASETERIARQVREAAKIDYEQARRRAEGLRRLYEETEQRVSELQQAFVEYEARKAEIDRKQATLR
ELLDRKNQMTLSASLAEDRALNIRVIEKATPPRMIFKPKKKLNVALGFLFGLFLGIGAAFVMEYVDNTIKTPDDVRDVLQ
LPVLGMIPAQEPATRRERRRSASRGEQAAEIEDPSLISARAPLSPVAEAYRELRTAVLLAMPDHPPRTLAVTSCQPGEGK
TTTAINLATTLAQLGRRVLVVDTDLRRPRCHQILKASTGRGVSTYLTGMSDLPALVQTSDLERVAVIPAGPIPPNPAELL
DSERFRTMVRELEGFEDFDHVIFDSPPVLSVVDPLLIGRQMDGTILVLRSAYTSRDAGRLGVEKLRSGRVPHVLGVVLNA
VHVEHVPYQYRYYRSGYKQAGTDSAQARRGAKGARRTAAGGRG
>gnl|bykdb|A0A3M1S4R8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=822 residues).
MRESRELISTRSAGREELEPRWQSPSYYPSYKSFSEGSAKIFEYWNAIRKRLWLIVGLVVLVTTLTAIYVARQPNVYEAR
ARVQVDLEQGNPQLQVSDRPTLLPNPDPAYFNTQLQLLTSDSLLRRVVKEMNLETNKEFQEERNRQQASTWRAILRSIGL
AREETKKTRDLEEVLAGMNLATAEEINEAVRLAPFVEILKKNLRVDPVRVSQATFKDTRLIEISFQHTNPELAALIVNGI
AEVFVKQNQEKRTGTNKRTNDFLAERIATLQSEIKRDEMRLAELKNNAGILKKDEGQTIVIDRLAGLNKQLLEAENIRKI
AEAEYMAVKDSPEKLRALAEEKLQRFITERENDMRSLNNETAKKIAELEAEKAKLLIEYQESAIEVQEINRKMEALKSTV
EKAQEKNREELEKYRARTAKEILTNLQTRYEQAKAQEDKIRRAFEEQYRKAEGENRAAIDIKLLEQNIETNRGFLKNLIE
QQSSNDVVAQGTTNNISVVDLAIPPDTPVSPRRLLTVMMALFLSTCFGVGLAFFLEYLDDTIKTAEDVENYLGLPVLVVI
PSMNAAQKRRLLLVGSSDNEPAFKNRSELLIYDNSRSSSLSEAYRQLRTSILLSVAGHAPKSLLVTSSLPAEGKTTTAVN
TAITLAQTGAKVLVIDADMRRPRIHSIFNISNREGLSNLLSSEIKRDKVLDSVYFDMSSRLYLLPSGPVPPNPAELIGST
QMSTLMEIFQKEFTHVIIDSPPIASFTDGVLIAAMVDGVIMVVHSAKTSRQIVRRSCQLIQDVGAKIFGVLLNNVNLSSQ
DNYYYYQSYYYNSYYKKEEEEE
>gnl|bykdb|A0A3M1SIV3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=829 residues).
MEKDERLLPLPKELEANKNAITYQEEGPRYFASYAYGDDILEKKFNPRDYLLVIHKRLPLIIALVLVITTLTALYMYRQP
SIYQATAILLIEPPKPKIQSKDTININFGYDLNYYNTQEKLLESPELMKEVVVKLGLYRTPDLIIRRNSGITALFKSIFE
SEKDKQEQIVLPVINESDFQKSLDNLEAKLSPEEKEAVEKVTASLLPGVDVVQEERTNLFSINVANSNPELAAILANTIA
EVYIERTIRRETEGMQKSLEDITKSIDQLQENIAELENQRIAQMRESGLPLAEKGQELTAGILRSKSEEWLKAEADRRKL
EQMYEAALQAANRGEIFSIVSRETPNSEFISTLRANIIAKKNSLDARLSEIDNKIKAAESERAALLARYTPENPKVKQIE
ATIQKLQEGKEKIRQEESAQIEQESKQAEERAKKEILTGLAAQLNSARKREAKAKESYLREVEKANQQGQAAMSLTDLTQ
KIETSRSLLNTYVQRQKELESAISSSRPDNVAVSTKASKPDSPIGPPRNRNILISLIVSLFLGIGLAFLLDYLDDSVRDV
DDITRHLNLPTLALIPEAQEKKKVKSLGSEINGNTSAALITLRETSSATAEAFRHLRTSLLFSSAGRPPQTILITSSQPS
EGKTTIAVNTAVALAQAGADVVLIDCDLRRPRIHQHFSLKNSVGLTNYLSGDQELQDLLKSPEGLPKLKIITSGPLPPNP
AELLGSTEMKALLTYLKTNFKHVIIDSPPAISFADAAILSTLVDGVVIVAMAGKSSMHLLKRFKQRLNSIGARIYGVVLN
GISSTSPEYGYYGYYYGYESYKHDYEENK
>gnl|bykdb|A0A3M1VMP2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=737 residues).
MPAMTVPGVGPGGDWDLAAVRKVLWQRRWLVAAIAAEVFLLTALVTFLRTPVYTASARLLIERTTPRVLDTEDVVPMVWN
EYEIQRFYQTQYLLLRDPAVLRDALDRYGVREALAPELTEPGEDGEEPKPPTDDQIAAYIRDNLDTEQLEYSSVVRVSFT
HPSPEIAANVVNAVVDAYRDFFVRTGVDARRGAADFLERAIQEAQAEVLELEAKLAQARRQAPPTVPEREDEPGSTRLSR
LEQTLTEVKAERAAAEARLAAYQEATPSGIPEVNANPQVQRYRQDLAELRRELAELEGKVGPNWPRLVELRAAVKETERN
LENEMEAIYRQALESARAELALRRESEARLQRLIEEEQARAAQLQLATGELEALRSLYKQKREALDRLLARREEVAVTRD
LQSILERQVHVVDRAKPPKSPSAPRVKLNLALGLLLGLLLGVGGAFGAEALDVKLRTASQMREITGLPLLGSIPRASAPP
RPRLVFSRKGRSRSRPVIPEEQMDVEEAFRALRSSILLAQPQHPPRSLLVTSALPGEGKSTIAANLARTLGAFGRKVVLI
DADLRHPRLHRVFRVPSERGLTNLLASHDPADGFVVPTRYANLHLLPGGPCPPDPATLLDPDRFREIVGELDERLGFDFV
VIDSPPVLVFADALNLVPVVEGTLLVARALSTPKDALRQAVDQLAKVNARILGTILNCEVTEDVTGSYYRSYRYRKGYYR
RPAEEEGERASARDAAG
>gnl|bykdb|A0A3M1VZ38 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=748 residues).
MIQQDPQNQEFNLRSYWQILVRRRWLIGTCVLVTTVAAAVSSFLATPIYKATTTISIERRGVRLLNTSLTATEPSWLDYQ
NWYNTQYRIISSDAVLRYAVKQLDLENRPTLLGEQADEEPSPFSLGGLRAKILSVIGRGAPETGEVDPLRPYIKQLRAGL
SVDPVRDSHLVEISFVHPDPRIAAEVANAIAYGYLRFTLDRKTRIAKQSKDWFVERVAELKREVSDLELALQDYAAQHQI
VLGQGEDVTRRNLSNIQERYTQAKIKLAEARARLDTVRSTRPESLQEVLENPVVRELRSRVSALESEYREKLVQLGEKHP
EVQTVKAKLDSSREHLQEQIAAIAASAIDSAQAAFEQARREEQQLAQLLADATREASEADRAMIEYEARSLELERKKATL
NELIAKENEMEQSANLGDTAHNVQIIDEAVPPEIIYRPKKKLNILLGFLLGLCLGIGGAVLAEYIDNTIKSPDDVRDILD
LPLLGMVPAPRPVKKAHGEEPVRCDPAVITAEMPLSPAAEAYRELRTAVLLATPGHPPRDLTVTSCQPGEGKTTTAVNLA
IALAQLGRQVLLVDSDLRRPRCHDVLGVEKDRGVSTFLTGLNDLDPLIQQTRIDRLSLIAAGPVPPNPADLLDSPRFAEL
VETLRERGEFDHVIFDSPPLLSVVDPVLIGRQTEGVVLVIRSGYTSREAGRLGKDKLEKGRATILGAVLNAVETEHVPYQ
YRYYRYAADDESRPRRRGRAARAGGQRT
>gnl|bykdb|A0A3M1WQW8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=749 residues).
MSERDERTHLPAPADTGAMDRNVVTRLYPIGYGHERYGTAVERDVHLLDYWRIIKKRKWIVLGVLMMVVTVVAIRMYRAR
PIYQASGKVIINQQTPVPLANRQEALPYSSNDTQYLRTQINVLQSRTLARRVIEELSLDRQPEFAGLARIRDATLRDKLM
VDRFLSGLRVELIRDTRIVKVTYESPDPQLAAQIVNALMDQLIEYTLMARFESTRQAREWLNKRLTELREKLEQLQEELV
RYSREHEIIQLDENQTIAIERLTDLNRRLVEAEAERIRAETLYRLSQEADVDTLPPVMSNPIVQTLRQRLADDRRRLVKL
QQQYTDEWPEIQSLKGEIAETEQQLAEIEKQILAKIEADYKAARTREENLRAELMAQRAETLRQNERAINLSIKQQQVEA
SAELYRSLLQKMNDVDLLSTLTTTNIQILDRAQVPTTPARPRKLFTTGVSGLVGLLLGIVLALFVEYLDNTVKSTEDVDR
LLGLPSLGVVPALESLERKKRLALPRWSRERRTTKPILILDDQRRSSFAEAFRSLRTSVLLSHAERPPRTILFTSSSPGE
GKTTTAVNTAISLTQTGARVMLIDGDLRKPGLHKMLSINHQPGLSTYLTRGITIDSVIVPNRIDNLWIIPSGPVPPNPSE
LLSSRKMREAVKVLSERYDFVILDSPPVSTPDALILSTMVDGVILVIQCGETPRELVQRAKQSLEDVNAKIFGVVLNRMD
VGQDGYYYYYYRYYYADEDPRDESPMVEG
>gnl|bykdb|A0A3M2BZG9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=801 residues).
MKMIPSSEQPLPRPAVRDDFLAYDAAPATATPVPPMPGDAGELDVAKYLGALQRRWPLILIFCALAAAYSLVRYSLTTKM
YQATAVIQIERRQLATIAMGGATNWLEEWWNLEYYPTQYRLLRSRGMAERVIQNLHLLQDPTFTGRSADLLPGAADATTV
DDDAAELARQAMRLQSGLVVNPIRDTQLVELTYRSDKPELAARIANGYAQAFIDWGIETRTSTVSRASTLLTSQIEELSR
EIEKLRTKLASSAAEANLVLDPDGEAIIERKKSLETTLNRAVIDRLDKQAIWDELRNLTDAEVANSLISSQITQLRSEVD
KLERQYRKALQTFRDDWPSVTKLKEELEGKRAKLTALVSAEVNQRRDLARTAYQEALRKEQNVEEELRKLTDEISAYSSS
ALDYTTAKLELETKQRLFNDLLKKQSEAEVASSFHDAKESNVRVVDYAIVPSAPFRPVLRKDLTTALLLGLLAGVGLILL
IEFFDRTIKSPEELEKITGLPTLTVIPDVAERNRSYAARLRYGLGNGYGYGYGYGYGYGYGYGYYGAEGRKRRKLKGASS
DEPEPDRQIELLPHRKPRLAVCEAYRSLRTALLLSSAEELRSVAVTSAEPGEGKTATTTNLGVVMAQLGRSVLIVDCDLR
RPRMHQVFKTSNRLGVVNHLTGTERAEDLVLPTAVPNLYLCPSGPIPPNPSELLASERMRELLATLRSRFDFILLDTPPA
LPVVDAAIIGQLVDGIVICARAGVLVREHARACRERLRYQRIRLLGTVVNRFNPSGASRYARQYYYADYGSDEQLPASTA
A
>gnl|bykdb|A0A3M2D491 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=832 residues).
MNKERDERLLPLPKEIQEYELTSRYYPSYGGSTELVEQRFDPREYLIIIYKRLPMIIALVVIVTSLVAFYMYRQPSIYEA
RAVLLIEPRRPKIQSKDTININFGYDMNYYNTQEKLLESPELIKEAVIKLGLYRNPELFKGQGRGVIASIKSLFSGGSDE
PSKTQSLPVLSENNDEGFSSEEIKLSPEERLRVERITASLAGSVDAIQEERTNLFSVKVVHTNPELAARLANAIVGVYID
RAARREVEGTRKSLEDLTKSIEELKENIAQLEQQRIEEMKSSGLPLAEKGQELAASILEQKSTEWLKAEAERRAIEQQYR
TAVEVAKKGEILSVASDNKFIITAREQQLKLKKDSEARLEDIEGQIEKAEKEKAALLARYTEEHPSVKQIEAQIQQLRET
KEKVKNEVEKKLELESKLLEQRAQKELLTALSAQLNAAKQKEEQARASYLAEVERSNQQGQAGMRLKTLTQAIDTNRELL
NTYIQRQKELELAISSSRPDNISIATEATKPDAPIGPQRNRNILLAFLASLFVGIGLAFLFDYLDDSVRTVDDVTKHLGL
PTLAIIPEATASKKTKLLPAGEKEQSSSVALVTLSSKQSPLAEAFRHLRTSLLFSSAGKPPQTILITSSQPAEGKTTTAI
NTAIALAQSGADVVLIDCDLRRPRIHEHLSLSNKTGLTNYLSGDQSLEGLLKPIPELPNLKVITSGPIPPNPAELLGSDE
MKALLNFLKTNFKHVILDSPPAISFADAAILSTIVDGVVIVAMSGKSSMNLMKRFKQRLISIGARIYGVVLNGVKPSSLE
YSYYGYYYGYYGYYGSSEKDDDVFEEKNGKEG
>gnl|bykdb|A0A3M2D6Y5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=826 residues).
MRKTNELIVREAQENTEVEFRSQPFVSSGNYYSAATRDSAGSLKLREYWNAIRKRLWLIVSIAILVTTLTAIYVARKPNI
YEAKARIQVDLEQNNPQLQVTDRPALLSNPDPAYFNTQLQLLTSDSLLRRVIKEMNLDTNKEFQEEKNQQRASAWRAFLR
SIGLVREERRKEDTKIDEITPGMNLASVEEMNEAIRLAPYVEIIKKKLQVEPVRESRATFKDTRLIEVRFQHTNPELAAL
VVNGIAEIFAKQNQEKRTGTSKRTNDFLSERIASLQAEIKRDEMRLAELKNSAGILKKDEGQTIVIDRLAGLNRQLLEAE
NARKIAEAEYNAVKDSPDRLKALVEEKLQRYITERENDMRALNNEATKRIAELEAEKARLLVEYQESALEVQEINRKIDA
LKRTVEVAQEKNRKDLEEYRSRTAKEILTNLQTKYEQAKAQEDKIRKAFDEQYRRAEGENRAAIDIRLLEQNLETNRGFL
KNLIEQQSSNDVIARGTENNISVVDPAIPPDTPVSPRRLLTVMMAFFLSIVFGVGLSLFLEYLDDSVKTVEDVETYLGLP
ALAVIPTIGVSQRRKLLPVGTGEENGSQGKAGSEILIYNSSNSSLSEAYRQLRTSILLSVAGHAPRSLLVTSSLPSEGKT
TTAVNTAISLAQTGAKVLIVDADMRRPRVHSIFNVQNREGLSNLLSSEIKADKVLDKVQFDSAAKLYILPSGPVPPNPAE
LIGSKSMLNLMEILHNEFTHVVIDSPPIASFTDGVLIASMVDGVIMVVHSGKSSRHVVRRSKQLLQDVGAKIFGVILNKV
DVNSQENYYYYQSYYYSSYYKKEEEK
>gnl|bykdb|A0A3M2D9H8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=616 residues).
MLPRDYLFLAKRWAWLLGVGVLIGLIGGLIYSLVQEPVYQATTKVMVLGAPQSNLSDILNQNTELLSQTFTELLVTRPVL
EAASERLGYYISSSQVRVQQVRGAQLIQIVVEDSDPQKAAEIANTLVTVFLEQNAKIQSNRFSASEESLQAQIQQVEAQI
ADLQKQLAQSSEQSSEKRLQDVTNIISGLQAEINQLQADIVRLESDHETVLGVNALGQPARVTPTLTVDQQIELTQKRSR
LDELKSLLNIYQQIYVNLSFSPASQSSQNGTNNQLQAALVLYQQIYANLLSNYEAIRLARLQSTPEVVQVEEARVPSRPV
RPQTATNVLLGGILGLILAGGIVFLIEYLDDSIRNGETVTKNLDLPVLGYISEMNGKLPREDYPPHVVAQPRSPVTEAFR
SVRTNLEFVEIDRPLKTLLIGSPGPDEGKTTVAVNLAIVMAQGGNRVLLMDTDLRQPQVHERLRLPNRLGLSDILREHST
LDESLHHLTTEGIDVLTSGTLPPNPAEVLSSERMATLLSEVATRYDKVILDGPPFLISDAIVLASRVDGVLLTLRARSTS
QSVTLEVLEQLDRVKARVVGAVLNRVQDSVSNHYYHNLKSYAYIAKESDELTLLED
>gnl|bykdb|A0A3N1JHC1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella sp. GAS466] (length=739 residues).
MRTPAGKLRAIAPAETPGPRLPSAGTLDPFRSSTVYGTPEEQIDYLLLLRRHRFAVMMIFALCLLGGLLYAFFVPKSYKA
QTVLEITGINQDFMNTRDADPYANGVTQDSYLETQIMLLKNEVVADRVAMVMAPRVPPSLASNDAGREGVVRNMVMDAKA
KEEGMSNLIRITLIGPDPHLAADTANELTNQYIQQGQNARLAAASETGVFLTQQLEGAKKKLQESGEALQEYARASGIVL
TSETQEPVAAEHLREIQQGLAQAEVDRANRQSAVEMARNASVDSLPQVADDPTMRDDRAKLTELHRQLAEMSTTMTPSNY
KVQKVESQIKELEEEMQRHRFTIVKRLSVEDDTAARRQQLLKQQYDRQLAVVTDQGSKQVRFNMLKHEVDVNEQVYQSML
QKAKEAGVIAALRAANARVVSPAKASLIPTSPKLSICIFLAVLLGGVFSLLYILISERRDNSVRNPGESEQYVERPELAV
IPRDRLIAKKSKAHPQMRLNGAGSKDVHPILEHWKEADKTFLTETYRSAGASILFSRNGGMAPKVLLVTSPHPRCGKTVT
IANLAISLAEGGRRVLLIDGDLRRPALPQLFGVQNIEGLSNTLDEAECADPNSLIQTTAFPGVSILTSGTTKGNIVRLLH
SSRLASVIGTVRNGFDFVLIDAPPLLGLADARILSKFTDGVIFICRAGQTNTDDLAEARRLLAEDGTYIVGTILNDYDLR
NEKSSHYSSYLTYVGNSSA
>gnl|bykdb|A0A3N1K1G7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella sp. GAS466] (length=750 residues).
MGPKETPPVAGAPDLSPSAFSSTATDTTLSEAIITLRKRRWILIVAVLLGLIYGVYKAETQPKLYEAYGRIQVRSGSSNE
YRVTAVQGYAGDAQSSRMLTEIAILQSDSLMLTVARELNLSNNSEFLEVKGPLPHTNLDDAAVRQSTVHRLQSNLHITLV
PKTDIIRISYSSRSPKLSADVVNKVISTYIQRSFETRFASTQRVSQWLQGQLDDLKQSVETSQEQMMELQKRLGILGFDP
SHNQISSSLEDLSKAAGEARIARIIAESRYRILSGMDPNTIEGSIETTPGTAPGELNTLRAQIAVARASYAQLEATMGPN
HPQAKAQKAQIDELAKEIDAEQSRLLLQAKQNYVIARANEDQTAAVLEAQKTDAYKLRDDLVEYTLRQREFESNRTLYEG
LLQRLRTAGVQAGLESLEIDVVDQALPPANPVLRPQSTIILTMLFVGLIAGIIIAFLMESLDTGLRSIAEIESITELPSL
AIIPRARRSSAEQAGNLTTAQRNISVLTQPKSQFAESFRALRTSLLLSTTGHPPKFILFTSATPSEGKTTTASNLACILA
QADTRVLLIDADLRRPNVHHRFGLNGKVGLTTVLTGATTLEDTVQHIPDAPNLDILPSGPVPPFPTEMLSSEAMNTLLRH
CGEVYTHVVIDSPPILSVTDGVILAREADAVVLVVRHGKSSKHVVRRARDLLLRSGAPITGIVLNAVDLNSPEYYGYYGY
SGYSYSSVDSESWESQAVGDSSRKAGGTER
>gnl|bykdb|A0A3N5M5V0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=776 residues).
MGDLIRREPSSFADPTIRMQRTGNYQWGPDEDSLDVRRYFQILRKRKWLIVAVVTTVLVLVAVQSFTTTPLYRATARIQI
DPESENILPYKDVYEGPERYLSSEVYLQTQLEILQSRALARRVVDRLNLANDPRFEVPVREGLVTSQLGSVKKAMSGLFS
KSDSGAAAANRESMPGMAENRAVIEKVLSRLEVTQVPNSRLVEVGWVSPDPSLASAVSDTLAEEFIEQNLQTKFEANTRA
TAFLKKQLQDMKGNVEKSEGDLYRYARENNILNINDRGSIVLQTLEDLNRQMTTVEGELIGKTAEFQAVRDATPEDFPQS
LRTPSISLLEERLFGLQQNLASLSAQFGNEWPAVVQVRQQIREVEQQLVREKRETIRRAQSEYKVAVNRQQMLRRALQKQ
KAEANQLNQDSIQYNILQREVDTNRQLYEGLLQRLKETGISAGMRTSNIHIVDHAQVPTAPYSPQRAADLALGFGVGLLI
AVGLAFLMEYLDNTLKTPEDMEQSLGLPSLGVIPAISDLPAGGSRLLAEKSTSGADKTELPARIAPTRFRVWEAYRSLRT
SILLSHSGKPPKVIMVTSSIPGEGKTTTVANTGIVLAQTGARTLLIDLDMRKPALAGTFGFTGNQGISSYLSGNADLSSQ
IRQTSYPNLFLLPSGFRPPNPAELIGSERMEAGLRLLGDYFKYILIDTPPLLSVTDGLLLSPHVDGVVLVIKGGSTPKET
VKKASNHLMSVGARVLGAMINNVDMDTPEYTYYYRDYYDDRYNSDLSSAAGSPGAV
>gnl|bykdb|A0A3N5PCI5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=748 residues).
MSDTQQPPSEHDAVTSRAEPQWQLEDVFAVLYKRRWIALFTFLIAAAGVVTYTMSVTPIYEAHTQLLLQQRASIVTFEGA
ADPQANERGYLETQHRLLRSRSLARRVIDALNLWDLGRAPADGNAQPAGTFAFLGQWRSWLGRAVGAATGATSSQEKEPG
SVRETVAESIAIDRLLANLRILPVRDTRIIEVRYESPDPELAARVVNTLATTYITHNLEVQSQASKEATTWLAEQLAEQR
RKVEVSELALQKYRERENSLSLEAGQNIVVQRLNSLNASVTQAKTDLIAVESLYRQLAASQRDQGALDTFPLIRSNGVVQ
EIRGRLANLQRERMQLASNLGAKHPEMVRVNSAIEAAERELDSEVAKTVESVRQEYLAALSREKELTAELDAQKSRALAL
NRQGIEYGVLLREVESNRQIYQNLLQRSNETAVSKDIQGPDIQVVDAAEVPRRPVRPDTRSTLMIGLLLSGILAVAIAFI
REAFDSRLQTPSAVRALGIPFLGMLPYVGKRALKGRSLLLTHGVPAPYAEACRALRTNVLASAGGGTTGRSLLVTSAAPG
DGKSIVAVNLAVALGRSGGRVLVIDADLRRPVLHQVLECEQRPGLAEVLTGKRKPSEAIVATRSPGVWLLPSGAGIASPS
EQLGSRRFSEFLARVGESFDWVIIDSPPVMAVTDPSVMAHLASGVLFVVNARHTKQRVAQAALDQLETAGATFAGAVLNA
VTLDRDHYYNSRYYLPFYGDYLTDKRSA
>gnl|bykdb|A0A3N5XQP8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=828 residues).
MADLAKQSRQGMQERGGGPRLFEPSPSSRDRSTVRFYWEAIIKYRRFVLLVLFLVVALVALETFTATPLYRASVRVEVDA
EPAKVLPYQEIYQVAMDPRSMESDLRTQYSILQSRTMARGVIKRLNLTNERLLQLREKSGVISETLRQVMRAVRGVIDRL
IDEGGPGGQNDPTEYMIDRLLSDLQINPVLESRLMDVSFSSPSPKFAAMVANAWVEEYIEQNFQSKLKTTEMATKFLAEE
LKELRVKVEQSERDLNDYARTKGIFTTEGSQNEVTQKLNDLNTEITRAQANLIAEQSQYDQARAASATRVPTNLRSSVTE
QIEARLSALRQDYARLTSQFGPEWPEVIQAQRQITQGEQELKQERERALEEAQGRYRASLQQYSQLSRVMDRQRQLAYRL
NSDLVQFNTLKREADTNRQLYEGLLARLKQAGVEAGFRSNNIQIVDRARTPLNTWWPRRTMNLALAFLGGLFLGLGLAVT
LHLLDNRVHSPEDVLALHIPALGIVPKSQELTNGANPLVLALPEQVQADHRSASDQDRMGSALARSAALDSPMWEAYRRL
RTCLLLSHPDQPPVRILIASAMPGEGKTTTAAYTGVVLAETGAPTVLIDLDLRRAGLTGLFEIENKWGMSVYLSGHSDLE
QEIQPTGVPNLSILPAGLRPPNPAALLSSKRLPNALERLTKQFRFIVIDTGPLLCYTDALIISTVVDGVVLVGRADQTPI
RNLKLASEQLTGVGANLLGVLVNGLDVTEFGYGAYGGYYPYGDQHRTHSWTRFFTDWARVQTLWNRMRVRNGSSNGTRVA
PRKASRSRGSKARSQNERPSESGPDLTL
>gnl|bykdb|A0A3N5YNR8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=772 residues).
MGDLIRREYSSIPDPSIRIQRNTEYQWASDDDSLDIRRYFQVLLKRKWLIGLVVGAVLLLVGLQSFTTTPLYRATARVQI
DPESASILPYQPLNESAERYLSSEIYLQTQLEILQSRALARRVVDRLNLANDPRFSVPVREGVVTSQLSWLKRTVSNLRP
GRSDAPKTGADESGAGRDKNRDVLDTFRDRLEVAQVPNSRLVEIRWVSPDPTLAAAVSDTLAEEFIEQNLQTKFEANTRA
TEFLKKQLQDMKGKVEKSEQELVQYARENNIVNIGPDRGSIVLQTLEDLNRQMTTVEGELIGKTADYQAVRDATPENFPQ
SLRTPSISLLEERLFGLQQNLASLSAQFGSEWPAVIQVRQQIQEVEKQLQREKKETINRVQSEYRVAVNRRQMLLGALNR
QKSEANQLNQDSIQYNILQREVDTNRQLYEGLLQRLKETGISAGMRASNIHVVDHAEVPETPYSPQRAGDLALGLGVGLF
LAIGLAFLMEYLDNTLKTPEDMEQSLGLPSLGVIPAMADLPAGSSRLLASRNESGDSKTGLPAPISPARFRVWEAYRSLR
TSILLSHSGKPPKVIMVTSSVPGEGKTTTVANTGIVLAQTGARTLLIDLDMRKPALASTFGYNGNQGISAYLSGNGDLSS
QIRQTNYPNLFLLPAGFRPPNPAELIGSERMESALRLLGDYFKYILIDTPPILSVTDGLLLSPHVDGVVMVIKGGSTPKE
AARKAGNHLSSVGARILGALINNVDMNAPEYSYYYRHYFDERYNTDLSSAAG
>gnl|bykdb|A0A3N6A5T6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=794 residues).
MADLMIPGTEGLPTQIRPSPSPNWAHQKPKAPSKVEVPHLRDYWNVVLKRKWLVLTVLVTVVVGTAVQTMTTTKVYRSTA
RVRIDPESTNILPYEDVYQAADQGIAMETYLQTQFKILQGRTLAERIVKQLQLHENPSFNAETSGGLLTDSLAGLIGGTI
ALLKGRQPETPDSAENRLDKDEADLSADVDRFLGSLQVQPIRGSRLVEVSYASHDARLAATIVNTLADQFIEMNFESRYQ
ATTKATEFLQKQMHELKVKVEKSEEQLVAYARAHNILSLAGSSSKEGDRSQNIIMQKLADLNQEMTKVEAQMIERSAEFD
AVKNATVQDFPDALVTDNIRQLETTLADLEQKLANMTSHYGPVWPEVVQLKREVNEVNTQLVREKKRAIQRARAQYQVAV
DRRNRLQTALVAQKEMADQLNENSIQYNILQREVETNKQLYEGLLQRLKEAGVAAGLKSSNINVVDRGETPRRVYRPRTA
INLALGLILGLMLGVSMAFFIDYLDNTIKTPDDIEKTLDLPSLGVIPAFKMFETPVGTRLLTAASTQSTDASVDAVLQGS
QDMRSRVWEAYRSLRTSLLLSNSGKPPQIILVTSALPAEGKTTTALNAAIVLAQTSARTLLIDLDMRRPKIGSHFGLNGH
QGMSYFLTGNSDLTSQVRKTSVPNLFVVSAGYVPPNPAELIGSDRMDKALKLLRDYFQYVVIDSPPILSVTDALVLSPKV
DGVVMVVRGGETPREAVRRASEHLNQVGAKILGVMINDVDIRKSEYRYYYKYYYDSKYYSGYGYGGDKEDAGKS
>gnl|bykdb|A0A3P0X3W6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidipila sp. EB88] (length=730 residues).
MSSVYNNKPRILPASAPPSQIAHYTGPQAAAEPDELLPMQHYMWLLRRAWWKIALFVVTCTALTAVACFLMTPVYEATVR
LAVDSKVPASVIGQDSATPNISDVEEFLTTEIDLLQSDAVLRPVAKAYHLLPRDKKGKEFLPAGSVTLPGLTITHPASSL
LLKITYRSKDPRKAADVANAVAHSYIDEAMDMRLHSSMNLSGFMAKQLDDLKANMDKSAEALTTYQRQLGVIDPEQQTSI
LSARVAQLNSEYTEAENDRIRKQTAYQGVKSGNASAIDISTQAEQLTRLQQQMQDAEQAMAIVQTHYGPNNANYKVAANT
LAEVTREYQAARDNTGRRIQTDFAQADTREKMLAATLAAAKAQSDALSLKSLEYQQLKRDADANKTLYNELFQKIKEAGI
NSGFQNSSIRIADEARPQNAPVFPKKGIFIFIGFFLSGVIAVAATLLSDMMDKSVRDPEQARRSLQVEVLGILPDVLQLK
PAGRQLLLKSGSDVPAPVAGKQPLDWSRTQDAYTEAIRTMRSLVLLERTREKLRSVQVTSAVAGEGKSTCTAHLAIAHAM
QGRKTLLIDADLRRPSQHNHFSLPNEEGLADVIMDGRSLADVLHTIEGIENLHVVTAGASAMRAAHLVGNKMAALLTDAE
QDYDLVLIDTPPMLGLAEPIQIACSVDGVLLITQAGETNQDAVAAAIGTLNRLDVRILGLVLNKVRREMSSTYQHFGVYG
QYDERVLNAS
>gnl|bykdb|A0A3P0XH15 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidipila sp. EB88] (length=751 residues).
MEGPAVQPERQVAAGPQLAPEQAIITPSDIRKILIKRKWLILAGIVVGLAFAAVYILTTIPQYEAIALIDINEGQQSNIG
ISELVQQEQGGIEADLTRTATEIAIMQSDTVSLDVINSLDLYHKQPFAQVFVRQPYNGKLTPNQRIEMLSIFKGSTKIAT
KPGTQLVEVRFRNQSPAVAASVSNAIVDRYMDRSRRARYEGTTRISEWLAKQLEPLKNQVTESQDALSTYQKQNNLIGVD
SNGSGQDLTIEDMRVANQQLSEAQADRVVKEARYRMAMTRNPELLLSVAPSATLSQLQQQAAALTVQQAQLQSKFGPEWP
RVKEVQGSLVQVRKAIDVEINNMQQRFQVEYETALSTENLMRKRLEDAKQQAYQQNRSSAEYQILRHGADSASDLYDALQ
TRLKEAGITAGLNATQIDIVDRAVTPALPVFPVKRNDAAIGLAAGLVLGLALALFAETIDDTIRTSDDAESVVGLPSLAV
IPHFEPAQKKGVSAAGTAAAEAERERMARVSPDLISYTEPQSYVSEGFRTLRSSILLSAVDREPKLILLTSSFATEGKST
CAANLAISFARRSARVLLVDTDLRKGTLHMKFRTSNRFGLSTLLVRENEESSYENPLPDLPNLTLVTRGPVTVNPGEALA
SRSMEELLQRWRSEYDHIILDSSPVLAVADTLSIAPQVDACFILVRSGVTRKKALLRTREQMRRVNSRVQGIIVNDVDLR
LENYYTYSKRYNYSYNSTYGAGYGGGMDAEQ
>gnl|bykdb|A0A3R9WF43 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Edaphobacter aggregans] (length=771 residues).
MDRSPPKVSITKKEHRSFLAEMQTRAHLAPVNASEYESLSGLLRVLRRRWRSAVLVAVVIALLGTVAVLLMTPRYSATAT
IEVNREDHEEASGPRTDTPSDSADDLKAEVQTDTSILQSDGLVLRVIKDLDLAKKRPFLGAIVRGEADKPLEDAPRTRER
MVKLFRKNLKVDSPPDTRLINVTFENPDPTVAALAANSLAKTFIDDYLERRHRSTSQASYWLQKELDDLKKQVRDSEQRL
ADYERTTGLAGVQVSGSTSGDGTSSVSVNSHNTVLDRLFTLNQEMTSAEANRISSEAVYHLVKTQNPEVVLGLGSMSIAS
GNGSSSGALTADGGVDLLRSLRTQEASLRREYASYATKYGEKNPRLLQLQEQINAVDAQMQTEMARITKRAENAYQYAKD
NENSIKGQFEKQQHEAIQLADNTVQLQVLAQEAYSNRALYQNLFSKLQEASLSSGVRATRIDVVNEARPAGTPSSPDYPK
YLTLVAGIGIFLGISSAFVRESLDESIRTPLDIEAASHLSILAYIPTKSRAETVTAGTVGECALITNPYSPFSESFRTLR
TSILHSHSVTRLQTLLVTSPHGGDGKTTVAYNLAVAFAQQGSRVVLLDADLRNPDLHRLFGCENSPGLGDVSAADTHIEV
SNLIQHSSIKTLYILPAGNRPDLPSEFFSSATFDAVLEMCTNRFDYVVIDSPPILRVTDATIIAKKVDGIITVLRSQATT
RSMASSVAQILIRTHAPALGFVLNGVHNPSLDGFHDYSYLREKGSETHADA
>gnl|bykdb|A0A428MDU2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Edaphobacter aggregans] (length=749 residues).
MGLENPQQPGPGAPETNPTGFSTTVTDTTLSEALITLRKRRWILITSVVLGIAYGVYKAETQPKLFEAFGRIEVRSGSSN
EYRVSAVQGYASDTAASKMLTEVAILQSDSLMLTVAREMDLSNNPEFLEVKGPVSHTTLDDAGVRQSTVHRLQSNLHITL
VPKTDIIRISYTCLSAKLSADIVNTVIATYVHRSYQTRFDSTQRVSQWLSGQLDDLKQQVQTSQERMMDLQRRLGMLGFD
PSHNQISTSLEDLSKAAGDARIARIVAESRYRMLAGMDPNTMEGSIETTPGTAPGELNLLRGQVASAKANYAQMESTLGP
NHPQAQALKAQIDELEKEIDAEQKRLLLQAKQNYVVARTNEDQTSAALEKQKSDAYKLRDDLVEYTVRQRDFESNRTLYE
GLLQRLRTAGVQAGLESLEIDVVDQALPPASPMLRPQSTIIMTSFVFGLLGGIVLAFLMESLDTGLRSVAEIESITELPS
LAVIPRSRRAGVSEAAMSTAQRNISVLTQPKSQFAEAFRSLRTALLLSSAGHPPKFILFTSATPSEGKTTTASNLACILA
QRDARVLLIDADLRRPNVHHRFGLNGKVGLTTLLTGASKLKDTVQNIPNVPNLDILPSGPVPPFPSEMLSSEAMDAFLNH
CGDLYTHIVIDSPPILSVTDGVILARRADAVVLVIRHGKSSKHVVRRARDMLLRSGAPITGIVLNAVDLSSPEYYGYYGY
SGYSYSSVDSESWESQTVSASSNGAGGRV
>gnl|bykdb|C1F294 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacterium capsulatum] (length=759 residues).
MDTLDPQRQSGSAIASADEKTVAPQSTINLSDLRKLFLKRKWIILICVLAGIGVALYHVETATPQYEAVSSVSIDMNKST
GVELTSLASSSGGLQSQDRVETQLHIMQSNTIAWNVIKTLKLYNKPPYSGVFKKAGYHGTVTPSQKLALLNTFKGATQVV
LVPETDLAEIHFQNQNPKVAQEAANEIVNAYQDWTLRAHFETMTRISDWLSQQIISLRESVNKSQNDLVQYQREHNLLSV
GQQGSSLVDANLETINSQLAQAEADRIVKEARYKMALTRNPDLLVSVAPNTVLTSLRSQEANLLVQQADLQSRFGPRYPK
LEEVRQQLKQVRSDINKEITNLTQRFKAEYDAAVQTQNLLEARLENTKQQAFKQNESSAQFEILKHKAQTSSELYDALQL
RLEEAGITAGLNSNSLEVVDHANLPVIPVTPQKKRTVVFGFLGGLIAGIAISLLLESLDDTLRTSEEVESIGHLPALAIV
PRFVSGAKRKTAYGSYGAEKRPKEPVAEKEDQISRDLLTLLEPQSIVAEGFRTLRSSILLSSVDREPKAILLTSGLAAEG
KSTCAANLAISFAQRPARVLLVDTDLRKGTQHLKFRVSNRVGLSTYLSRESGEESIVFPLPELPNLGVLPRGPVAPNPGE
MLASRMMADTIQKWRSEWDFIIFDTSPVLAVSDTLNLVRHMDGTLVVVRSGITRKKALQRTRELLRRANARILGSVVNGV
DMRLENYYTYSRGYSYGYRSGYESAYGAGYGVEDTDDKG
>gnl|bykdb|E8UZE1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Terriglobus saanensis] (length=732 residues).
MKNPGIPDEVAARSSFSAVGLPEIYRLLKRRKWLVLLIFLVFVAASALYTLRLPKRYEALCKIDIDLSTPKSVLALDSQS
TASVATEQKMATQLSILESQSIAWKVIEELKLDANPVFSGITSSATPKPLNSLTDQERYSLIRRFQSGLGVQLERGTEIV
QIRYKSTNPALAATIANTVAAKYIQRNFETKYNTTHETSAWLQDQLETLRHQVDADQKNFEEFQERTGLLQTGEGHNAIV
DRLSQLNSDLSKAQADRIMKEVTFRESMVSDADQIVPTTTFPGLTSLRAQKITLESQYASLSSKYGDSYPRVAQIKSELA
EVNRTITTELRRGRNQLELEYKLASENENKLRAATEAQKQQIFSMNEDALHYSILQGQVASGRALYQDLTRKLQEAQITS
GLSSDTISVIDPALTPNIPSEPRRALNMEAGALLGLVVAFAVVFLIENANATIRTGEDIYRYSGLPLLSIVPHLSPAQRN
MKLGKKEVAGTADSLGLEPRVLQFPQSHFAESFRVLRSALLLSHAGNPPQLIVICSAWTKEGKSTITINLATVLAQMNRK
VLLVDADLRRPSLHHKLGLPKTEKGLSNLLAVSQSPPLVEYLHPAAVFPGLDFLPAGPLPPSSSELLMSPRMSELFEEWR
KAYDFIVVDTAPLLAVSDTTALVATADTTVVVVRDDATRKQSLQAVRDTIVSVRGRVAGVVLNDVKTSSEAYYAYYGNQD
GGAAYYAEAENA
>gnl|bykdb|E8WVF6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella tundricola] (length=753 residues).
MSSDNPYSNPGPGMSQAQQPTFVAPSNDTTLSEALITLRKRRMVLIIAVVLGTLFGFYKSVTQIKPYEAYGRLEVNTGAS
NQFKLSPFSGLGDDPQQKMMSEIAIITSDTLLTTVAKEMNLANNPTFLSVKGPIPHSSMEDPRVRQTIVGILQKNLKVTL
VPKTDIIRIAYSSLDPKLSADVVNKVIADYQQRSYETRFDSTKRVSQWLSGQLDDLKRQVETSQEQVLDLGKKLGTLGFD
STHNQIASSLEDLAKASGTAKLARIIAESRYRMLNGMDPNAIEGSIDAGTTATTGGATNGLANLRSNLATARATYAELTA
TLGPNHPQVKAARAQIDEFQHAVEAEQNRLLTQAKETYLIAKANETQTTAALEAEKQDAYSLRDAQVEYTLRLREFESNR
TLYEGLLQKLRTAGVEAGLESSEIDIIDQAVPPSDPQSTPQSTIILTYFAVSLVLGTLLAFLLESLDTGLRSVAEIEAIT
ELPSLSIIPRARRATPEQLAAMSTVERNINVLTQPKSQFTEAFRSLRTALLLASTGKEPRLLLFTSATPSEGKTTAASNL
AVILAQGGTRTLLIDADLRRPNVHHRFGLNGKLGLSTILSGQTTLENSVQTLKEVPTLDILASGPVPPFPTEMLSSASMA
ELIRHASEIYTHIVIDSPPILSVTDGIILSRQVDVCVLVVRHGKSSKHVVRRARDLLVRSGAPIAGIVLNAVDLNSPEYY
GYYGYSGYSYSSLDTAGWDAKSESGKTRKRDDR
>gnl|bykdb|G2LEI9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Chloracidobacterium thermophilum] (length=863 residues).
MPQEHPNNNVMLAPTAAELDLATPTVQDRMRRRGSYQYTLPQEDAGQPIRQAFLTILRYKFTVILCVVLTMTVTGLALSR
MQPVYEASSHIEVAPEKELYSSSGRIAFVPYSVDPDYLNTQIRKISSPSLLVEVVKTLKLDRDPKFLATGPTTLSAALLD
LIRSPRGPRKPPQSETKSAELPEASPTPATTEDELQRYAPQIGRLASGLQAYNVPRTRLVRITFQHHDPETTKAVVNTVA
EVFARRNVSDRLQQGSSQKEFLSSTAARLQQEILEEERKLTEYLRTRKIVSLKPEDNPEVARLTGLNQALLEAEKERLRA
EERYQASLTQPIDSLDEMQSDPELQKLRGKISELKQRRLELLGTYTELHPDVVQIDQVLAQAENELKEAKANTLVRIKTA
YENAKRREEELRARVEKQRNEVVTQNGDGVMQRMMQDNIDNKKKMLQALQATTKDTEINLRMDLNNITVVDRAGTPGAPI
SPRVSYTLSVAFFLSLFGGVGLAFAREYLNTRIKSVEDVDRLLNLPTLGLIPQVSPKELSKSSGYYSYGGETRALAKLAD
GRPLPADFNVGLSAFALSASPIGEAYRQLRTSILLSSSEDVRNRIILITSSQPGEGKTTTSFNTAISLAQTGASVLLIDC
DLRRPQLQKLFDSYGQERTFQPGLSRYLSGQCKIGEIFTPSPIPYLTLITCGQMPPNPAELLGSQRMRSLLAYAVEKFDY
VILDTPPMLSFADATILAAMADSVILVVNCQRSKREIVKRTCRKLDETNTRVLGVVLNGMTQEQSSYYGYDYYGYSSYYR
YSQAVTVNGDGKASGPKPPPSASEVFEQLKVALDEQQAADDRVPPAPDASPAGNSSNNGHKAG
>gnl|bykdb|G8P085 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella mallensis] (length=740 residues).
MRVQTTQPDTEGKLDQRSLTEADSASALSLGDIAQMLGRHKWFILACIVIGTVVAVVYVKSVTPIYEATASIRIDPGRIG
SLGLADLTGTQADSAELIATEMAIIKSDAVAIDTMHSLSDEEFREYAGPNAKQLAIPLGAISLSPAQEEMLSHFKSQINV
LQVPSTQLVTISFRNPNPQVAALLANRLIEAYLRQTFDSRYGSVTQVTKWLSSEMDSLRERAAEAQKKLADFQEKNNILM
LGGGSSGSSKDGGGESPSPSASTVTDRLTQLNNRLTVAQGDRIVKEAQMRAAENGNTAVLAAMFPSANLAALQSQQATLY
GQYVQLSTKFGQNYPPLAQVKDQMQKTDAELERQSSIVKNRLKQEYDTAVAIQSSLQQQYDEQTDKAYALNRKAAEFAVL
YAEGSSSRELYNTLQYKLQQAGVDAGLQSVNTMRVDTARAPLIPVEPKKLVILSFGLVLGLFAGVGSAFLREALSDKLQS
VDQIERALGYQLLAIIPHISIAQRTDNKGDAPAFDASQMLVAYNSPLSVNAEAFRNLRNALLLSSIDRPAKMLLVSSTIP
GEGKSSTTANYGVVLAQKGARVLLVDADLRRPALHSKFGVENKRGLSNLILGDDTAEPFTNPLPDLDNLFLLTAGKKVAL
PSEALGSNKFYSLLQQWEQEFDYIIVDSAPLLIVSDSLPLASWADALILVTRYNMTPLGALKRIRDVLRHTNAQVAGVVI
NDMAVTQTGYYGGYGSGYYN
>gnl|bykdb|G8P0Y7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella mallensis] (length=779 residues).
MSTGRMRGEFAEPVRHDSPRLASLQEMYRPPAREHSISDYWHILLKRKWIVIVSVAIVLITTALISLHTTPIYEAVTKIT
ISPPTSNPLNFKDNNSSSSALEDPQAGINTQVKILQSDTMAELVIHRMNLDTRADFAGRAQTQSNGGIAVSQSPAEESFR
LESLIRKLQGNLTIQQIPDTTLVQVGYSDPSPALAAEIANGITAAYIEQNVKSRYDSTMQAADWLSKQLADMQIKMETAQ
AKLVQYQKEHAIVGTDDKQNLTTEKLDELNRELTSAQADRIQKESLYNVAKRGDPSTLSVILQDPILSALRQRQSELQTR
YAQLDTWAGQSYPQMREITSQLDQLNKSINEQVKNSVSRIHNDYQTAVNREQMLQEALGEQMGIADQLNQNAIEYKILKQ
EADSNRQIYDGLLQQLKEASLAAGLTSSNTRVVDRARLPRYPTKPNIPRNLEFALLVGLVVGIALAFGLEALDATVRTPE
QAETTSGLPVLGVIPMQPVFDKAGTNAARSRLLNKMPGTGTGPQPLISYLEPRSEIAEAYRALRTSILLSSVSHPPRSIL
VTSSVPEDGKTMTSINIAIVMAQQEKRILLVDADMRRPSVHTAFKIKGHVGLSNVLTGGAKVRDAIQSTVQPNLFVLPAG
LVPPHPSELLSSSLMRDLLKKWCEEYDHVIIDSPPVITVTDAVLLSVETDAVLLIIRSGQTTAAHVRHTCGLLHSVNADV
LGVVVNAADLGSPDYYHYGGRSGYYAANKMKSQEMKPGEARDLDQNPESEHDETLHTSS
>gnl|bykdb|I3ZEU5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Terriglobus roseus] (length=753 residues).
MPPATNQPVPTDPASPTGFTTTSADSALSEALAVIRKRKWILVACAVIAILYGYYTASTQPIIYTATGRIQIHEANSAAT
QLMGSVGSQETNLENELGIITSDSLLLNVARNMNLINNPDFMGIRVGKVRDINDPAVRTDVLQRLGNSVNASIIPRTAMI
KITCTASRPQLAADIVNQVINAYQQRSFETRFESTKRVSQWLSGQLDDLRQQVETSQEQLIDLQKRLGVLGLGFDATKPP
TTQLAVSVDALSTASVSAKVQRILAESRYRVLASSDPDLLESNLDVAGGQSELSKLRSDAAETQASIAELSITLGAKNPK
IIALRAHQREVQREVQAEENRLLTEAKQALVAARANEDQTTSALEQQKQESYRLRDDLVEYTLRQRDYEANRTLYESLLS
KLRAASIQAGLDSLEIDIVDQALKPAGPSMTPRSTILLRTVLIGLVAGLMIAFTMESLDTGIRSVAEVEQITQLPSLAVI
PKVRRLSSDTGSMSVAQSNIGVLATSKSQFSEAFRSLRTSLLLATTGHPPKIILISSSTPGEGKTTVATNLAAILAQRET
RVLLIDADLRRPNVHHRFGLNGRVGLSTVLSGGSTLEEATKNVAEIPNLDVLCSGPVPPFPTEMLSSEAMHDLLLHCCTL
YTHVVVDSPPILSVTDGVILARQADAIVLVVRHGKSSRNAVRRSRDLLSRSGANVTGVLLNSVDITAPEYHGYYGYSGYS
YSNIDSESWESGSTGTGDGGPRNSAAGQGEDKA
>gnl|bykdb|Q01X01 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacter usitatus] (length=559 residues).
MECARTLYRRKATVLWITFFAVIAAALISVAQPRMYESQASIQVQGVNENFLNLRDIFPTAAPSADSAVYVQTQAEMLQQ
DALLERVVKKLRLEDRPEYQRSSSLWDRLRPGTSQAPVTRTAVDEVRKNLQIISSRGTSIIRIVAEAREPQLAADLANTL
AQTFIEQSIEARQRSAQQTFASLSGDLKEIRNRALQTESDLNAYGRGKRAAGRAEGDGNREFYDAMARRANEASVASTLR
QSNVRLVDPAQPATHHHKPNVPLNLLFGLFGGLALATGYVMLQEQTNSALRSPGDAGAYLTLPELGAIPRAAKRKFAVLG
FLSESNGKSQVERASLEQPASHVSESFRATLASILSSSHNGDHPHVLVVTSSRPMEGKTTVVSNLGIALAEIGNRVLLID
GDLRRPRLHKVFDQANSWGLSDLLREKNAIEDLPLDVLVKKTAVPRLSLLPSGTGTDNIFGLLCSGRMARLLPRFRQEFD
YVIVDAPPCLEFADARIISRYTERLLLVVRADYTDRKTAQAAVQRLLLDGISVMGVIFNYWDPTVNDLYSYAQYHQDIA
>gnl|bykdb|Q01XL7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacter usitatus] (length=772 residues).
MNDHYEPESNGSGPHGLPVGPDVRMLPSPSDGWVPEPTKISYWKIAWGHKFILLLCIFAGALGGTAYVILKTPEYAAAST
VELIGFNQSFMNMSQVDPQAGTDMTTASASNIQTQTRILTSRSMLARVAERMSLEMTPIASTPTTFFTKLRAHIPFAQKE
PLEQMKEAVRTAAFTVSARGVGATRLIELRCQSPSPEVAANFLNTLAAEHISQNLAIRSSATQRTSQWMDSQMEEAKSRL
QTAGEKLRDFVRQSGMDFFPEQSTLADSKMKVLQGDLAAIQADRIAKQARWEMAKNTPIDSLPDVLSDPTLLGLKSRIVD
LRREMAQLTATLTPEHYKVQKIQAQISELQQTLDKEKTGLLKRLDNDYQEALRREKLLSGAYNAQTHAVGAQADKASQYA
MLKRDAEMAQQVYNGLLQQANQAALIALVPASNIRVVDAAVADNIPSSPTPMRDIPTWSLFGGALCYGLLWFREVLRRKR
LTQLFESPGHTRTILGVPELGVIPSATIDRPKKLAAAQRALNGATSIHPLGTLVEDGQKTLEFATWQNKSSILAESFRQT
LTSILRAQPKGECPVYVITSGGPGEGKTTLSANLAIAMAMIGQRVLLIDADLRRARLHSVFGLDNCPGLSDLLTSTESLE
EADLAPYLSPTKVDNLRVMTHGLAQVGTPATLFFSPRVKELVKKLRGQFDYILLDTAPVLLFPDARLWGRHSDGVVLVVR
AGVTTREGATSACQRFAEDGIAVLGTILNDWTPKEGSPSHYYYHSYEAYGQK
>gnl|bykdb|Q1IJZ6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Koribacter versatilis] (length=774 residues).
MDSLFRKSELPPLGVSEQSTTNAGLEDEDLSLRQVIRILRKRKNLILGAAGACLACALLLSFVMRSYYNSSATIEIQKDQ
DASLGSALDTLASTVGGGSGDTKTEVQTQVAILQSDDLAIETIERTGFEKHIGSYWHLFPSGRVTSEQGLPLRNAPRQRE
AMLKKFGKALTVTPIPDTRLIQIAFEDPDPNFAAQVLNTLIGQYTQDVLTRRNASTTQASEWMSAQIKDLNQQVEAAQQK
LINYEKESGLIAITATDPKNPAAAPVLHIPALDRLTALNQDLVTAEASRVTREALYRLARSGDLDRLTSLGAESLTSPTD
QAQAAMFTNLQALRQRQSQLKQQMASAVQIYGARNPHLVDVDKQLSDVDSQIKGELKLIVDRTELDLELARQSEDALRQA
YEKQEQEANKINDSQIRLAVLQQEADSTRQLYETLYGRLEVSKLDEGIKSTNVAVISAGLPPAKPSHPDPLVNGIVGLGG
GLFVGLILAFVVETLDDSVATTTDAEELTGIAVLGVIPIVNENPRVLRAAGRAKANGSNGSKPGRPTAMVYEQAMATEAF
RSLRTTLLLSQAGSAPKSLLLTSSLPGEGKSTTTYGLGRCFGSLGTRVLLIDADLRRPTLHKHAMKENDRGLSNLLTSVA
EPSDFIQKDSSAPNLDILCAGPIPPNPAELLASNVFSDLLKRVVLEYDLVLIDSPPAMLVSDAAIISSRVDGVVLVARAG
IITRAALGKAVEVLRRNKAPLRGLVLNAVNTKGTDYYYSHGYYGYDSYGSNGNA
>gnl|bykdb|Q1ILD9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Koribacter versatilis] (length=756 residues).
MSATNLATRKDLLPQNGKGARWQPSESDGQKIDFDGLFRIIVRRRKLLAAGVLLGILLATAYCILKTRRYEGEATVYVHP
EGSDVLGSMPDLGLSSGMDWNSQLATQIKILQSDALAWDVVKRLRLDQKPPFAGDKLYTEGSGTWYSHHGLRSLPNEPLS
NIGNARRQQLLARFQLGLDVTEVPRTGIVQLRFRSSDPELAAAVVNELAEAYTEHNFQVAYESTIKASDWLAKQLVELKT
GIQSSEQQIADYQKTHKIIGTDENNNLTLATLDDVSKQYTDAQADRIMKEAKYRLAKSGNPELIGMLVPDSVLPVLRTQE
ADIQNQLSQATAIYGPNYPRVVELKKQLAQVNASLAKETRDIEARFSSEYEASLNTENKIKGNFDQHQQEALSKSQNFSE
YSRLRREVDTSRDIYDDLLRKLREAGVMASLKAANIDVVDAAPVPIKPVEPAMKLAMALGLIGGLFMGFAGVVVAEAVDQ
SLKTPDDVELITSLPVIGVIPNTAVGRSSNGRPGRTAVKQEAMGIDVLTRPNSQFSESFRTLRTSIMLSFPSRPPKSLVV
TSALPGEGKSTISMNVAGTLVQRGARVLLVDADMRRGRLASRAGAQEGDGLTECLSGLRRWTDVVQDASGIAGLRILSAG
VRPPNPAELLSSDKLKEMLEEWQKNFDHVIFDAPPALVVTDAVVLALLCDAVLLVARSGVTHRSALRRSYEMLLHDGIRV
AGVILNMYNPAGDYGYYGSNYYSYYHEGEGVKADRD
>gnl|bykdb|Q1ITG0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Koribacter versatilis] (length=743 residues).
MEKFSQIENVQGASRTSWADVQEDREADLLHVLYVLRRHLQMIIGVTAFGVLVAILFCLFMKPRYEGMADLNVHPEESAA
LDMGALGDLATGAGGLDWSSKLETQARILKSDTLAWDVISQLRLDQNEAFATKSLFGRSLQTPVGKDVSSVDEARKSKLL
TRFSKALRVEAVPKTQVIEIRFRSTDPALAAKVVNTLTSSYMHHNFMTRFEATMQASAWLQQRLTELKNNVEESQRKLAE
YQSKANIIGTDETDNLAVSDLTDVSKQLTDAESDRIMKEAKYRLAQTGNPELIGTILPDSVLPVLRSQEADLRNQLAQYS
TKFGSNYPKVIQLNNQLAQTDASLKKEIRDIEERFRTEYESAKRTEDQLRASVENRKKEAFSQSAKFSQYDILKNEVASG
RSLYEDLLRKLNEAGIAAGLKSTNVDVIDPSAVPQLPVLPNVPLFIALGLFGGAFLGVCSAFVKESIDQTISSPEDAEEM
AGISTIGLIPHFSMEGLNALATENQSVLARVPLAADRPQSKLAEAFRALRTSLLLANAGAPPKVIMITSAQPGDGKSTVS
VNISAVLAQSGARVLLVDADLRRGVLARNLKVMPEGGLSECLAGRKSWRDLIIPVNGVANMWVLPAGHRPPSPADLFTSN
KMEEILNEWRGAFDHVVIDTPPVVAVTDGVVLSQKTDAVLLIARASRTGRHPLRHARMLLAKVRANVVGLVVNDFDAKAK
YYGYSYSYDKYYVEDKTETTVNN
© 1998-2019